| Basic Information | |
|---|---|
| Family ID | F055963 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MGYVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDRR |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 35.51 % |
| % of genes near scaffold ends (potentially truncated) | 30.43 % |
| % of genes from short scaffolds (< 2000 bps) | 88.41 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.754 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (8.696 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.580 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.826 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.93% β-sheet: 0.00% Coil/Unstructured: 45.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF00196 | GerE | 46.38 |
| PF05977 | MFS_3 | 22.46 |
| PF12697 | Abhydrolase_6 | 5.07 |
| PF07690 | MFS_1 | 4.35 |
| PF00561 | Abhydrolase_1 | 4.35 |
| PF13191 | AAA_16 | 2.90 |
| PF05331 | DUF742 | 0.72 |
| PF05960 | DUF885 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 22.46 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.75 % |
| Unclassified | root | N/A | 7.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559006|FI_contig02788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1992 | Open in IMG/M |
| 2170459005|F1BAP7Q01DW5I8 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
| 2199352024|deeps__Contig_190064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
| 3300005147|Ga0066821_1026419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
| 3300005159|Ga0066808_1038458 | Not Available | 516 | Open in IMG/M |
| 3300005163|Ga0066823_10157807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300005172|Ga0066683_10465419 | Not Available | 774 | Open in IMG/M |
| 3300005175|Ga0066673_10807654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300005179|Ga0066684_10920121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 570 | Open in IMG/M |
| 3300005186|Ga0066676_10404856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 920 | Open in IMG/M |
| 3300005327|Ga0070658_10711844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 872 | Open in IMG/M |
| 3300005331|Ga0070670_100093532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2586 | Open in IMG/M |
| 3300005332|Ga0066388_104023939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 750 | Open in IMG/M |
| 3300005336|Ga0070680_100022374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 5035 | Open in IMG/M |
| 3300005338|Ga0068868_100184278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 1733 | Open in IMG/M |
| 3300005338|Ga0068868_101015179 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300005345|Ga0070692_11167526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
| 3300005353|Ga0070669_101404138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
| 3300005364|Ga0070673_100018301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5000 | Open in IMG/M |
| 3300005365|Ga0070688_100451830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 961 | Open in IMG/M |
| 3300005434|Ga0070709_10512885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 912 | Open in IMG/M |
| 3300005435|Ga0070714_102506882 | Not Available | 500 | Open in IMG/M |
| 3300005437|Ga0070710_11235031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 553 | Open in IMG/M |
| 3300005445|Ga0070708_101203941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 708 | Open in IMG/M |
| 3300005458|Ga0070681_10066933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 3561 | Open in IMG/M |
| 3300005468|Ga0070707_100188497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 2011 | Open in IMG/M |
| 3300005545|Ga0070695_100245612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1300 | Open in IMG/M |
