| Basic Information | |
|---|---|
| Family ID | F055946 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VLTERLEFVPERDAEIFATVPAAPAVFLLRGEDARAEPYVSKT |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 10.14 % |
| % of genes near scaffold ends (potentially truncated) | 97.83 % |
| % of genes from short scaffolds (< 2000 bps) | 88.41 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.971 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog (7.971 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.014 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.130 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.68% β-sheet: 0.00% Coil/Unstructured: 87.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF01695 | IstB_IS21 | 36.23 |
| PF01541 | GIY-YIG | 7.97 |
| PF00216 | Bac_DNA_binding | 5.07 |
| PF11918 | Peptidase_S41_N | 2.17 |
| PF09965 | DUF2199 | 1.45 |
| PF13456 | RVT_3 | 1.45 |
| PF01197 | Ribosomal_L31 | 0.72 |
| PF03466 | LysR_substrate | 0.72 |
| PF01370 | Epimerase | 0.72 |
| PF01207 | Dus | 0.72 |
| PF12850 | Metallophos_2 | 0.72 |
| PF12704 | MacB_PCD | 0.72 |
| PF12681 | Glyoxalase_2 | 0.72 |
| PF14559 | TPR_19 | 0.72 |
| PF12631 | MnmE_helical | 0.72 |
| PF13620 | CarboxypepD_reg | 0.72 |
| PF01641 | SelR | 0.72 |
| PF04055 | Radical_SAM | 0.72 |
| PF01520 | Amidase_3 | 0.72 |
| PF02567 | PhzC-PhzF | 0.72 |
| PF14520 | HHH_5 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 36.23 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 5.07 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG0254 | Ribosomal protein L31 | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.72 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.97 % |
| Unclassified | root | N/A | 42.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002914|JGI25617J43924_10144122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 824 | Open in IMG/M |
| 3300004091|Ga0062387_100529455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 829 | Open in IMG/M |
| 3300004091|Ga0062387_100600412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 789 | Open in IMG/M |
| 3300005445|Ga0070708_101441818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 642 | Open in IMG/M |
| 3300005459|Ga0068867_100181936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1672 | Open in IMG/M |
| 3300005518|Ga0070699_101179118 | Not Available | 703 | Open in IMG/M |
| 3300005538|Ga0070731_11118650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 520 | Open in IMG/M |
| 3300005559|Ga0066700_11016297 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005563|Ga0068855_100119445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3018 | Open in IMG/M |
| 3300005575|Ga0066702_10790335 | Not Available | 565 | Open in IMG/M |
| 3300005591|Ga0070761_10112111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1579 | Open in IMG/M |
| 3300005591|Ga0070761_11050862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 518 | Open in IMG/M |
| 3300005598|Ga0066706_11328152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300005617|Ga0068859_101352274 | Not Available | 785 | Open in IMG/M |
| 3300005905|Ga0075269_10001886 | Not Available | 3084 | Open in IMG/M |
| 3300006032|Ga0066696_10278416 | Not Available | 1084 | Open in IMG/M |
| 3300006041|Ga0075023_100565413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 523 | Open in IMG/M |
