NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055963

Metagenome / Metatranscriptome Family F055963

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055963
Family Type Metagenome / Metatranscriptome
Number of Sequences 138
Average Sequence Length 42 residues
Representative Sequence MGYVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDRR
Number of Associated Samples 129
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 35.51 %
% of genes near scaffold ends (potentially truncated) 30.43 %
% of genes from short scaffolds (< 2000 bps) 88.41 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.754 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(8.696 % of family members)
Environment Ontology (ENVO) Unclassified
(40.580 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.826 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 54.93%    β-sheet: 0.00%    Coil/Unstructured: 45.07%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF00196GerE 46.38
PF05977MFS_3 22.46
PF12697Abhydrolase_6 5.07
PF07690MFS_1 4.35
PF00561Abhydrolase_1 4.35
PF13191AAA_16 2.90
PF05331DUF742 0.72
PF05960DUF885 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 22.46
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.75 %
UnclassifiedrootN/A7.25 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559006|FI_contig02788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1992Open in IMG/M
2170459005|F1BAP7Q01DW5I8All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia521Open in IMG/M
2199352024|deeps__Contig_190064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300005147|Ga0066821_1026419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300005159|Ga0066808_1038458Not Available516Open in IMG/M
3300005163|Ga0066823_10157807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300005172|Ga0066683_10465419Not Available774Open in IMG/M
3300005175|Ga0066673_10807654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia536Open in IMG/M
3300005179|Ga0066684_10920121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium570Open in IMG/M
3300005186|Ga0066676_10404856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales920Open in IMG/M
3300005327|Ga0070658_10711844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia872Open in IMG/M
3300005331|Ga0070670_100093532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2586Open in IMG/M
3300005332|Ga0066388_104023939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia750Open in IMG/M
3300005336|Ga0070680_100022374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales5035Open in IMG/M
3300005338|Ga0068868_100184278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium1733Open in IMG/M
3300005338|Ga0068868_101015179All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300005345|Ga0070692_11167526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia547Open in IMG/M
3300005353|Ga0070669_101404138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia606Open in IMG/M
3300005364|Ga0070673_100018301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5000Open in IMG/M
3300005365|Ga0070688_100451830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium961Open in IMG/M
3300005434|Ga0070709_10512885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae912Open in IMG/M
3300005435|Ga0070714_102506882Not Available500Open in IMG/M
3300005437|Ga0070710_11235031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium553Open in IMG/M
3300005445|Ga0070708_101203941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae708Open in IMG/M
3300005458|Ga0070681_10066933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae3561Open in IMG/M
3300005468|Ga0070707_100188497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae2011Open in IMG/M
3300005545|Ga0070695_100245612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1300Open in IMG/M
3300005563|Ga0068855_102089611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia571Open in IMG/M
3300005569|Ga0066705_10580075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae691Open in IMG/M
3300005764|Ga0066903_108218829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300005840|Ga0068870_10130929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1457Open in IMG/M