| 3300005563|Ga0068855_102089611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300005569|Ga0066705_10580075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 691 | Open in IMG/M |
| 3300005764|Ga0066903_108218829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300005840|Ga0068870_10130929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1457 | Open in IMG/M |
| 3300005842|Ga0068858_100373100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1368 | Open in IMG/M |
| 3300005983|Ga0081540_1000216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 61035 | Open in IMG/M |
| 3300006173|Ga0070716_101835969 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300006581|Ga0074048_13118591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300006605|Ga0074057_11701157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1007 | Open in IMG/M |
| 3300006606|Ga0074062_12750551 | Not Available | 632 | Open in IMG/M |
| 3300006755|Ga0079222_12244940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 544 | Open in IMG/M |
| 3300006755|Ga0079222_12422680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300006800|Ga0066660_11416658 | Not Available | 545 | Open in IMG/M |
| 3300006904|Ga0075424_100107930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2938 | Open in IMG/M |
| 3300006954|Ga0079219_10245823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1059 | Open in IMG/M |
| 3300007258|Ga0099793_10087199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 1431 | Open in IMG/M |
| 3300009098|Ga0105245_13235865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300009177|Ga0105248_11574213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300009792|Ga0126374_10118958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1540 | Open in IMG/M |
| 3300010046|Ga0126384_10153538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1775 | Open in IMG/M |
| 3300010046|Ga0126384_10512408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1036 | Open in IMG/M |
| 3300010321|Ga0134067_10116872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 926 | Open in IMG/M |
| 3300010321|Ga0134067_10407313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| 3300010337|Ga0134062_10445501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 642 | Open in IMG/M |
| 3300010376|Ga0126381_100980110 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300010396|Ga0134126_12920095 | Not Available | 517 | Open in IMG/M |
| 3300011003|Ga0138514_100086992 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300012198|Ga0137364_10928531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 659 | Open in IMG/M |
| 3300012200|Ga0137382_10688731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 732 | Open in IMG/M |
| 3300012201|Ga0137365_10320070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1148 | Open in IMG/M |
| 3300012208|Ga0137376_11144924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Sciscionella → unclassified Sciscionella → Sciscionella sp. | 665 | Open in IMG/M |
| 3300012285|Ga0137370_10162161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1298 | Open in IMG/M |
| 3300012351|Ga0137386_10183912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1500 | Open in IMG/M |
| 3300012361|Ga0137360_10527042 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300012474|Ga0157356_1016338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300012496|Ga0157353_1018685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 649 | Open in IMG/M |
| 3300012500|Ga0157314_1011291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 785 | Open in IMG/M |
| 3300012507|Ga0157342_1003711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1324 | Open in IMG/M |