| 3300006050|Ga0075028_100647759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 631 | Open in IMG/M |
| 3300006102|Ga0075015_100051263 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
| 3300006102|Ga0075015_100891245 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006162|Ga0075030_100213910 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
| 3300006174|Ga0075014_100983897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 510 | Open in IMG/M |
| 3300006175|Ga0070712_100691036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 869 | Open in IMG/M |
| 3300006176|Ga0070765_100037166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3860 | Open in IMG/M |
| 3300006755|Ga0079222_11226358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 675 | Open in IMG/M |
| 3300006893|Ga0073928_10131646 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
| 3300006893|Ga0073928_10650064 | Not Available | 740 | Open in IMG/M |
| 3300006903|Ga0075426_10270059 | Not Available | 1240 | Open in IMG/M |
| 3300009088|Ga0099830_10595702 | Not Available | 906 | Open in IMG/M |
| 3300009092|Ga0105250_10381576 | Not Available | 622 | Open in IMG/M |
| 3300009162|Ga0075423_12726924 | Not Available | 541 | Open in IMG/M |
| 3300009520|Ga0116214_1380720 | Not Available | 549 | Open in IMG/M |
| 3300009522|Ga0116218_1480274 | Not Available | 554 | Open in IMG/M |
| 3300009551|Ga0105238_10760928 | Not Available | 983 | Open in IMG/M |
| 3300009624|Ga0116105_1125508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300009634|Ga0116124_1043811 | Not Available | 1337 | Open in IMG/M |
| 3300009644|Ga0116121_1027410 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
| 3300009644|Ga0116121_1169769 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300009645|Ga0116106_1059223 | Not Available | 1269 | Open in IMG/M |
| 3300009665|Ga0116135_1184807 | Not Available | 791 | Open in IMG/M |
| 3300009839|Ga0116223_10309695 | Not Available | 941 | Open in IMG/M |
| 3300010339|Ga0074046_10362702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 880 | Open in IMG/M |
| 3300010341|Ga0074045_10672858 | Not Available | 658 | Open in IMG/M |
| 3300011270|Ga0137391_11080677 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300012201|Ga0137365_10176965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1598 | Open in IMG/M |
| 3300012212|Ga0150985_104273411 | Not Available | 648 | Open in IMG/M |
| 3300012351|Ga0137386_10291765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1174 | Open in IMG/M |
| 3300012362|Ga0137361_10773729 | Not Available | 874 | Open in IMG/M |
| 3300012923|Ga0137359_10301819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1426 | Open in IMG/M |
| 3300012925|Ga0137419_11418146 | Not Available | 587 | Open in IMG/M |
| 3300012989|Ga0164305_10094058 | Not Available | 1905 | Open in IMG/M |
| 3300014156|Ga0181518_10010044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7367 | Open in IMG/M |
| 3300014165|Ga0181523_10227140 | Not Available | 1073 | Open in IMG/M |
| 3300014169|Ga0181531_10189313 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300014325|Ga0163163_10239610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1864 | Open in IMG/M |
| 3300014490|Ga0182010_10075417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1652 | Open in IMG/M |
| 3300014501|Ga0182024_12429236 | Not Available | 567 | Open in IMG/M |
