| Basic Information | |
|---|---|
| Family ID | F055976 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 42 residues |
| Representative Sequence | SDTLKKTSTDSGDSHLEGKYGRGRGPKIILKTSYGSISIHKTS |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 89.13 % |
| % of genes from short scaffolds (< 2000 bps) | 77.54 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.884 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.841 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.812 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.522 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.99% Coil/Unstructured: 69.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF00275 | EPSP_synthase | 39.13 |
| PF04185 | Phosphoesterase | 13.04 |
| PF06940 | DUF1287 | 7.97 |
| PF04011 | LemA | 2.90 |
| PF00486 | Trans_reg_C | 1.45 |
| PF02371 | Transposase_20 | 1.45 |
| PF02517 | Rce1-like | 1.45 |
| PF00291 | PALP | 1.45 |
| PF13442 | Cytochrome_CBB3 | 1.45 |
| PF03683 | UPF0175 | 1.45 |
| PF12704 | MacB_PCD | 0.72 |
| PF08338 | DUF1731 | 0.72 |
| PF06580 | His_kinase | 0.72 |
| PF12483 | GIDE | 0.72 |
| PF01694 | Rhomboid | 0.72 |
| PF13620 | CarboxypepD_reg | 0.72 |
| PF07944 | Glyco_hydro_127 | 0.72 |
| PF13349 | DUF4097 | 0.72 |
| PF00583 | Acetyltransf_1 | 0.72 |
| PF16538 | FlgT_C | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 13.04 |
| COG3738 | Uncharacterized conserved protein YijF, DUF1287 family | Function unknown [S] | 7.97 |
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 2.90 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 1.45 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 1.45 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.45 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 1.45 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.72 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.72 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.72 |
| COG3533 | Beta-L-arabinofuranosidase, GH127 family | Carbohydrate transport and metabolism [G] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.88 % |
| Unclassified | root | N/A | 18.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573001|GZR05M102F8GM5 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300001867|JGI12627J18819_10243171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300001867|JGI12627J18819_10257290 | Not Available | 702 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10169290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300004080|Ga0062385_10795647 | Not Available | 618 | Open in IMG/M |
| 3300004479|Ga0062595_101366272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300004479|Ga0062595_102570225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300004633|Ga0066395_10357234 | Not Available | 813 | Open in IMG/M |
| 3300005187|Ga0066675_10894185 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300005187|Ga0066675_11447201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300005538|Ga0070731_10921344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300005556|Ga0066707_10259370 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300005569|Ga0066705_10095974 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300005575|Ga0066702_10374178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300005576|Ga0066708_10462027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