3300005842|Ga0068858_100373100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1368Open in IMG/M
3300005983|Ga0081540_1000216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia61035Open in IMG/M
3300006173|Ga0070716_101835969All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300006581|Ga0074048_13118591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia578Open in IMG/M
3300006605|Ga0074057_11701157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1007Open in IMG/M
3300006606|Ga0074062_12750551Not Available632Open in IMG/M
3300006755|Ga0079222_12244940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium544Open in IMG/M
3300006755|Ga0079222_12422680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300006800|Ga0066660_11416658Not Available545Open in IMG/M
3300006904|Ga0075424_100107930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2938Open in IMG/M
3300006954|Ga0079219_10245823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1059Open in IMG/M
3300007258|Ga0099793_10087199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae1431Open in IMG/M
3300009098|Ga0105245_13235865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300009177|Ga0105248_11574213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia744Open in IMG/M
3300009792|Ga0126374_10118958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1540Open in IMG/M
3300010046|Ga0126384_10153538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1775Open in IMG/M
3300010046|Ga0126384_10512408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1036Open in IMG/M
3300010321|Ga0134067_10116872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae926Open in IMG/M
3300010321|Ga0134067_10407313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia546Open in IMG/M
3300010337|Ga0134062_10445501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae642Open in IMG/M
3300010376|Ga0126381_100980110All Organisms → cellular organisms → Bacteria1219Open in IMG/M
3300010396|Ga0134126_12920095Not Available517Open in IMG/M
3300011003|Ga0138514_100086992All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300012198|Ga0137364_10928531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae659Open in IMG/M
3300012200|Ga0137382_10688731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae732Open in IMG/M
3300012201|Ga0137365_10320070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1148Open in IMG/M
3300012208|Ga0137376_11144924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Sciscionella → unclassified Sciscionella → Sciscionella sp.665Open in IMG/M
3300012285|Ga0137370_10162161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1298Open in IMG/M
3300012351|Ga0137386_10183912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1500Open in IMG/M
3300012361|Ga0137360_10527042All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300012474|Ga0157356_1016338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia568Open in IMG/M
3300012496|Ga0157353_1018685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia649Open in IMG/M
3300012500|Ga0157314_1011291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae785Open in IMG/M
3300012507|Ga0157342_1003711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1324Open in IMG/M
3300012515|Ga0157338_1036267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia652Open in IMG/M
3300012927|Ga0137416_10697212All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300012951|Ga0164300_10121437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae1181Open in IMG/M
3300012985|Ga0164308_11327589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium URHB0048654Open in IMG/M
3300012986|Ga0164304_10225044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1241Open in IMG/M
3300015265|Ga0182005_1238582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia559Open in IMG/M
3300015371|Ga0132258_12914357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1188Open in IMG/M
3300015372|Ga0132256_100390713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium URHB00621492Open in IMG/M
3300015373|Ga0132257_101062526All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300015373|Ga0132257_101218527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia953Open in IMG/M