| 3300014654|Ga0181525_10847968 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 517 | Open in IMG/M |
| 3300014657|Ga0181522_10085890 | Not Available | 1806 | Open in IMG/M |
| 3300015356|Ga0134073_10381440 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300016422|Ga0182039_11838973 | Not Available | 555 | Open in IMG/M |
| 3300016750|Ga0181505_10044886 | Not Available | 947 | Open in IMG/M |
| 3300017822|Ga0187802_10177027 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300017823|Ga0187818_10247340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300017924|Ga0187820_1068043 | Not Available | 986 | Open in IMG/M |
| 3300017955|Ga0187817_10739414 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300017996|Ga0187891_1045900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1860 | Open in IMG/M |
| 3300018008|Ga0187888_1064646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1636 | Open in IMG/M |
| 3300018030|Ga0187869_10369863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300018034|Ga0187863_10499523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 681 | Open in IMG/M |
| 3300018038|Ga0187855_10507130 | Not Available | 703 | Open in IMG/M |
| 3300018043|Ga0187887_10633742 | Not Available | 631 | Open in IMG/M |
| 3300018043|Ga0187887_10911946 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300018044|Ga0187890_10496919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300018089|Ga0187774_11099993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300020001|Ga0193731_1084926 | Not Available | 823 | Open in IMG/M |
| 3300020580|Ga0210403_11297125 | Not Available | 556 | Open in IMG/M |
| 3300021088|Ga0210404_10751883 | Not Available | 556 | Open in IMG/M |
| 3300021420|Ga0210394_10272204 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300021479|Ga0210410_10151888 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
| 3300021858|Ga0213852_1226688 | Not Available | 739 | Open in IMG/M |
| 3300024049|Ga0233359_1029390 | Not Available | 630 | Open in IMG/M |
| 3300025320|Ga0209171_10567811 | Not Available | 551 | Open in IMG/M |
| 3300025432|Ga0208821_1003842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4908 | Open in IMG/M |
| 3300025500|Ga0208686_1000035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 97399 | Open in IMG/M |
| 3300025906|Ga0207699_10256438 | Not Available | 1207 | Open in IMG/M |
| 3300025910|Ga0207684_10502268 | Not Available | 1039 | Open in IMG/M |
| 3300025922|Ga0207646_10775180 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300025923|Ga0207681_10896249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300025982|Ga0208139_1001729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2249 | Open in IMG/M |
| 3300026309|Ga0209055_1092898 | Not Available | 1224 | Open in IMG/M |
| 3300026324|Ga0209470_1067278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1675 | Open in IMG/M |
| 3300026537|Ga0209157_1052076 | All Organisms → cellular organisms → Bacteria | 2165 | Open in IMG/M |
| 3300027073|Ga0208366_1033174 | Not Available | 578 | Open in IMG/M |
| 3300027528|Ga0208985_1050795 | Not Available | 805 | Open in IMG/M |
| 3300027559|Ga0209222_1023065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1216 | Open in IMG/M |
| 3300027616|Ga0209106_1108892 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300027671|Ga0209588_1260133 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300027676|Ga0209333_1164964 | Not Available | 593 | Open in IMG/M |