| 3300005587|Ga0066654_10342261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300005591|Ga0070761_10880269 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005598|Ga0066706_11458174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300005602|Ga0070762_10379180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| 3300005712|Ga0070764_10981819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300005843|Ga0068860_100959655 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300006173|Ga0070716_101075458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6 | 640 | Open in IMG/M |
| 3300006173|Ga0070716_101256818 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300006176|Ga0070765_100175756 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
| 3300006176|Ga0070765_100504506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6 | 1137 | Open in IMG/M |
| 3300006797|Ga0066659_11122066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300006806|Ga0079220_11767122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300006854|Ga0075425_100548731 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300007076|Ga0075435_100651754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
| 3300007255|Ga0099791_10022244 | All Organisms → cellular organisms → Bacteria | 2733 | Open in IMG/M |
| 3300009012|Ga0066710_103744311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300009038|Ga0099829_10434513 | Not Available | 1087 | Open in IMG/M |
| 3300009038|Ga0099829_10733663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300009089|Ga0099828_10169391 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
| 3300009090|Ga0099827_10259112 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300009137|Ga0066709_102464606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300009137|Ga0066709_103959404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300009143|Ga0099792_10855851 | Not Available | 599 | Open in IMG/M |
| 3300009792|Ga0126374_10595883 | Not Available | 815 | Open in IMG/M |
| 3300010043|Ga0126380_11206143 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300010046|Ga0126384_10042257 | All Organisms → cellular organisms → Bacteria | 3095 | Open in IMG/M |
| 3300010303|Ga0134082_10268867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300010325|Ga0134064_10290631 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300010326|Ga0134065_10080181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300010880|Ga0126350_10371766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300011269|Ga0137392_10523051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
| 3300011269|Ga0137392_10947242 | Not Available | 708 | Open in IMG/M |
| 3300011270|Ga0137391_10543120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 980 | Open in IMG/M |
| 3300011271|Ga0137393_10440010 | Not Available | 1117 | Open in IMG/M |
| 3300012189|Ga0137388_11231877 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300012202|Ga0137363_10002758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10552 | Open in IMG/M |
| 3300012203|Ga0137399_11277149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300012205|Ga0137362_10872213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300012363|Ga0137390_10795136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 904 | Open in IMG/M |