3300016357|Ga0182032_10740729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria827Open in IMG/M
3300017792|Ga0163161_11584972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia577Open in IMG/M
3300017937|Ga0187809_10040208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium URHB00621501Open in IMG/M
3300018431|Ga0066655_11356106Not Available514Open in IMG/M
3300018482|Ga0066669_11093110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium URHB0048720Open in IMG/M
3300019875|Ga0193701_1042620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria927Open in IMG/M
3300019885|Ga0193747_1042384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1134Open in IMG/M
3300020082|Ga0206353_10775593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1988Open in IMG/M
3300020170|Ga0179594_10365795Not Available547Open in IMG/M
3300020199|Ga0179592_10305599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae706Open in IMG/M
3300021088|Ga0210404_10810624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia535Open in IMG/M
3300021401|Ga0210393_11627749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300021403|Ga0210397_10002889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10688Open in IMG/M
3300021445|Ga0182009_10267456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria853Open in IMG/M
3300021560|Ga0126371_11877308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora719Open in IMG/M
3300024245|Ga0247677_1023759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia877Open in IMG/M
3300024249|Ga0247676_1019858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1060Open in IMG/M
3300024254|Ga0247661_1049060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae772Open in IMG/M
3300024279|Ga0247692_1024046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia932Open in IMG/M
3300025904|Ga0207647_10150860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium URHB00481358Open in IMG/M
3300025905|Ga0207685_10201878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae935Open in IMG/M
3300025908|Ga0207643_10106318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1649Open in IMG/M
3300025910|Ga0207684_11010514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia695Open in IMG/M
3300025912|Ga0207707_10121052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2288Open in IMG/M
3300025914|Ga0207671_11164944Not Available604Open in IMG/M
3300025920|Ga0207649_10365852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1071Open in IMG/M
3300025922|Ga0207646_10078678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2947Open in IMG/M
3300025922|Ga0207646_11355930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia620Open in IMG/M
3300025923|Ga0207681_10494438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1001Open in IMG/M
3300025928|Ga0207700_10858161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae812Open in IMG/M
3300025929|Ga0207664_11809810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia533Open in IMG/M
3300025931|Ga0207644_10213714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium URHB00621526Open in IMG/M
3300025933|Ga0207706_10047348All Organisms → cellular organisms → Bacteria3805Open in IMG/M
3300025940|Ga0207691_10756366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia818Open in IMG/M
3300025960|Ga0207651_10433881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1124Open in IMG/M
3300026089|Ga0207648_10776295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii891Open in IMG/M
3300026557|Ga0179587_10111320All Organisms → cellular organisms → Bacteria1669Open in IMG/M
3300027725|Ga0209178_1111622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria921Open in IMG/M
3300027775|Ga0209177_10513213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia502Open in IMG/M
3300027817|Ga0209112_10248211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia622Open in IMG/M
3300028755|Ga0307316_10209693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia703Open in IMG/M
3300028824|Ga0307310_10311777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia767Open in IMG/M
3300031170|Ga0307498_10058057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1072Open in IMG/M