| 3300012515|Ga0157338_1036267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 652 | Open in IMG/M |
| 3300012927|Ga0137416_10697212 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300012951|Ga0164300_10121437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 1181 | Open in IMG/M |
| 3300012985|Ga0164308_11327589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium URHB0048 | 654 | Open in IMG/M |
| 3300012986|Ga0164304_10225044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1241 | Open in IMG/M |
| 3300015265|Ga0182005_1238582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 559 | Open in IMG/M |
| 3300015371|Ga0132258_12914357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1188 | Open in IMG/M |
| 3300015372|Ga0132256_100390713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium URHB0062 | 1492 | Open in IMG/M |
| 3300015373|Ga0132257_101062526 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300015373|Ga0132257_101218527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 953 | Open in IMG/M |
| 3300016357|Ga0182032_10740729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 827 | Open in IMG/M |
| 3300017792|Ga0163161_11584972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300017937|Ga0187809_10040208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium URHB0062 | 1501 | Open in IMG/M |
| 3300018431|Ga0066655_11356106 | Not Available | 514 | Open in IMG/M |
| 3300018482|Ga0066669_11093110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium URHB0048 | 720 | Open in IMG/M |
| 3300019875|Ga0193701_1042620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 927 | Open in IMG/M |
| 3300019885|Ga0193747_1042384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1134 | Open in IMG/M |
| 3300020082|Ga0206353_10775593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1988 | Open in IMG/M |
| 3300020170|Ga0179594_10365795 | Not Available | 547 | Open in IMG/M |
| 3300020199|Ga0179592_10305599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 706 | Open in IMG/M |
| 3300021088|Ga0210404_10810624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300021401|Ga0210393_11627749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
| 3300021403|Ga0210397_10002889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10688 | Open in IMG/M |
| 3300021445|Ga0182009_10267456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 853 | Open in IMG/M |
| 3300021560|Ga0126371_11877308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora | 719 | Open in IMG/M |
| 3300024245|Ga0247677_1023759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 877 | Open in IMG/M |
| 3300024249|Ga0247676_1019858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1060 | Open in IMG/M |
| 3300024254|Ga0247661_1049060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 772 | Open in IMG/M |
| 3300024279|Ga0247692_1024046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 932 | Open in IMG/M |
| 3300025904|Ga0207647_10150860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium URHB0048 | 1358 | Open in IMG/M |
| 3300025905|Ga0207685_10201878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 935 | Open in IMG/M |
| 3300025908|Ga0207643_10106318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1649 | Open in IMG/M |
| 3300025910|Ga0207684_11010514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 695 | Open in IMG/M |
| 3300025912|Ga0207707_10121052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2288 | Open in IMG/M |
| 3300025914|Ga0207671_11164944 | Not Available | 604 | Open in IMG/M |
| 3300025920|Ga0207649_10365852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1071 | Open in IMG/M |
| 3300025922|Ga0207646_10078678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2947 | Open in IMG/M |