| 3300012917|Ga0137395_10466841 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300012923|Ga0137359_11334604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6 | 605 | Open in IMG/M |
| 3300012930|Ga0137407_11712335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6 | 599 | Open in IMG/M |
| 3300012931|Ga0153915_11432549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300012944|Ga0137410_10003180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 11139 | Open in IMG/M |
| 3300012944|Ga0137410_10291596 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300012960|Ga0164301_11758571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300013307|Ga0157372_10529766 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300015241|Ga0137418_10140191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2138 | Open in IMG/M |
| 3300017656|Ga0134112_10383011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300018482|Ga0066669_10125594 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300018482|Ga0066669_11444703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300020579|Ga0210407_10227516 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300020579|Ga0210407_10289137 | Not Available | 1279 | Open in IMG/M |
| 3300020579|Ga0210407_10460489 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300020582|Ga0210395_10007728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8137 | Open in IMG/M |
| 3300021168|Ga0210406_10813090 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300021405|Ga0210387_10109735 | All Organisms → cellular organisms → Bacteria | 2318 | Open in IMG/M |
| 3300021432|Ga0210384_10004614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15313 | Open in IMG/M |
| 3300021474|Ga0210390_10199231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1693 | Open in IMG/M |
| 3300021474|Ga0210390_11193710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300021478|Ga0210402_10340162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6 | 1391 | Open in IMG/M |
| 3300024288|Ga0179589_10031436 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
| 3300024330|Ga0137417_1046711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1059 | Open in IMG/M |
| 3300025898|Ga0207692_10375089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 882 | Open in IMG/M |
| 3300026089|Ga0207648_11978339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300026295|Ga0209234_1008382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3931 | Open in IMG/M |
| 3300026309|Ga0209055_1129989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300026309|Ga0209055_1134083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300026323|Ga0209472_1174344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300026333|Ga0209158_1319995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300026547|Ga0209156_10497733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300026552|Ga0209577_10072875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2843 | Open in IMG/M |
| 3300027297|Ga0208241_1038081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300027698|Ga0209446_1179170 | Not Available | 546 | Open in IMG/M |
| 3300027748|Ga0209689_1293104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300027787|Ga0209074_10006045 | All Organisms → cellular organisms → Bacteria | 2799 | Open in IMG/M |