3300031231|Ga0170824_104644311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300031718|Ga0307474_10173618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1634Open in IMG/M
3300031720|Ga0307469_11993616All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031723|Ga0318493_10238072All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300031740|Ga0307468_100488772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia972Open in IMG/M
3300031771|Ga0318546_11315188Not Available508Open in IMG/M
3300031805|Ga0318497_10340853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae837Open in IMG/M
3300032009|Ga0318563_10476968All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300032068|Ga0318553_10061581All Organisms → cellular organisms → Bacteria1864Open in IMG/M
3300032770|Ga0335085_10126771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae3246Open in IMG/M
3300032770|Ga0335085_10147748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2954Open in IMG/M
3300032770|Ga0335085_11471678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae711Open in IMG/M
3300032770|Ga0335085_11732529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia642Open in IMG/M
3300032828|Ga0335080_10009673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia10085Open in IMG/M
3300032955|Ga0335076_10924656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria754Open in IMG/M
3300033004|Ga0335084_10064034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3802Open in IMG/M
3300033134|Ga0335073_10107069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium3603Open in IMG/M
3300033158|Ga0335077_10267654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1886Open in IMG/M
3300033475|Ga0310811_10793799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia886Open in IMG/M
3300034817|Ga0373948_0019064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae1294Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.70%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.52%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.35%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.62%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.62%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.17%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.17%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.17%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.17%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere2.17%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.17%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil1.45%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.45%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.45%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.45%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.45%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.72%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.72%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.72%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.72%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.72%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.72%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.72%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.72%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.72%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559006Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembledEnvironmentalOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300005147Soil and rhizosphere microbial communities from Laval, Canada - mgLMCEnvironmentalOpen in IMG/M
3300005159Soil and rhizosphere microbial communities from Laval, Canada - mgLPBEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012474Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610EnvironmentalOpen in IMG/M
3300012496Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610EnvironmentalOpen in IMG/M
3300012500Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610Host-AssociatedOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300024249Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027817Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FI_007401902166559006Grass SoilVSNSLTASLTDLIFISIVPTLLLAGWLIVIFRATRDYDKP
E41_048805002170459005Grass SoilMGYVGNSLTASLTELIFISIVPTFLLAGWLIVIFR