| 3300025922|Ga0207646_11355930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 620 | Open in IMG/M |
| 3300025923|Ga0207681_10494438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1001 | Open in IMG/M |
| 3300025928|Ga0207700_10858161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 812 | Open in IMG/M |
| 3300025929|Ga0207664_11809810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
| 3300025931|Ga0207644_10213714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium URHB0062 | 1526 | Open in IMG/M |
| 3300025933|Ga0207706_10047348 | All Organisms → cellular organisms → Bacteria | 3805 | Open in IMG/M |
| 3300025940|Ga0207691_10756366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 818 | Open in IMG/M |
| 3300025960|Ga0207651_10433881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1124 | Open in IMG/M |
| 3300026089|Ga0207648_10776295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 891 | Open in IMG/M |
| 3300026557|Ga0179587_10111320 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300027725|Ga0209178_1111622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
| 3300027775|Ga0209177_10513213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
| 3300027817|Ga0209112_10248211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 622 | Open in IMG/M |
| 3300028755|Ga0307316_10209693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 703 | Open in IMG/M |
| 3300028824|Ga0307310_10311777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 767 | Open in IMG/M |
| 3300031170|Ga0307498_10058057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1072 | Open in IMG/M |
| 3300031231|Ga0170824_104644311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300031718|Ga0307474_10173618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1634 | Open in IMG/M |
| 3300031720|Ga0307469_11993616 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031723|Ga0318493_10238072 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300031740|Ga0307468_100488772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 972 | Open in IMG/M |
| 3300031771|Ga0318546_11315188 | Not Available | 508 | Open in IMG/M |
| 3300031805|Ga0318497_10340853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 837 | Open in IMG/M |
| 3300032009|Ga0318563_10476968 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300032068|Ga0318553_10061581 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
| 3300032770|Ga0335085_10126771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 3246 | Open in IMG/M |
| 3300032770|Ga0335085_10147748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2954 | Open in IMG/M |
| 3300032770|Ga0335085_11471678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 711 | Open in IMG/M |
| 3300032770|Ga0335085_11732529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 642 | Open in IMG/M |
| 3300032828|Ga0335080_10009673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10085 | Open in IMG/M |
| 3300032955|Ga0335076_10924656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
| 3300033004|Ga0335084_10064034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3802 | Open in IMG/M |
| 3300033134|Ga0335073_10107069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 3603 | Open in IMG/M |
| 3300033158|Ga0335077_10267654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1886 | Open in IMG/M |
| 3300033475|Ga0310811_10793799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 886 | Open in IMG/M |