| 3300027853|Ga0209274_10638344 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300027867|Ga0209167_10066888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1790 | Open in IMG/M |
| 3300027869|Ga0209579_10593894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300027874|Ga0209465_10284561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 828 | Open in IMG/M |
| 3300027908|Ga0209006_10326354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 1305 | Open in IMG/M |
| 3300028047|Ga0209526_10464505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
| 3300028780|Ga0302225_10014324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4075 | Open in IMG/M |
| 3300028798|Ga0302222_10003072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7652 | Open in IMG/M |
| 3300028906|Ga0308309_10188457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1691 | Open in IMG/M |
| 3300028906|Ga0308309_10502008 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300030813|Ga0265750_1012934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 987 | Open in IMG/M |
| 3300030879|Ga0265765_1000369 | All Organisms → cellular organisms → Bacteria | 3417 | Open in IMG/M |
| 3300031040|Ga0265754_1027457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300031708|Ga0310686_105735999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300031718|Ga0307474_11267973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300031753|Ga0307477_10095568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2064 | Open in IMG/M |
| 3300031781|Ga0318547_10798729 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300031820|Ga0307473_11403129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300031837|Ga0302315_10605733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300031947|Ga0310909_10154035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1891 | Open in IMG/M |
| 3300031962|Ga0307479_12018121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300031962|Ga0307479_12183833 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300032001|Ga0306922_11518669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300032010|Ga0318569_10445554 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300032180|Ga0307471_100006866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7276 | Open in IMG/M |
| 3300032180|Ga0307471_101730473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300032892|Ga0335081_12057771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300032893|Ga0335069_10458747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1485 | Open in IMG/M |
| 3300032955|Ga0335076_10257243 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300033289|Ga0310914_10209987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1740 | Open in IMG/M |
| 3300033289|Ga0310914_10548179 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300033289|Ga0310914_11817166 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.32% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.62% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.17% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.17% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.72% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.72% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD2_06360050 | 2189573001 | Grass Soil | LKKTAVESGDSHLEGKYGKDRGPKITLKTSYGSISIHKTS |