deeps_036057402199352024SoilMGYVGNSLTASLTELIFISIVPTLLLAGWLIVIFRATRDYDRR
Ga0066821_102641913300005147SoilMGYVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR*
Ga0066808_103845813300005159SoilMGYVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDRR*
Ga0066823_1015780713300005163SoilMGYVGNSLTASLTELIFISIVPTFLLAGWLIVIFRATRDYDRR*
Ga0066683_1046541923300005172SoilMGYVGNSLTASLTDLVFIAVIPTILLVGWLIVIFRATRDYDRRD*
Ga0066673_1080765423300005175SoilMGYVDNSLTASLTELIFISIVPTLLLAGWLIAIFRATRDYDRR*
Ga0066684_1092012123300005179SoilMGYVGNSLTASLTELIFISIVPTLLLAGWLIAIFRATRDYDRR*
Ga0066676_1040485623300005186SoilVDTILSASLTELIFISIIPTVLLAGWLIVIFRATRDYDKR*
Ga0070658_1071184423300005327Corn RhizosphereMGYVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR*
Ga0070670_10009353233300005331Switchgrass RhizosphereMGYVGNSLTASLTELIFISIVPTALLAGWLIVIFRAARDYDRR*
Ga0066388_10402393913300005332Tropical Forest SoilATMGSVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR*
Ga0070680_10002237433300005336Corn RhizosphereMGCVGNSLTASLTELIFISIVPTVLLAGWLIVIFRAARDYDRR*
Ga0068868_10018427823300005338Miscanthus RhizosphereMGYVGNSLTASLTELIFISIVPTVLLAGWLIVIFRAARDYDRR*
Ga0068868_10101517923300005338Miscanthus RhizosphereMGYVGNSLTASLTALIFISIVPTLLLAGWLIVIFRATRDYDRR*
Ga0070692_1116752613300005345Corn, Switchgrass And Miscanthus RhizospherePSTATMGYVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDRR*
Ga0070669_10140413823300005353Switchgrass RhizosphereATMGYVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR*
Ga0070673_10001830133300005364Switchgrass RhizosphereVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR*
Ga0070688_10045183023300005365Switchgrass RhizosphereMGCVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR*
Ga0070709_1051288523300005434Corn, Switchgrass And Miscanthus RhizosphereMGYMGNSLTASLTSLLFISIVPTALLAGWLIVIFRATRDYDKRD*
Ga0070714_10250688223300005435Agricultural SoilMGCVGNSLTASLTELIFISIVPTALLIGWLIAIFRATRDYDRR*
Ga0070710_1123503123300005437Corn, Switchgrass And Miscanthus RhizosphereMGYMGNSLTASLTSLLFISIVPTFLLAGWLIVIFRATRDYDKRD*
Ga0070708_10120394123300005445Corn, Switchgrass And Miscanthus RhizosphereMGYVGNSLTASLTALIFISIVPTVLLAGWLIVIFRATRDYDRR*
Ga0070681_1006693333300005458Corn RhizosphereVGNSLTASLTELIFISIVPTVLLAGWLIVIFRAARDYDRR*
Ga0070707_10018849723300005468Corn, Switchgrass And Miscanthus RhizosphereMGCVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDRR*
Ga0070695_10024561223300005545Corn, Switchgrass And Miscanthus RhizosphereMGYVGNSLTASLTALIFISIVPTFLLAGWLIVIFRATRDYDRR*
Ga0068855_10208961113300005563Corn RhizosphereMGYVGNSLTASLTALLFISIVPTFLLAGWLIVIFRATRDYDRR*
Ga0066705_1058007513300005569SoilASLTELIFISIVPTLLLAGWLIAIFRATRDYDRR*
Ga0066903_10821882913300005764Tropical Forest SoilAATMGYVDNSLTASLTELIFISIVPTVLLAGWLIAIFRATRDYDRR*
Ga0068870_1013092923300005840Miscanthus RhizosphereMGYVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDKRD*
Ga0068858_10037310023300005842Switchgrass RhizosphereVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR*
Ga0081540_1000216113300005983Tabebuia Heterophylla RhizosphereVGNSLTASLTELIFISIVPTLLLAGWLIAIFRATRDYDRR*
Ga0070716_10183596913300006173Corn, Switchgrass And Miscanthus RhizosphereMGYVGNSLTASLTDLIFISIVPTVLLAGWLIVIFWATRDYDRR*
Ga0074048_1311859113300006581SoilGNSLTASLTSLIFISIVPTFLLAGWLIMIFRATRDYDKRD*
Ga0074057_1170115723300006605SoilMGYVGNSLTASLTELIFISIVPTLLLAGWLIVIFRATRDYDRR*
Ga0074062_1275055123300006606SoilMGYMGNSLTASLTSLIFISIVPTFLLAGWLIMIFRATRDYDKRD*
Ga0079222_1224494023300006755Agricultural SoilMGYVGNSLTASLTELIFISIIPTALLAGWLIAIFRATRDYDRR*
Ga0079222_1242268023300006755Agricultural SoilLTASLTELIFISIIPTALLAGWLIVIFRATRDYDRR*
Ga0066660_1141665823300006800SoilVNSSLTTSLAGLVFIAVVPTLLLAGWLIVIFRATRDYDPPSPGAR
Ga0075424_10010793023300006904Populus RhizosphereMGHVGNSLTASLTALIFISIVPTLLLAGWLIVIFRATRDYDRR*
Ga0079219_1024582323300006954Agricultural SoilMGYVGNSLTASLTELIFISIIPTALLAGWLIAIFRATRDYD
Ga0099793_1008719923300007258Vadose Zone SoilVNSQLSASLTDLIFISVIPTLLLAGWLIVIFRSARDYDRRD*
Ga0105245_1323586523300009098Miscanthus RhizosphereMGCVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR*
Ga0105248_1157421323300009177Switchgrass RhizosphereMGYVGNSLTASLTELIFISIVPTALLAGWLIAIFR