| 3300034817|Ga0373948_0019064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 1294 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.17% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.17% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.17% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.17% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.45% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.72% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.72% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.72% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
| 3300005159 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPB | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
| 3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
| 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00740190 | 2166559006 | Grass Soil | VSNSLTASLTDLIFISIVPTLLLAGWLIVIFRATRDYDKP |
| E41_04880500 | 2170459005 | Grass Soil | MGYVGNSLTASLTELIFISIVPTFLLAGWLIVIFR |
| deeps_03605740 | 2199352024 | Soil | MGYVGNSLTASLTELIFISIVPTLLLAGWLIVIFRATRDYDRR |
| Ga0066821_10264191 | 3300005147 | Soil | MGYVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR* |
| Ga0066808_10384581 | 3300005159 | Soil | MGYVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDRR* |
| Ga0066823_101578071 | 3300005163 | Soil | MGYVGNSLTASLTELIFISIVPTFLLAGWLIVIFRATRDYDRR* |
| Ga0066683_104654192 | 3300005172 | Soil | MGYVGNSLTASLTDLVFIAVIPTILLVGWLIVIFRATRDYDRRD* |
| Ga0066673_108076542 | 3300005175 | Soil | MGYVDNSLTASLTELIFISIVPTLLLAGWLIAIFRATRDYDRR* |
| Ga0066684_109201212 | 3300005179 | Soil | MGYVGNSLTASLTELIFISIVPTLLLAGWLIAIFRATRDYDRR* |
| Ga0066676_104048562 | 3300005186 | Soil | VDTILSASLTELIFISIIPTVLLAGWLIVIFRATRDYDKR* |
| Ga0070658_107118442 | 3300005327 | Corn Rhizosphere | MGYVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR* |
| Ga0070670_1000935323 | 3300005331 | Switchgrass Rhizosphere | MGYVGNSLTASLTELIFISIVPTALLAGWLIVIFRAARDYDRR* |
| Ga0066388_1040239391 | 3300005332 | Tropical Forest Soil | ATMGSVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR* |
| Ga0070680_1000223743 | 3300005336 | Corn Rhizosphere | MGCVGNSLTASLTELIFISIVPTVLLAGWLIVIFRAARDYDRR* |
| Ga0068868_1001842782 | 3300005338 | Miscanthus Rhizosphere | MGYVGNSLTASLTELIFISIVPTVLLAGWLIVIFRAARDYDRR* |
| Ga0068868_1010151792 | 3300005338 | Miscanthus Rhizosphere | MGYVGNSLTASLTALIFISIVPTLLLAGWLIVIFRATRDYDRR* |
| Ga0070692_111675261 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | PSTATMGYVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDRR* |
| Ga0070669_1014041382 | 3300005353 | Switchgrass Rhizosphere | ATMGYVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR* |
| Ga0070673_1000183013 | 3300005364 | Switchgrass Rhizosphere | VGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR* |
| Ga0070688_1004518302 | 3300005365 | Switchgrass Rhizosphere | MGCVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR* |
| Ga0070709_105128852 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYMGNSLTASLTSLLFISIVPTALLAGWLIVIFRATRDYDKRD* |
| Ga0070714_1025068822 | 3300005435 | Agricultural Soil | MGCVGNSLTASLTELIFISIVPTALLIGWLIAIFRATRDYDRR* |
| Ga0070710_112350312 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYMGNSLTASLTSLLFISIVPTFLLAGWLIVIFRATRDYDKRD* |
| Ga0070708_1012039412 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYVGNSLTASLTALIFISIVPTVLLAGWLIVIFRATRDYDRR* |
| Ga0070681_100669333 | 3300005458 | Corn Rhizosphere | VGNSLTASLTELIFISIVPTVLLAGWLIVIFRAARDYDRR* |
| Ga0070707_1001884972 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MGCVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDRR* |
| Ga0070695_1002456122 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYVGNSLTASLTALIFISIVPTFLLAGWLIVIFRATRDYDRR* |
| Ga0068855_1020896111 | 3300005563 | Corn Rhizosphere | MGYVGNSLTASLTALLFISIVPTFLLAGWLIVIFRATRDYDRR* |
| Ga0066705_105800751 | 3300005569 | Soil | ASLTELIFISIVPTLLLAGWLIAIFRATRDYDRR* |