| JGI12627J18819_102431711 | 3300001867 | Forest Soil | KKTTESGDSHLEGKYGNGRGPKITLKTSYGSISIHKN* |
| JGI12627J18819_102572902 | 3300001867 | Forest Soil | GSLNPTKTGKGDSHLEGKYGAGRGPKITLKTSYDSIEVRKTT* |
| JGIcombinedJ51221_101692901 | 3300003505 | Forest Soil | INSEFSADTLKKSSVESGDSHLEGKYGTARGPKITLKTSYGSVSIKKTS* |
| Ga0062385_107956472 | 3300004080 | Bog Forest Soil | IESEFSSDTLKNTAPSSGDAHLEGKYGNARGPKITLKTSYDAISIKKTS* |
| Ga0062595_1013662722 | 3300004479 | Soil | IDSEFEADTLKQTSTDSGDAHLEGRYGNGRGPKITLKTSYGSISIHKTN* |
| Ga0062595_1025702251 | 3300004479 | Soil | FSADTLKKTTAESGDSHFEGKYGKDRGPKITLKTSYGAISIHKTS* |
| Ga0066395_103572342 | 3300004633 | Tropical Forest Soil | DIETEFEAGTLTKSSTKSGDSHLEGRYGTARGPKITLKTSYGSISINKTS* |
| Ga0066675_108941852 | 3300005187 | Soil | FSADSLKHASAGGDSHLEGKYGNGRGPKIILRTSYGSISIRKTS* |
| Ga0066675_114472011 | 3300005187 | Soil | DSLKQSATHSGDSHLEGKYGSGRGPKIILKTSYGAIAIRKTS* |
| Ga0070731_109213441 | 3300005538 | Surface Soil | PGSGDSHLEGKYGNSRGPKITLKTSYDAIAIRKTS* |
| Ga0066707_102593702 | 3300005556 | Soil | TSGPKSGDSHLEGKYGSGRGPKIILKTSYGSISIHKTS* |
| Ga0066705_100959741 | 3300005569 | Soil | ADTLKHTSTDSGDAHLEGRYGNGRGPKITLKTSYGSISIHKNN* |
| Ga0066702_103741781 | 3300005575 | Soil | SGTGSGDSHLEGKYGSGRGPKIILKTSYGSIAIRKTS* |
| Ga0066708_104620272 | 3300005576 | Soil | EADSLKATHTESGDSHLEGKYGKGRGPKIILKTSYGGISIHKNS* |
| Ga0066654_103422612 | 3300005587 | Soil | FRADSLKQSATHSGDSHLEGKYGSGRGPKIILKTSYGAIAIRKTS* |
| Ga0070761_108802692 | 3300005591 | Soil | TEGGDSHLEGRYGTGRGPKITLHTTYGSISIHKN* |
| Ga0066706_114581742 | 3300005598 | Soil | GTGSGDSHLEGKYGSGRGPKIILKTSYGSIAIRKTS* |
| Ga0070762_103791802 | 3300005602 | Soil | DIDSEFSADTLKKTSVESGDSHLEGKYGTARGPKITLKTSYGTLSIKKTS* |
| Ga0070764_109818191 | 3300005712 | Soil | EFSADTLKKTSVESGDSHLEGKYGAARGPKISLKTSYGAISIHKTS* |
| Ga0068860_1009596553 | 3300005843 | Switchgrass Rhizosphere | TLNSTKTEKGDSHLEGKYGAGRGPKIILKSSYDSIEIRKTN* |
| Ga0070716_1010754582 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KTESGDSHLEGRYGKGRGPKITLKTTYGGISIHKTS* |
| Ga0070716_1012568182 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PSLNKTTTKSGDSHFEGKYGSGRPIKIVIRTSYGSINIRKTS* |
| Ga0070765_1001757564 | 3300006176 | Soil | LKKTTTESGDSHLEGKYGNGRGPKITLKTSYGSISIHKN* |
| Ga0070765_1005045062 | 3300006176 | Soil | SEFESDSMKKTAQSGDSHFEGKYGNGRGPKITLKTSYGSISIHKN* |
| Ga0066659_111220661 | 3300006797 | Soil | KLTSGTGSGDSHLEGKYGSGRGPKIILKTSYGSIAIRKTS* |
| Ga0079220_117671222 | 3300006806 | Agricultural Soil | LKKSSTDSGDVHLEGKYGNGRGPKITLKTSYGSISIHKNN* |
| Ga0075425_1005487311 | 3300006854 | Populus Rhizosphere | QTGGDSHLEGKYGNGRGPKIILKTSYGSISIRKTS* |
| Ga0075435_1006517541 | 3300007076 | Populus Rhizosphere | SDFSGSSLNKTTTKSGDSHLEGKYGSGGHPIKIVLRTSYGSINIRKTS* |
| Ga0099791_100222441 | 3300007255 | Vadose Zone Soil | DTLKKTSTDSGDSHLEGKYGRGRGPKIILKTTYGSISIHKTS* |
| Ga0066710_1037443111 | 3300009012 | Grasslands Soil | TKSGDSHLEGKYGSGRPIKILIRTSYGSINIRKTS |
| Ga0099829_104345131 | 3300009038 | Vadose Zone Soil | TLKKTTTDSGDSHLEGKIGAKGPKITLKTTYGSISIHKGT* |
| Ga0099829_107336631 | 3300009038 | Vadose Zone Soil | PSLKKTGGGGHDSDSRLEGKVGGRGPKINLKTSYGSIALHKTT* |
| Ga0099828_101693911 | 3300009089 | Vadose Zone Soil | EADTLKRTSSESGDAHLEGKYGRGRGPKITLKTSYGSISIHKTS* |
| Ga0099827_102591121 | 3300009090 | Vadose Zone Soil | SEFEADSLKKTTAESGGDSHLEGKYGRGHGPKITLKTSYGSISIHKTS* |