| 3300027783|Ga0209448_10030414 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300027812|Ga0209656_10282785 | Not Available | 773 | Open in IMG/M |
| 3300027824|Ga0209040_10194310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1058 | Open in IMG/M |
| 3300027842|Ga0209580_10162956 | Not Available | 1100 | Open in IMG/M |
| 3300027882|Ga0209590_10056448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2211 | Open in IMG/M |
| 3300027889|Ga0209380_10489264 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300028047|Ga0209526_10026043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4103 | Open in IMG/M |
| 3300028560|Ga0302144_10185712 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300028740|Ga0302294_10083049 | Not Available | 768 | Open in IMG/M |
| 3300028748|Ga0302156_10140001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1186 | Open in IMG/M |
| 3300028748|Ga0302156_10200197 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300028759|Ga0302224_10203109 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300028866|Ga0302278_10250923 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300028874|Ga0302155_10068756 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300029943|Ga0311340_10752652 | Not Available | 828 | Open in IMG/M |
| 3300029944|Ga0311352_10017943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6986 | Open in IMG/M |
| 3300029954|Ga0311331_10992269 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300030020|Ga0311344_11018328 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300030054|Ga0302182_10229320 | Not Available | 790 | Open in IMG/M |
| 3300030058|Ga0302179_10278191 | Not Available | 737 | Open in IMG/M |
| 3300030506|Ga0302194_10351199 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300030518|Ga0302275_10644437 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 505 | Open in IMG/M |
| 3300030519|Ga0302193_10210669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1079 | Open in IMG/M |
| 3300030677|Ga0302317_10094760 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300030688|Ga0311345_10115257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3001 | Open in IMG/M |
| 3300030706|Ga0310039_10058566 | Not Available | 1687 | Open in IMG/M |
| 3300030879|Ga0265765_1000051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5894 | Open in IMG/M |
| 3300031234|Ga0302325_10280777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2729 | Open in IMG/M |
| 3300031344|Ga0265316_11237155 | Not Available | 516 | Open in IMG/M |
| 3300031525|Ga0302326_12294203 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300031716|Ga0310813_11862390 | Not Available | 566 | Open in IMG/M |
| 3300031718|Ga0307474_10632234 | Not Available | 844 | Open in IMG/M |
| 3300031720|Ga0307469_10772192 | Not Available | 879 | Open in IMG/M |
| 3300032515|Ga0348332_12690131 | Not Available | 783 | Open in IMG/M |
| 3300032782|Ga0335082_10985260 | Not Available | 707 | Open in IMG/M |
| 3300032783|Ga0335079_10360809 | Not Available | 1574 | Open in IMG/M |
| 3300032805|Ga0335078_12070018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300033158|Ga0335077_11345857 | Not Available | 691 | Open in IMG/M |