| Ga0066903_1082188291 | 3300005764 | Tropical Forest Soil | AATMGYVDNSLTASLTELIFISIVPTVLLAGWLIAIFRATRDYDRR* |
| Ga0068870_101309292 | 3300005840 | Miscanthus Rhizosphere | MGYVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDKRD* |
| Ga0068858_1003731002 | 3300005842 | Switchgrass Rhizosphere | VGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR* |
| Ga0081540_100021611 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VGNSLTASLTELIFISIVPTLLLAGWLIAIFRATRDYDRR* |
| Ga0070716_1018359691 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYVGNSLTASLTDLIFISIVPTVLLAGWLIVIFWATRDYDRR* |
| Ga0074048_131185911 | 3300006581 | Soil | GNSLTASLTSLIFISIVPTFLLAGWLIMIFRATRDYDKRD* |
| Ga0074057_117011572 | 3300006605 | Soil | MGYVGNSLTASLTELIFISIVPTLLLAGWLIVIFRATRDYDRR* |
| Ga0074062_127505512 | 3300006606 | Soil | MGYMGNSLTASLTSLIFISIVPTFLLAGWLIMIFRATRDYDKRD* |
| Ga0079222_122449402 | 3300006755 | Agricultural Soil | MGYVGNSLTASLTELIFISIIPTALLAGWLIAIFRATRDYDRR* |
| Ga0079222_124226802 | 3300006755 | Agricultural Soil | LTASLTELIFISIIPTALLAGWLIVIFRATRDYDRR* |
| Ga0066660_114166582 | 3300006800 | Soil | VNSSLTTSLAGLVFIAVVPTLLLAGWLIVIFRATRDYDPPSPGAR |
| Ga0075424_1001079302 | 3300006904 | Populus Rhizosphere | MGHVGNSLTASLTALIFISIVPTLLLAGWLIVIFRATRDYDRR* |
| Ga0079219_102458232 | 3300006954 | Agricultural Soil | MGYVGNSLTASLTELIFISIIPTALLAGWLIAIFRATRDYD |
| Ga0099793_100871992 | 3300007258 | Vadose Zone Soil | VNSQLSASLTDLIFISVIPTLLLAGWLIVIFRSARDYDRRD* |
| Ga0105245_132358652 | 3300009098 | Miscanthus Rhizosphere | MGCVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR* |
| Ga0105248_115742132 | 3300009177 | Switchgrass Rhizosphere | MGYVGNSLTASLTELIFISIVPTALLAGWLIAIFR |
| Ga0126374_101189581 | 3300009792 | Tropical Forest Soil | MGYVDNSLTASLTELIFISIVPTVLLAGWLIAIFRATRDYDRR* |
| Ga0126384_101535381 | 3300010046 | Tropical Forest Soil | MGFVGNSLTASLTELIFISIVPTLLLAGWLIAIFRATRDYDRR* |
| Ga0126384_105124082 | 3300010046 | Tropical Forest Soil | MGYVDNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR* |
| Ga0134067_101168722 | 3300010321 | Grasslands Soil | MGYMGNSLTASLTELIFISIVPTLLLAGWLIAIFRATRDYDRR* |
| Ga0134067_104073132 | 3300010321 | Grasslands Soil | VNSSLTTSLAGLVFIAVVPTLLLAGWLIVIFRATRDYD |
| Ga0134062_104455012 | 3300010337 | Grasslands Soil | MGYVGNSLTASLTDLVFISIVPTLLLVGWLIVIFRATRDYDRR* |
| Ga0126381_1009801103 | 3300010376 | Tropical Forest Soil | MGYVPSHLTASLGDLIAISIVPTLLLAGWLISIYRAARSYD |
| Ga0134126_129200952 | 3300010396 | Terrestrial Soil | MRYVGNSQTASLTALIFISIVPTVLLAGWLIVIFRSTRDYDRR* |
| Ga0138514_1000869922 | 3300011003 | Soil | VDTIVSASLTELIFISIIPTVLLAGWLIAIFRATRDYDKR* |
| Ga0137364_109285312 | 3300012198 | Vadose Zone Soil | MAHPALDSDNGYMGNSLTASLTSLIFISIVPTLLLAGWLIAIFRATRDYDRR* |
| Ga0137382_106887311 | 3300012200 | Vadose Zone Soil | LGRRTIGYVNSQTASLAGRVFIAVVPTLLLAGWLIVIFRATRDYDKRD* |
| Ga0137365_103200702 | 3300012201 | Vadose Zone Soil | MGYVGNSLTASLTSLIFISIVPTVLLAGWLIAIFRATRDYDRR* |
| Ga0137376_111449241 | 3300012208 | Vadose Zone Soil | TMGHVGNSLTASLTALIFISIVPTLLLAGWLIAIFRATRDYDRR* |
| Ga0137370_101621611 | 3300012285 | Vadose Zone Soil | MGYVGNSLTASLTELIFISIVPTLLLAGWLIAIFRAPRDYDRR* |
| Ga0137386_101839121 | 3300012351 | Vadose Zone Soil | MCSRLGRRTIGYVSNSLTASLTDLVFIAVVPTLLLVGWLIVIFRSTRDYD |
| Ga0137360_105270422 | 3300012361 | Vadose Zone Soil | VDTILSASLTELIFISIVPTALLAGWLIVIFRATRDYDKP* |
| Ga0157356_10163382 | 3300012474 | Unplanted Soil | MGDVGNSLTASLTELIFISIIPTALLAGWLIVIFRATRDYDRR* |
| Ga0157353_10186852 | 3300012496 | Unplanted Soil | ASLTELIFISIVPTALLAGWLIVIFRATRDYDRR* |
| Ga0157314_10112912 | 3300012500 | Arabidopsis Rhizosphere | MGSVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR* |