| Ga0066709_1024646061 | 3300009137 | Grasslands Soil | LTSGPKSGDSHLEGKYGSGRGPKIILKTSYGSISIHKTS* |
| Ga0066709_1039594042 | 3300009137 | Grasslands Soil | DTEFRADSLKQSATHSGDSHLEGKYGSGRGPKIILKTSYGAIAIRKTS* |
| Ga0099792_108558512 | 3300009143 | Vadose Zone Soil | SGGDSHLEGKYGRGHGPKIILKTSYGSISIHKTS* |
| Ga0126374_105958832 | 3300009792 | Tropical Forest Soil | GPSLNKTSAKNGDTHFEGKYGSGRPIKIILRTSYGAIAIRKTS* |
| Ga0126380_112061431 | 3300010043 | Tropical Forest Soil | SLKKTTSEGGDSHLEGRYGNGRGPKITLHTTYGSISIHKN* |
| Ga0126384_100422573 | 3300010046 | Tropical Forest Soil | ADSLKQTSTGGDAHVEGKYGSGRGPKIILKTSYGSISIRKTS* |
| Ga0134082_102688672 | 3300010303 | Grasslands Soil | GPKSGDSHLEGKYGSGRGPKIILKTSYGSISIHKTS* |
| Ga0134064_102906312 | 3300010325 | Grasslands Soil | ASAGGDSHLEGKYGNGRGPKIILRTSYGSLSIRKTS* |
| Ga0134065_100801812 | 3300010326 | Grasslands Soil | EFRADSLKQSATHSGDSHLEGKYGSGRGPKIILKTSYGAIAIRKTS* |
| Ga0134063_107074262 | 3300010335 | Grasslands Soil | RTDKGDSHLEGKYGSARGPKIILKSSYDSIQIRKTN* |
| Ga0126378_106177033 | 3300010361 | Tropical Forest Soil | LNSTKTEKGDSHLEGKYGAARGPKITLKTSYDSIEVRKTT* |
| Ga0126379_118694693 | 3300010366 | Tropical Forest Soil | LNHSKTEKGDSHLEGKYGAGRGPKIILKTTYDSIEIRKTT* |
| Ga0126350_103717662 | 3300010880 | Boreal Forest Soil | EFDGDSLKKTTTESGDSHLEGKYGNGRGPKITLKTSYGSISIHKN* |
| Ga0137392_105230512 | 3300011269 | Vadose Zone Soil | DSLKKTTAESGGDSHLEGKYGRGHGPKITLKTSYGSISIHKTS* |
| Ga0137392_109472421 | 3300011269 | Vadose Zone Soil | FQADSLKLTTSESGGNSHLEGKYGRGRGPKITLKTSYGSISIHKTS* |
| Ga0137391_105431201 | 3300011270 | Vadose Zone Soil | SDTLKKTSTDSGDSHLEGKYGRGRGPKIILKTSYGSISIHKTS* |
| Ga0137393_101832704 | 3300011271 | Vadose Zone Soil | LKATRTDKGDSHLEGKYGSARGPKIILKSSYDSIQIRKTT* |
| Ga0137393_104400101 | 3300011271 | Vadose Zone Soil | DSEFEADSLKKTTAESGGDSHLEGKYGRGHGPKITLKTSYGSISIHKTS* |
| Ga0137389_117225631 | 3300012096 | Vadose Zone Soil | TGSSLKATRTDKSDSHLEGKYGAARGPKIILKTSYDSIQIHKTN* |
| Ga0137388_112318772 | 3300012189 | Vadose Zone Soil | SEFTGSSLKATRTDKSDSHLEGKYGAARGPKIILKTSYDSMQIRKTT* |
| Ga0137363_100027581 | 3300012202 | Vadose Zone Soil | LKKTSTTSGDYHLEGKYGSGRGPKITLKTSYGSIAIRKTS* |
| Ga0137399_112771491 | 3300012203 | Vadose Zone Soil | GESLKKTSTTSGDYHLEGKYGSGRGPKITLKTSYGSIAIRKTS* |
| Ga0137362_108722132 | 3300012205 | Vadose Zone Soil | SDTLKKTSAESGDSHMEGKYGRGRGPKIILKTSYGSISIHKTS* |
| Ga0137390_107951361 | 3300012363 | Vadose Zone Soil | SLKKTTAESGGDSHLEGKYGRGHGPKITLKTSYGSISIHKTS* |
| Ga0137395_104668412 | 3300012917 | Vadose Zone Soil | ESLKKTSTESGDSHLEGKYGRGRAPKIILKTSYGSISIHKTS* |
| Ga0137359_106182852 | 3300012923 | Vadose Zone Soil | SEFTGSGLKATRTNKGDSHLEGKYGSARGPKIILKTSYDSIQIRKTT* |
| Ga0137359_113346041 | 3300012923 | Vadose Zone Soil | IDSEFESDSLKLTKSESGDSHLEGKYGRGRGPKIVLRTTYGSISIHKTS* |
| Ga0137407_117123352 | 3300012930 | Vadose Zone Soil | LNKTNTKSGDSHFEGKYGSGRPIKIVIRTSYGSINIRKTS* |
| Ga0153915_114325491 | 3300012931 | Freshwater Wetlands | SLKKTTTESGDAHLEGKLGARGPKITLKTSYGSIALHKGT* |
| Ga0137410_100031801 | 3300012944 | Vadose Zone Soil | TTSGDYHLEGKYGSGRGPKITLKTSYGSIAIRKTS* |
| Ga0137410_102915961 | 3300012944 | Vadose Zone Soil | NSDFSGPNLNKTTTQSGDSHIEGKYGTGRPIKIVVKTSYGSITIRKTS* |
| Ga0164301_117585712 | 3300012960 | Soil | FSADTLKKTAADSGDSHLEGKYGEGRGPKITLKTSYGALNIRKTS* |