| 3300033433|Ga0326726_12375274 | Not Available | 515 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 7.97% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.07% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.62% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.62% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.90% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.90% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.17% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.45% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.45% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.45% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.72% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.72% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.72% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.72% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005905 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024049 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025982 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028740 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25617J43924_101441222 | 3300002914 | Grasslands Soil | VLSERLEFRPERDSDIFSVVAAAPAVFLLRGADTNSEPYV |
| Ga0062387_1005294551 | 3300004091 | Bog Forest Soil | VLTERVEFIPERDTEVFAAVPAAPAVFLLRGEDAQAEPYV |
| Ga0062387_1006004122 | 3300004091 | Bog Forest Soil | VLSLEFLPERDAEFFAAIPAAPAVFLLRAGDPQAEPYVSRP* |
| Ga0070708_1014418182 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VLTERIEFRPEADAEVFSALAAAPAVFLLRGEDANSEPYISKTANL |
| Ga0068867_1001819362 | 3300005459 | Miscanthus Rhizosphere | VLAERLEFVPQREAEIFAATPAAPAVFSLRGADERADPYISKTANLRRR |
| Ga0070699_1011791181 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VLTNRAEFVAAADAEIFLTIPATPAVFLLRGDDPQSEPYVSKTA |
| Ga0070731_111186501 | 3300005538 | Surface Soil | MERIEFLPERDAKVFAAAPAAPAVFLLRGADPASEPYV |
| Ga0066700_110162973 | 3300005559 | Soil | VLTERIEFQPDRDCDIFSAVAAAPAVFLLRGEDANSEPYVS |
| Ga0068855_1001194455 | 3300005563 | Corn Rhizosphere | VLRISLPFESERDEAIFASVPAAPAVFLLRSDDPQAEP |
| Ga0066702_107903351 | 3300005575 | Soil | LLTERLEFVPERDAETFASVPAAPAVFLLRGSDAQA |
| Ga0070761_101121111 | 3300005591 | Soil | VLTERLEFAAERDAGVFAAVPAAPAVFLLRGEDAQAEPYV |
| Ga0070761_110508621 | 3300005591 | Soil | VLSRRLEFVPASEADAFALVPSAPAVFLLRGDDPQSEPY |
| Ga0066706_113281522 | 3300005598 | Soil | VLTQHLEFVPVRDAEIFGSVPAAPAVFLIRGNDPQSEPYVSKTANLR |
| Ga0068859_1013522741 | 3300005617 | Switchgrass Rhizosphere | LVVLRHRLEFRPKADSEQFGSVPAAPAVFLLRGEDEKAEPYVSKT |
| Ga0075269_100018861 | 3300005905 | Rice Paddy Soil | MLAQRLEFVPERDAEIFAAVPGAAAVFLLGGPEAGSE |
| Ga0066696_102784161 | 3300006032 | Soil | VLSERIEFTPERDAEIFAAVPAGPAVFVLRGDESHAEPYV |
| Ga0075023_1005654132 | 3300006041 | Watersheds | MVLTERVEFAPDHDAEVFASAPAAPAVFLLRASDPQAEPYVSRTA |
| Ga0075028_1006477591 | 3300006050 | Watersheds | VLTNRLEFVPVRDAELWATVPAAPAVFLLRGDDPKSEPYVSKTAN |
| Ga0075015_1000512634 | 3300006102 | Watersheds | VLTERIEFHPEADAEVFAAVAAAPAVFLLRGEHANSEPYVSKTAN |
| Ga0075015_1008912452 | 3300006102 | Watersheds | VLTERLEFVPERDLEVFAAVPTAAGVFLLRGENAGAE |
| Ga0075030_1002139101 | 3300006162 | Watersheds | VLTERIEFHPEADAEVFAAVAAAPAVFLLRGEHANSEP |
| Ga0075014_1009838971 | 3300006174 | Watersheds | VLTERIEFRPEADAEVFSAAAAAPAVFLLRGEDANSEPYVSKTAN |
| Ga0070712_1006910361 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTQRLEFAPQRDTEIFAAVPAAPAVFLLRGESAESEPYVSKTA |
| Ga0070765_1000371661 | 3300006176 | Soil | MEFHPEADSKVFSSVADAPAVFLLRAEDADSEPYVSKTANLRRRLQRL |