Ga0126374_1011895813300009792Tropical Forest SoilMGYVDNSLTASLTELIFISIVPTVLLAGWLIAIFRATRDYDRR*
Ga0126384_1015353813300010046Tropical Forest SoilMGFVGNSLTASLTELIFISIVPTLLLAGWLIAIFRATRDYDRR*
Ga0126384_1051240823300010046Tropical Forest SoilMGYVDNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR*
Ga0134067_1011687223300010321Grasslands SoilMGYMGNSLTASLTELIFISIVPTLLLAGWLIAIFRATRDYDRR*
Ga0134067_1040731323300010321Grasslands SoilVNSSLTTSLAGLVFIAVVPTLLLAGWLIVIFRATRDYD
Ga0134062_1044550123300010337Grasslands SoilMGYVGNSLTASLTDLVFISIVPTLLLVGWLIVIFRATRDYDRR*
Ga0126381_10098011033300010376Tropical Forest SoilMGYVPSHLTASLGDLIAISIVPTLLLAGWLISIYRAARSYD
Ga0134126_1292009523300010396Terrestrial SoilMRYVGNSQTASLTALIFISIVPTVLLAGWLIVIFRSTRDYDRR*
Ga0138514_10008699223300011003SoilVDTIVSASLTELIFISIIPTVLLAGWLIAIFRATRDYDKR*
Ga0137364_1092853123300012198Vadose Zone SoilMAHPALDSDNGYMGNSLTASLTSLIFISIVPTLLLAGWLIAIFRATRDYDRR*
Ga0137382_1068873113300012200Vadose Zone SoilLGRRTIGYVNSQTASLAGRVFIAVVPTLLLAGWLIVIFRATRDYDKRD*
Ga0137365_1032007023300012201Vadose Zone SoilMGYVGNSLTASLTSLIFISIVPTVLLAGWLIAIFRATRDYDRR*
Ga0137376_1114492413300012208Vadose Zone SoilTMGHVGNSLTASLTALIFISIVPTLLLAGWLIAIFRATRDYDRR*
Ga0137370_1016216113300012285Vadose Zone SoilMGYVGNSLTASLTELIFISIVPTLLLAGWLIAIFRAPRDYDRR*
Ga0137386_1018391213300012351Vadose Zone SoilMCSRLGRRTIGYVSNSLTASLTDLVFIAVVPTLLLVGWLIVIFRSTRDYD
Ga0137360_1052704223300012361Vadose Zone SoilVDTILSASLTELIFISIVPTALLAGWLIVIFRATRDYDKP*
Ga0157356_101633823300012474Unplanted SoilMGDVGNSLTASLTELIFISIIPTALLAGWLIVIFRATRDYDRR*
Ga0157353_101868523300012496Unplanted SoilASLTELIFISIVPTALLAGWLIVIFRATRDYDRR*
Ga0157314_101129123300012500Arabidopsis RhizosphereMGSVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR*
Ga0157342_100371123300012507Arabidopsis RhizosphereMGDVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR*
Ga0157338_103626723300012515Arabidopsis RhizosphereTATMGYVGNSLTASLTELIFISIIPTALLAGWLIAIFRATRDYDRR*
Ga0137416_1069721213300012927Vadose Zone SoilMGYVGNSLTASLTSLIFISIVPTVLLAGWLIVIFRASRDYDRR*
Ga0164300_1012143723300012951SoilMGYMGNSLTASLTSLLFISIVPTALLAGWLIVIFRATRDYDRR*
Ga0164308_1132758923300012985SoilMAYMGNSLTASLTSLLFISIVPTALLAGWLIVIFRATRDYDKRD*
Ga0164304_1022504423300012986SoilMGCVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDKRD*
Ga0182005_123858223300015265RhizosphereMGSVGNSLTATLTELIFISIVPTLLLAGWLIAIFRATRDYDRR*
Ga0132258_1291435723300015371Arabidopsis RhizosphereGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR*
Ga0132256_10039071323300015372Arabidopsis RhizosphereMGSVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR*
Ga0132257_10106252623300015373Arabidopsis RhizosphereVDKLSASLGDLIWIAIVPTLLLAGWLITIFRAAKDYDRPSP
Ga0132257_10121852723300015373Arabidopsis RhizosphereMGYVGNSLTASLTELIFISIIPTALLAGWLIAIFRAT
Ga0182032_1074072923300016357SoilMGKVDSHLTASLGDLIAIATVPTLLLAGWLIVIFRATRDYDRRD
Ga0163161_1158497213300017792Switchgrass RhizosphereMGYVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR
Ga0187809_1004020823300017937Freshwater SedimentVGNSLTASLTDLLFIAIVPTALLAGWLIAIFRATRDYDRRD
Ga0066655_1135610623300018431Grasslands SoilMGYVGNSLTASLTELIFISIIPTVLLAGWLIVIFRATRDYDKR
Ga0066669_1109311023300018482Grasslands SoilMGYVGNSLTASLTELIFISIVPTLLLAGWLIAIFRATRDYDRR
Ga0193701_104262023300019875SoilMGYVGNSLTASLTALIFISIVPTFLLAGWLIVIFRATRDYDRR
Ga0193747_104238423300019885SoilMRYVGNSLTASLTALIFISVVPTFLLAGWLIVIFRATRDYDKRD
Ga0206353_1077559323300020082Corn, Switchgrass And Miscanthus RhizosphereMGYVGNSLTASLTELIFISIVPTVLLAGWLIVIFRAARDYDRR
Ga0179594_1036579513300020170Vadose Zone SoilMGYVGNSLTASLTSLIFISIVPTVLLAGWLIVIFRASRDYDRR
Ga0179592_1030559923300020199Vadose Zone SoilVNSQLSASLTDLIFISVIPTLLLAGWLIVIFRSARDYDRRD
Ga0210404_1081062423300021088SoilVGNSLTASLTDLLFIAIVPTALLAGWLIVIFRATRDYDRR
Ga0210393_1162774923300021401SoilVGNSLTASLTDLLFIAIVPTALLAGWLIVIFRATRDYDRRD
Ga0210397_1000288983300021403SoilMGYVGNSLTASLTELIFISIVPTALLVGWLIVIFRATRDYDRR
Ga0182009_1026745623300021445SoilMGSVGNSLTATLTELIFISIVPTLLLAGWLIAIFRATRDYDRR
Ga0126371_1187730823300021560Tropical Forest SoilVDKLSASLGDLIWIAIIPTLLLAGWLIAIFLAAKDYDRPSPG
Ga0247677_102375913300024245SoilMGYVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYD
Ga0247676_101985823300024249SoilMGCVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDKRD
Ga0247661_104906023300024254SoilSTATMGYVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR
Ga0247692_102404623300024279SoilMGCVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR
Ga0207647_1015086023300025904Corn RhizosphereMGCVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR
Ga0207685_1020187823300025905Corn, Switchgrass And Miscanthus RhizosphereVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR
Ga0207643_1010631813300025908Miscanthus RhizosphereLAATMGYMGNSLTASLTSLLFISIVPTALLAGWLIVIFRATRDYDKRD
Ga0207684_1101051423300025910Corn, Switchgrass And Miscanthus RhizosphereMGYVGNSLTASLTALIFISIVPTVLLAGWLIVIFRATRDYDRR
Ga0207707_1012105223300025912Corn RhizosphereVGNSLTASLTELIFISIVPTVLLAGWLIVIFRAARDYDRR
Ga0207671_1116494423300025914Corn RhizosphereMGYVGNSLTASLTALIFISIVPTLLLAGWLIVIFRATRDYDRR
Ga0207649_1036585213300025920Corn RhizosphereMGYVGNSLTASLTELIFISIVPTALLAGWLIAIFRATR
Ga0207646_1007867813300025922Corn, Switchgrass And Miscanthus RhizosphereSQLSASLGDLIFIAVVPTILLAGWLIIIFRATRDYDKPD
Ga0207646_1135593013300025922Corn, Switchgrass And Miscanthus RhizosphereVGNSLTASLTALIFISIVPTVLLAGWLIVIFRATRDYDRR
Ga0207681_1049443823300025923Switchgrass RhizosphereIPPSTATMGYVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR
Ga0207700_1085816123300025928Corn, Switchgrass And Miscanthus RhizosphereMGYMGNSLTASLTSLLFISIVPTALLAGWLIVIFRATRDYDKRD
Ga0207664_1180981023300025929Agricultural SoilMGYMGNSLTASLTSLLFISIVPTALLAGWLIVIFRATRDYDKR
Ga0207644_1021371423300025931Switchgrass RhizosphereMGCVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDRR
Ga0207706_1004734843300025933Corn RhizosphereMGYVGNSLTASLTELIFISIVPTALLAGWLIAIFRGT
Ga0207691_1075636623300025940Miscanthus RhizospherePSTATMGYVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDRR
Ga0207651_1043388113300025960Switchgrass RhizosphereVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDRR
Ga0207648_1077629523300026089Miscanthus RhizosphereVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR
Ga0179587_1011132033300026557Vadose Zone SoilVDTILSASLTELIFISIVPTALLAGWLIVIFRATRDYDKP
Ga0209178_111162223300027725Agricultural SoilMGYVGNSLTASLTELIFISIIPTALLAGWLIAIFRATRDYDRR
Ga0209177_1051321323300027775Agricultural SoilMGSVGNSLTASLTELIFISIVPTLLLAGWLIAIFRATRDYDRR
Ga0209112_1024821113300027817Forest SoilMTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR
Ga0307316_1020969323300028755SoilPLAATMGYVGNSLTASLTALIFISIVPTFLLAGWLIVIFRATRDYDRR
Ga0307310_1031177713300028824SoilMGYMGNSLTASLTSLLFISIVPTFLLAGWLIVIFRATR
Ga0307498_1005805723300031170SoilMRPGTATMGSVGNSLTASLTELIFISIVPTFLLAGWLIVIFRATRDYDRR
Ga0170824_10464431123300031231Forest SoilVSNSLTASLTDLIFISVVPTLLLAGWLIVIFRATRDYDKRP
Ga0307474_1017361823300031718Hardwood Forest SoilPLAATMGYMGNSLTASLTSLLFISIVPTALLAGWLIVIFRATRDYDKRD
Ga0307469_1199361613300031720Hardwood Forest SoilMGYVGNSLTASLTALLFISIVPTFLLAGWLIVIFRATRDYDRR
Ga0318493_1023807213300031723SoilVDKLSASLGDLIWIAIVPTLLLAGWLIAIFRAAKDYD
Ga0307468_10048877213300031740Hardwood Forest SoilMGYVGNSLTASLTVLIFISIVPTVLLAGWLIVIFRATRDSDRR
Ga0318546_1131518823300031771SoilVGNCLTASLTDLLFIAIVPTALLAGWLIAIFRATRDYDRRD
Ga0318497_1034085323300031805SoilVGNSLTASLTDLLFIAIVPTALLAGWLTAIFRATRDYDRRD
Ga0318563_1047696813300032009SoilVDKLSVSLGDLIWIAVVPTLLLAGWLIAIFRAARDYD
Ga0318553_1006158113300032068SoilVDKLSASLGDLIWIAIVPTLLLAGWLIAIFRAAKDYDRPS
Ga0335085_1012677123300032770SoilMGSVGNSLTASLTELIFISIVPTLLLAGWLITIFRATRDYDRR
Ga0335085_1014774833300032770SoilVDSHLSASLGEIIVIAIVPAALLAGWLIAIFRATRDYDRPD
Ga0335085_1147167823300032770SoilMRYVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR
Ga0335085_1173252923300032770SoilVGNSLTASLTELIFISIVPTFLLAGWLIAIFRATRDYDRR
Ga0335080_1000967343300032828SoilVDSHLSASLGDLIVIAIVPTALLAGWLIAIFRATRDYDRRD
Ga0335076_1092465623300032955SoilMEYVGNSLTASLTELIFISIVPTVLLAGWLIVIFRAARDYDRR
Ga0335084_1006403413300033004SoilVGNSLTASLTELIFISIVPTLLLAGWLITIFRATRDYDRR
Ga0335073_1010706923300033134SoilMGSVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATKDYDRRD
Ga0335077_1026765433300033158SoilMGSVGNSLTASLTELIFISIVPTFLLAGWLIAIFRATRDYDRR
Ga0310811_1079379913300033475SoilMGYVGNSLTASLTELIFISIVPTALLAGWLIAIFRAT
Ga0373948_0019064_856_9903300034817Rhizosphere SoilMGYVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDKRD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.