| Ga0163162_108465231 | 3300013306 | Switchgrass Rhizosphere | LNQTKTEKGDSHLEGKYGAGRGPKIVLKTSYDSIEIRKTN* |
| Ga0157372_105297663 | 3300013307 | Corn Rhizosphere | CESDSLKNATTEGGDSHREGRYGNGRGPKITLHTTYGSISIHKN* |
| Ga0137418_101401913 | 3300015241 | Vadose Zone Soil | SEFQADSLKLTSGSKSGDSHLEGKYGSGRGPKIILKTSYGSISIRKTG* |
| Ga0132255_1036329061 | 3300015374 | Arabidopsis Rhizosphere | KTEKGDSHLEGKYGAGRGPKIILKSSYDSIEIRKTN* |
| Ga0134112_103830111 | 3300017656 | Grasslands Soil | GTKSGDSHLEGKYGNGRGPKIILKTSYGSISIHKTS |
| Ga0187862_100819121 | 3300018040 | Peatland | TKDAQGNSHLEGKVGTHGPKITLKTTYGSIVLRKAG |
| Ga0066669_101255941 | 3300018482 | Grasslands Soil | TSGTGSGDSHLEGKYGSGRGPKIILKTSYGSIAIRKTS |
| Ga0066669_114447032 | 3300018482 | Grasslands Soil | DSLKLTSGPKSGDSHLEGKYGSGRGPKIILKTSYGSISIHKTS |
| Ga0210407_102275163 | 3300020579 | Soil | SEFEADSLKKTSTESGDSHLEGKYGRGRGPKITLKTSYGSISIHKTS |
| Ga0210407_102891371 | 3300020579 | Soil | DIESEFSADTLKKTSVESGDSHLEGKYGTARGPKISLKTSYGAISIHKTS |
| Ga0210407_104604891 | 3300020579 | Soil | QDNFRPAGDSHLEGKYGSARGPKIILKSSYDSIQIRKTT |
| Ga0210395_100077287 | 3300020582 | Soil | SEFSADTLKKTSAESGDSHLEGKYGTARGPKISLKTSYGAISIHKTS |
| Ga0210406_108130902 | 3300021168 | Soil | DSDTLKKTSTDSGDSHLEGKYGRGRGPKIILKTSYGSISIHKTS |
| Ga0210393_115003821 | 3300021401 | Soil | KATRSDKGDSHLEGKYGSARGPKIILKSSYDSIQIRKTT |
| Ga0210387_101097351 | 3300021405 | Soil | TLKKTTVNSGDSHLEGKYGNARGPKITVKTSYGALNIRKTS |
| Ga0210384_100046141 | 3300021432 | Soil | ADTLKKTSVESGDSHLEGKYGTARGPKISLKTSYGAISIHKTS |
| Ga0210390_101992311 | 3300021474 | Soil | EADSLKKTTESGDSHLEGKYGNSRGPKITLKTSYGSISIHKN |
| Ga0210390_111937101 | 3300021474 | Soil | CDINSEFSADTLKKSSVESGDSHLEGKYGTARGPKITLKTSYGSVSIKKTS |
| Ga0210402_103401621 | 3300021478 | Soil | KTAVESGDAHLEGKYGKDRGPKITIKTSYGSISIHKTS |
| Ga0179589_100314361 | 3300024288 | Vadose Zone Soil | ESLKKTSTESGDSHLEGKYGRGRAPKIILKTSYGSISIHKTS |
| Ga0137417_10467111 | 3300024330 | Vadose Zone Soil | IDSEFESDTLKKTSTDSGDAHLEGKYGRGRGPKIILKTTYGSISIHKTS |
| Ga0207692_103750891 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TESGDAHLEGKYGNGRGPKITLKTSYGSISIHKNN |
| Ga0207648_119783392 | 3300026089 | Miscanthus Rhizosphere | DSEFEADTLKQTSTDSGDAHLEGRYGNGRGPKITLKTSYGSISIHKTN |
| Ga0209234_10083821 | 3300026295 | Grasslands Soil | ESLKLTSGTGSGDSHLEGKYGSGRGPKIILKTSYGSIAIRKTS |
| Ga0209055_11299892 | 3300026309 | Soil | LKQSATQSGDSHLEGKYGSGRGPKIILKTSYGAIAIRKTS |
| Ga0209055_11340832 | 3300026309 | Soil | TKSGDSHLEGKYGSGRGPKIILKTSYGSISIHKTS |
| Ga0209472_11743441 | 3300026323 | Soil | FQADSLKLTSGTGSGDSHLEGKYGSGRGPKIILKTSYGSITIRKTS |
| Ga0209802_12519402 | 3300026328 | Soil | IETEFTDPSLKKTGGGGHDSDSRLEGKVGGRGPKINLKTSYGSIALHKTT |
| Ga0209158_13199951 | 3300026333 | Soil | DSEFQSDSLKLTSGAKSGDSHLEGKYGSGRGPKIILKTSYGSISIHKTS |
| Ga0257168_11067991 | 3300026514 | Soil | TDKGDSHLEGKYGSARGPKIILKSSYDSIQIRKTT |
| Ga0209156_104977332 | 3300026547 | Soil | ADSLKQSATHSGDSHLEGKYGSGRGPKIILKTSYGAIAIRKTS |
| Ga0209577_100728755 | 3300026552 | Soil | SLKQTSTGGDSHLEGKYGKARGPKITLKTSYGSISIRKTS |
| Ga0208241_10380812 | 3300027297 | Forest Soil | INSEFSADTLKKSSVESGDSHLEGKYGTARGPKITLKTSYGSVSIKKTS |
| Ga0209446_11791701 | 3300027698 | Bog Forest Soil | IESEFSSDTLKNTAPSSGDAHLEGKYGNARGPKITLKTSYDAISIKKTS |
| Ga0209689_12931041 | 3300027748 | Soil | PTLKKTTTESGDAHLEGKVGSRGPKITLKTSYGSISIHKSS |
| Ga0209074_100060451 | 3300027787 | Agricultural Soil | IDSDFSAPSLKKTSKENGDSHLEGKYGSGRAPRNVLKTTYGSITLRKTT |