| Ga0079222_112263582 | 3300006755 | Agricultural Soil | VLTERLEFTPERDAELFAAVPAGPAVFLLQGKDQGAEPYVSKTA |
| Ga0073928_101316464 | 3300006893 | Iron-Sulfur Acid Spring | VLTERLEFAPERDFEIFATVPVAPAVFLLRGADLQSEPYVSKT |
| Ga0073928_106500642 | 3300006893 | Iron-Sulfur Acid Spring | VLTERLEFAHERDAEIFSAIPAAPAVFLLRGEDAEAEP |
| Ga0075426_102700593 | 3300006903 | Populus Rhizosphere | MLAERLEFAPERDAGIFASVPARPAVFLLRGPEAGA |
| Ga0099830_105957022 | 3300009088 | Vadose Zone Soil | VLTERLEFVPDRDAEAFAAVPDAPAVFVLRSADPQAEP |
| Ga0105250_103815762 | 3300009092 | Switchgrass Rhizosphere | VLTERLDFIPDRDAEVFAAAPSAPAVFMLRRDDPQA |
| Ga0075423_127269241 | 3300009162 | Populus Rhizosphere | VLTERLEFAPDRDTEAFAAVPAGPAVFLLRGNDPQ |
| Ga0116214_13807201 | 3300009520 | Peatlands Soil | VLTERIEFRPERDAQVFSTAAAAPAVFLLRGEDVNSEPYVSKT |
| Ga0116218_14802741 | 3300009522 | Peatlands Soil | VLTERLEFVPERDAEIFATVPAAPAVFLLRGEDARAEPYVSKT |
| Ga0105238_107609281 | 3300009551 | Corn Rhizosphere | VLTEQIEFTPERDLEIFAAVPAGPAIFALRGDESHAEPYVSKTANL |
| Ga0116105_11255081 | 3300009624 | Peatland | VLTESLEFAPERDAEIFSAVPAAPAVFSLRGEDAQAEPYVSKTA |
| Ga0116124_10438112 | 3300009634 | Peatland | VLTERIEFQPERDIDIFSTVAAAPAVFLLRGEDANSEPYVSKTANLR |
| Ga0116121_10274101 | 3300009644 | Peatland | VLTERLEFAPERDALVFATVPAAPAVFLLRGEDPQAEPYVSKTA |
| Ga0116121_11697691 | 3300009644 | Peatland | VLTESLEFAPERDAEIFSAVPAAPAVFSLRGEDAQAEPYVSKT |
| Ga0116106_10592232 | 3300009645 | Peatland | LVLTERLEFAPERDGQVFSAVPAAPAVFLLRGEDPR |
| Ga0116135_11848072 | 3300009665 | Peatland | VLTERLEFAPERDSEIFASVPAAPAVFLLRASDPQSEPYVSKTANL |
| Ga0116223_103096951 | 3300009839 | Peatlands Soil | VLTERLEFRPEADAEVFSTVAAAPAVFLLRGADAN |
| Ga0074046_103627021 | 3300010339 | Bog Forest Soil | VLTRCIEFIPARDVEPWATVPPAPAVFLLRGDDPQSEPYVSKTANL |
| Ga0074045_106728582 | 3300010341 | Bog Forest Soil | MVLTERIEFHPERDREIFSAVAPAPAVFLLRGEDANSEPYASKTA |
| Ga0137391_110806772 | 3300011270 | Vadose Zone Soil | VLTERIEFRPEADTEIFSTAAAAPAVFLLRGEDANSEPYV |
| Ga0137365_101769651 | 3300012201 | Vadose Zone Soil | VATVLTNQLEFLPSKDTEVFAEACAAPAVFSLRGDDPHSEPYISKTANLRRRLQ |
| Ga0150985_1042734112 | 3300012212 | Avena Fatua Rhizosphere | VLTERLDFIPDRDAEVFAAAPSAPAVFMLRGGDPQAE |
| Ga0137386_102917653 | 3300012351 | Vadose Zone Soil | VLTERIEFHPEADAEVFSAAAAAPAVFLLRGEDANSEPY |
| Ga0137361_107737291 | 3300012362 | Vadose Zone Soil | VLTERLEFVPERDSEIFAAVPAASAVFLLRGEDAQSEPYVSK |
| Ga0137359_103018193 | 3300012923 | Vadose Zone Soil | VLTERIEFRPEADAEVFSAVAAAPAVFLLRGEDANS |
| Ga0137419_114181462 | 3300012925 | Vadose Zone Soil | VLTERLEFVPERDAEIFSAVPSAPAVFLLRGEDAQGEPYVSK |
| Ga0164305_100940581 | 3300012989 | Soil | MLSTRLDFTPEFDFAALPAAPAVFLLRGDEASEPYVSKTA |
| Ga0181518_1001004412 | 3300014156 | Bog | VLSLEFTPERDAEFFAAIPAAPTVFLLRADDPQAEPYV |
| Ga0181523_102271402 | 3300014165 | Bog | VLSERIEFRPEADAEVFSAVAAAPAVFLLRGQDANSEPYVSK |
| Ga0181531_101893133 | 3300014169 | Bog | VLTERVEFVTERDAEILAAIPAASAVFLLRGEDAQAEPYVS |
| Ga0163163_102396103 | 3300014325 | Switchgrass Rhizosphere | VLTERLEFAPDRDVEAFAAAPAGPAVFLLRGNDAQAEPYVSKTA |
| Ga0182010_100754171 | 3300014490 | Fen | VLSERIEFRPEIDAEVFSAVAAAPAVFLLRGEDANSEP |
| Ga0182024_124292361 | 3300014501 | Permafrost | VLSSGLEFVPTQDAEIFAAVPAAAAVFLLRGDDIHAEPYV |
| Ga0181525_108479682 | 3300014654 | Bog | VLTERLEFAPERDAGVFAAVPAAPAVFLLRGEDARAE |
| Ga0181522_100858904 | 3300014657 | Bog | VLTERIEFRAEADAEVFAAVAAAPAVFALRGADANA |