| Ga0157342_10037112 | 3300012507 | Arabidopsis Rhizosphere | MGDVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR* |
| Ga0157338_10362672 | 3300012515 | Arabidopsis Rhizosphere | TATMGYVGNSLTASLTELIFISIIPTALLAGWLIAIFRATRDYDRR* |
| Ga0137416_106972121 | 3300012927 | Vadose Zone Soil | MGYVGNSLTASLTSLIFISIVPTVLLAGWLIVIFRASRDYDRR* |
| Ga0164300_101214372 | 3300012951 | Soil | MGYMGNSLTASLTSLLFISIVPTALLAGWLIVIFRATRDYDRR* |
| Ga0164308_113275892 | 3300012985 | Soil | MAYMGNSLTASLTSLLFISIVPTALLAGWLIVIFRATRDYDKRD* |
| Ga0164304_102250442 | 3300012986 | Soil | MGCVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDKRD* |
| Ga0182005_12385822 | 3300015265 | Rhizosphere | MGSVGNSLTATLTELIFISIVPTLLLAGWLIAIFRATRDYDRR* |
| Ga0132258_129143572 | 3300015371 | Arabidopsis Rhizosphere | GNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR* |
| Ga0132256_1003907132 | 3300015372 | Arabidopsis Rhizosphere | MGSVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR* |
| Ga0132257_1010625262 | 3300015373 | Arabidopsis Rhizosphere | VDKLSASLGDLIWIAIVPTLLLAGWLITIFRAAKDYDRPSP |
| Ga0132257_1012185272 | 3300015373 | Arabidopsis Rhizosphere | MGYVGNSLTASLTELIFISIIPTALLAGWLIAIFRAT |
| Ga0182032_107407292 | 3300016357 | Soil | MGKVDSHLTASLGDLIAIATVPTLLLAGWLIVIFRATRDYDRRD |
| Ga0163161_115849721 | 3300017792 | Switchgrass Rhizosphere | MGYVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR |
| Ga0187809_100402082 | 3300017937 | Freshwater Sediment | VGNSLTASLTDLLFIAIVPTALLAGWLIAIFRATRDYDRRD |
| Ga0066655_113561062 | 3300018431 | Grasslands Soil | MGYVGNSLTASLTELIFISIIPTVLLAGWLIVIFRATRDYDKR |
| Ga0066669_110931102 | 3300018482 | Grasslands Soil | MGYVGNSLTASLTELIFISIVPTLLLAGWLIAIFRATRDYDRR |
| Ga0193701_10426202 | 3300019875 | Soil | MGYVGNSLTASLTALIFISIVPTFLLAGWLIVIFRATRDYDRR |
| Ga0193747_10423842 | 3300019885 | Soil | MRYVGNSLTASLTALIFISVVPTFLLAGWLIVIFRATRDYDKRD |
| Ga0206353_107755932 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYVGNSLTASLTELIFISIVPTVLLAGWLIVIFRAARDYDRR |
| Ga0179594_103657951 | 3300020170 | Vadose Zone Soil | MGYVGNSLTASLTSLIFISIVPTVLLAGWLIVIFRASRDYDRR |
| Ga0179592_103055992 | 3300020199 | Vadose Zone Soil | VNSQLSASLTDLIFISVIPTLLLAGWLIVIFRSARDYDRRD |
| Ga0210404_108106242 | 3300021088 | Soil | VGNSLTASLTDLLFIAIVPTALLAGWLIVIFRATRDYDRR |
| Ga0210393_116277492 | 3300021401 | Soil | VGNSLTASLTDLLFIAIVPTALLAGWLIVIFRATRDYDRRD |
| Ga0210397_100028898 | 3300021403 | Soil | MGYVGNSLTASLTELIFISIVPTALLVGWLIVIFRATRDYDRR |
| Ga0182009_102674562 | 3300021445 | Soil | MGSVGNSLTATLTELIFISIVPTLLLAGWLIAIFRATRDYDRR |
| Ga0126371_118773082 | 3300021560 | Tropical Forest Soil | VDKLSASLGDLIWIAIIPTLLLAGWLIAIFLAAKDYDRPSPG |
| Ga0247677_10237591 | 3300024245 | Soil | MGYVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYD |
| Ga0247676_10198582 | 3300024249 | Soil | MGCVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDKRD |
| Ga0247661_10490602 | 3300024254 | Soil | STATMGYVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR |
| Ga0247692_10240462 | 3300024279 | Soil | MGCVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR |
| Ga0207647_101508602 | 3300025904 | Corn Rhizosphere | MGCVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR |
| Ga0207685_102018782 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR |
| Ga0207643_101063181 | 3300025908 | Miscanthus Rhizosphere | LAATMGYMGNSLTASLTSLLFISIVPTALLAGWLIVIFRATRDYDKRD |
| Ga0207684_110105142 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYVGNSLTASLTALIFISIVPTVLLAGWLIVIFRATRDYDRR |
| Ga0207707_101210522 | 3300025912 | Corn Rhizosphere | VGNSLTASLTELIFISIVPTVLLAGWLIVIFRAARDYDRR |
| Ga0207671_111649442 | 3300025914 | Corn Rhizosphere | MGYVGNSLTASLTALIFISIVPTLLLAGWLIVIFRATRDYDRR |
| Ga0207649_103658521 | 3300025920 | Corn Rhizosphere | MGYVGNSLTASLTELIFISIVPTALLAGWLIAIFRATR |