| Ga0209274_106383442 | 3300027853 | Soil | LKKTTPEGGDSHLEGRYGTGRGPKITLHTTYGSISIHKN |
| Ga0209167_100668884 | 3300027867 | Surface Soil | DSEFEADSLKLTKAESGGDSHLEGKYGRGHGPKIILKTSYGSISIHKTS |
| Ga0209579_105938941 | 3300027869 | Surface Soil | PGSGDSHLEGKYGNSRGPKITLKTSYDAIAIRKTS |
| Ga0209465_102845612 | 3300027874 | Tropical Forest Soil | ETEFEAGTLTKSSTKSGDSHLEGRYGTARGPKITLKTSYGSISINKTS |
| Ga0209006_103263543 | 3300027908 | Forest Soil | SEFESDSLKKTTTEGGDSHLEGRYGTGRGPKITLHTTYGSISIHKN |
| Ga0209526_104645051 | 3300028047 | Forest Soil | FESDSMKKTAQSGDSHLEGKYGNGRGPKITLKTSYGSISIHKN |
| Ga0302225_100143245 | 3300028780 | Palsa | ESDSLKKTVAQSGDSHLEGRFGTGRGPKITLKTTYGSISLNKTD |
| Ga0302222_100030727 | 3300028798 | Palsa | KTVAQSGDSHLEGRFGTGRGPKITLKTTYGSISLNKTD |
| Ga0308309_101884572 | 3300028906 | Soil | SEFESDSMKKTAQSGDSHFEGKYGNGRGPKITLKTSYGSISIHKN |
| Ga0308309_105020081 | 3300028906 | Soil | ESDSLKKTTTEGGDSHLEGRYGNSSRAPKITLHTTYGSISIHKN |
| Ga0265750_10129341 | 3300030813 | Soil | EFSADTLKKTSVESGDSHLEGKYGSARGPKISLKTSYGTLSIKKTS |
| Ga0265765_10003691 | 3300030879 | Soil | DSEFSADTLKKTSAESGDSHLEGKYGSARGPKISLKTSYGTLSIKKTS |
| Ga0265754_10274571 | 3300031040 | Soil | KTSAESGDSHLEGKYGSARGPKITLKTSYGTLSIKKTS |
| Ga0310686_1057359991 | 3300031708 | Soil | TLKKTSVESGDSHLEGKYGTARGPKITLKTSYGAVSIKKTS |
| Ga0307474_112679731 | 3300031718 | Hardwood Forest Soil | KTTESGDSHLEGKYRNGRGPKITLKTSYGSISIHKN |
| Ga0307477_100955683 | 3300031753 | Hardwood Forest Soil | TSGKSGDSHLEGKYGSGRGPKIILKTSYGSISIRKTS |
| Ga0318547_107987293 | 3300031781 | Soil | LKHTSSGGDAHLEGKYGKSRGPKIRLKTSYGPISLRKTS |
| Ga0307473_114031292 | 3300031820 | Hardwood Forest Soil | DSLKLTSGTGSGDSHLEGKYGSGRGPKIILKTSYGSIAIRKTS |
| Ga0302315_106057332 | 3300031837 | Palsa | DSLKKTVAQSGDSHLEGRFGTGRGPKITLKTTYGSISLNKTD |
| Ga0310909_101540353 | 3300031947 | Soil | HTSSGGDAHLEGKYGKSRGPKIRLKTSYGPISLRKTS |
| Ga0307479_120181211 | 3300031962 | Hardwood Forest Soil | DSLKLASGAKSGDSHLEGKYGSGRGPKIILKTSYGSISIHKTS |
| Ga0307479_121838332 | 3300031962 | Hardwood Forest Soil | DSEFESDTLKKTSTDSGDSHLEGKYGRGRGPKIILKTSYGSISIHKTS |
| Ga0306922_105797493 | 3300032001 | Soil | RTEKGDSHLEGKYGAARGPKITLKSSYDSIEIRKTT |
| Ga0306922_115186692 | 3300032001 | Soil | IDSEFSGDSLKQTSNGGDAHLEGKYGNGRGPKITLKTSYGSISIRKTS |
| Ga0318569_104455542 | 3300032010 | Soil | SEFSSDTLKHTSSGGDAHLEGKYGKSRGPKIRLKTSYGPISLRKTS |
| Ga0307470_116136861 | 3300032174 | Hardwood Forest Soil | SLKATRTEKGDSHLEGKYGAARGPKIVLKTSYDSIQIRKTT |
| Ga0307471_1000068661 | 3300032180 | Hardwood Forest Soil | TESGDAHLEGKFGSGRGPKITLKTSYGSISIHKNN |
| Ga0307471_1017304731 | 3300032180 | Hardwood Forest Soil | PSLNKTTTKSGDSHFEGKYGSGRPIKIVIRTSYGSINIRKTS |
| Ga0307471_1023621891 | 3300032180 | Hardwood Forest Soil | HADNGDSHLAGKYGSSRGPKIVLKSSYDSIEIRKTT |
| Ga0335081_120577711 | 3300032892 | Soil | DSGDNHLEGHYGSSTRGPKITLKTSYGSISIHKTS |
| Ga0335069_104587471 | 3300032893 | Soil | LNTSRSDKGDSHLEGKYGAGRGPKITLKTSYDSIQIRKTT |
| Ga0335076_102572431 | 3300032955 | Soil | DSEFSSDTLKKSSNGSGDNHLEGHYGSTHAPKITLKTSYGSISIHKTS |
| Ga0310914_102099872 | 3300033289 | Soil | TSSGGDAHLEGKYGKSRGPKIRLKTSYGPISLRKTS |
| Ga0310914_105481791 | 3300033289 | Soil | LDQTKSESGDSHLSGKIGSGKGPKITLKTSYGNIELRRTSL |
| Ga0310914_118171662 | 3300033289 | Soil | FESGSLTKTSTKSGDSHLEGKFGSSRGPKITLKTSYGSISLTKTS |
| ⦗Top⦘ |