| Ga0207646_100786781 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SQLSASLGDLIFIAVVPTILLAGWLIIIFRATRDYDKPD |
| Ga0207646_113559301 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VGNSLTASLTALIFISIVPTVLLAGWLIVIFRATRDYDRR |
| Ga0207681_104944382 | 3300025923 | Switchgrass Rhizosphere | IPPSTATMGYVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATRDYDRR |
| Ga0207700_108581612 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYMGNSLTASLTSLLFISIVPTALLAGWLIVIFRATRDYDKRD |
| Ga0207664_118098102 | 3300025929 | Agricultural Soil | MGYMGNSLTASLTSLLFISIVPTALLAGWLIVIFRATRDYDKR |
| Ga0207644_102137142 | 3300025931 | Switchgrass Rhizosphere | MGCVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDRR |
| Ga0207706_100473484 | 3300025933 | Corn Rhizosphere | MGYVGNSLTASLTELIFISIVPTALLAGWLIAIFRGT |
| Ga0207691_107563662 | 3300025940 | Miscanthus Rhizosphere | PSTATMGYVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDRR |
| Ga0207651_104338811 | 3300025960 | Switchgrass Rhizosphere | VGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDRR |
| Ga0207648_107762952 | 3300026089 | Miscanthus Rhizosphere | VGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR |
| Ga0179587_101113203 | 3300026557 | Vadose Zone Soil | VDTILSASLTELIFISIVPTALLAGWLIVIFRATRDYDKP |
| Ga0209178_11116222 | 3300027725 | Agricultural Soil | MGYVGNSLTASLTELIFISIIPTALLAGWLIAIFRATRDYDRR |
| Ga0209177_105132132 | 3300027775 | Agricultural Soil | MGSVGNSLTASLTELIFISIVPTLLLAGWLIAIFRATRDYDRR |
| Ga0209112_102482111 | 3300027817 | Forest Soil | MTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR |
| Ga0307316_102096932 | 3300028755 | Soil | PLAATMGYVGNSLTASLTALIFISIVPTFLLAGWLIVIFRATRDYDRR |
| Ga0307310_103117771 | 3300028824 | Soil | MGYMGNSLTASLTSLLFISIVPTFLLAGWLIVIFRATR |
| Ga0307498_100580572 | 3300031170 | Soil | MRPGTATMGSVGNSLTASLTELIFISIVPTFLLAGWLIVIFRATRDYDRR |
| Ga0170824_1046443112 | 3300031231 | Forest Soil | VSNSLTASLTDLIFISVVPTLLLAGWLIVIFRATRDYDKRP |
| Ga0307474_101736182 | 3300031718 | Hardwood Forest Soil | PLAATMGYMGNSLTASLTSLLFISIVPTALLAGWLIVIFRATRDYDKRD |
| Ga0307469_119936161 | 3300031720 | Hardwood Forest Soil | MGYVGNSLTASLTALLFISIVPTFLLAGWLIVIFRATRDYDRR |
| Ga0318493_102380721 | 3300031723 | Soil | VDKLSASLGDLIWIAIVPTLLLAGWLIAIFRAAKDYD |
| Ga0307468_1004887721 | 3300031740 | Hardwood Forest Soil | MGYVGNSLTASLTVLIFISIVPTVLLAGWLIVIFRATRDSDRR |
| Ga0318546_113151882 | 3300031771 | Soil | VGNCLTASLTDLLFIAIVPTALLAGWLIAIFRATRDYDRRD |
| Ga0318497_103408532 | 3300031805 | Soil | VGNSLTASLTDLLFIAIVPTALLAGWLTAIFRATRDYDRRD |
| Ga0318563_104769681 | 3300032009 | Soil | VDKLSVSLGDLIWIAVVPTLLLAGWLIAIFRAARDYD |
| Ga0318553_100615811 | 3300032068 | Soil | VDKLSASLGDLIWIAIVPTLLLAGWLIAIFRAAKDYDRPS |
| Ga0335085_101267712 | 3300032770 | Soil | MGSVGNSLTASLTELIFISIVPTLLLAGWLITIFRATRDYDRR |
| Ga0335085_101477483 | 3300032770 | Soil | VDSHLSASLGEIIVIAIVPAALLAGWLIAIFRATRDYDRPD |
| Ga0335085_114716782 | 3300032770 | Soil | MRYVGNSLTASLTELIFISIVPTALLAGWLIAIFRATRDYDRR |
| Ga0335085_117325292 | 3300032770 | Soil | VGNSLTASLTELIFISIVPTFLLAGWLIAIFRATRDYDRR |
| Ga0335080_100096734 | 3300032828 | Soil | VDSHLSASLGDLIVIAIVPTALLAGWLIAIFRATRDYDRRD |
| Ga0335076_109246562 | 3300032955 | Soil | MEYVGNSLTASLTELIFISIVPTVLLAGWLIVIFRAARDYDRR |
| Ga0335084_100640341 | 3300033004 | Soil | VGNSLTASLTELIFISIVPTLLLAGWLITIFRATRDYDRR |
| Ga0335073_101070692 | 3300033134 | Soil | MGSVGNSLTASLTELIFISIVPTVLLAGWLIVIFRATKDYDRRD |
| Ga0335077_102676543 | 3300033158 | Soil | MGSVGNSLTASLTELIFISIVPTFLLAGWLIAIFRATRDYDRR |
| Ga0310811_107937991 | 3300033475 | Soil | MGYVGNSLTASLTELIFISIVPTALLAGWLIAIFRAT |
| Ga0373948_0019064_856_990 | 3300034817 | Rhizosphere Soil | MGYVGNSLTASLTELIFISIVPTALLAGWLIVIFRATRDYDKRD |
| ⦗Top⦘ |