| Ga0134073_103814401 | 3300015356 | Grasslands Soil | VLSERIEFTPERDAEIFAAVPAGPAVFVLRGDESHAEPYVSKTANL |
| Ga0182039_118389731 | 3300016422 | Soil | VLTDRIEFTPDRDAEVFASVPAGPAVFLLRGEDAQAEPYVSK |
| Ga0181505_100448862 | 3300016750 | Peatland | VLTERIEFRPEADAEVFSAAAAAPAVFLLRGEDLNS |
| Ga0187802_101770272 | 3300017822 | Freshwater Sediment | MEHRLLSHCIEFVPASDADALSMAPATPAVFHLRGQDPQSEPYVSKTAN |
| Ga0187818_102473402 | 3300017823 | Freshwater Sediment | VLSLEFLPERDAEFFAAIPAAPAVFLLRADDPQAEPYVSRP |
| Ga0187820_10680432 | 3300017924 | Freshwater Sediment | VLNERLEFAPERDTDVFSAVPAAPAVFLRRGEDPQSEPYVSK |
| Ga0187817_107394141 | 3300017955 | Freshwater Sediment | MEHRLLSHCIEFVPASDADALSMAPAAPAVFLLRGQDPQSEPYVSKTANLR |
| Ga0187891_10459003 | 3300017996 | Peatland | VLTERIEFQPERDSDIFSAAAAAPAVFLLRGEDANS |
| Ga0187888_10646463 | 3300018008 | Peatland | VLTERIEFRPEAVAEVFSAVAAAPAVFLLRGEDAHSEPY |
| Ga0187869_103698631 | 3300018030 | Peatland | VLTESLEFAPERDAEIFSAVPAAPAVFSLRGEDAQAEPYV |
| Ga0187863_104995231 | 3300018034 | Peatland | VLTERIEFVPEKDSQILSAFPAVPAVFLLLGENAQAEPYVSKTANLRRRL |
| Ga0187855_105071301 | 3300018038 | Peatland | VLADRIEFRPEAEAEVFSAAPAAPAVFLLRGEDANSQP |
| Ga0187887_106337422 | 3300018043 | Peatland | VLTERIEFCPEADAEVFSAAAPAPAVFLLRGEDANSEPYVS |
| Ga0187887_109119462 | 3300018043 | Peatland | VLSERIEFHPEADAEIFSAMAAAPAVFLLRGEDANSEPYVS |
| Ga0187890_104969191 | 3300018044 | Peatland | VLATRIEFAPDHDREIFSAIPARASVFLLRASDPVSEPYVSKTANLRRRLER |
| Ga0187774_110999931 | 3300018089 | Tropical Peatland | VLSLEFTPERDVEVFAAIPAVPAVFLLRADDPQAEPYVSKTTN |
| Ga0193731_10849262 | 3300020001 | Soil | VLSERLEFVSAQDSELFSAVPLAPAVFSLRGDDPQSEPYVSKTA |
| Ga0210403_112971252 | 3300020580 | Soil | VLTHLDFVPTRDAEMFASVPAAPAVFLLRSDDPHSE |
| Ga0210404_107518831 | 3300021088 | Soil | VLTERIEFTPVRDADIFSSVPTGPAVFLLRGEDATAEPYVSK |
| Ga0210394_102722043 | 3300021420 | Soil | VLTERIEFAPERDAEVFTSVPGSPAVFLLRGDDPQAEPYVSK |
| Ga0210410_101518881 | 3300021479 | Soil | VLSHHLEFVPARDGEILAAIPAAPAVFLLRADDPQSEPYVSKTAN |
| Ga0213852_12266882 | 3300021858 | Watersheds | VLTEQLEFTPERGAEVLGAIPAAPAVFLLRGQDAQAEPYVS |
| Ga0233359_10293902 | 3300024049 | Soil | VLTERLEFAAERDAAIFAGVPAAPAVFLLRGNEISAEPYVSKTAN |
| Ga0209171_105678112 | 3300025320 | Iron-Sulfur Acid Spring | VLTERLEFVAERDSETFAAVPASPAVFLLRGSEQHSEPY |
| Ga0208821_10038421 | 3300025432 | Peatland | VLTERLEFAPERDAEIFSAVPAAPAVFLLRADDSQAEPYVSKT |
| Ga0208686_100003590 | 3300025500 | Peatland | VLTERLEFAPERDAEIFSAVPAAPAVFLLRADDSQAE |
| Ga0207699_102564382 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSERIEFTPERDAEIFAAVPAGPAVFVLRGDESHAEPYVS |
| Ga0207684_105022681 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VLAQRLEFAPERDAEVFAAVPAAPAVFLLRGEDAQA |
| Ga0207646_107751801 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VLTERIEFRPEADAEVFSALAAAPAVFLLRGEDANSEP |
| Ga0207681_108962492 | 3300025923 | Switchgrass Rhizosphere | VLQISLPFEPERDEAIFASVPAAPAVFLLRSDDPQAEPY |
| Ga0208139_10017293 | 3300025982 | Rice Paddy Soil | MLAQRLEFVPERDAEIFAAVPGAAAVFLLGGPEAGSEPYV |
| Ga0209055_10928982 | 3300026309 | Soil | VLTERIEFTPDRDADIFSSVPAGPAVFLLRGEDATAEPYVS |
| Ga0209470_10672783 | 3300026324 | Soil | VLSERLEFVPARDAEIFAAIPTTPAVFLLRADDPQSEPYVSK |
| Ga0209157_10520764 | 3300026537 | Soil | VVLSERLEFVPAQDAEIFAATPATPAVFLLRADDPQS |
| Ga0208366_10331741 | 3300027073 | Forest Soil | VLTERIEFTPDRDADIFSSVPASPAVFHLRGEDATAEPYV |
| Ga0208985_10507951 | 3300027528 | Forest Soil | VLTERLEFSPEQDTEVLAAIPAAPAVFLLRGEDAQADPYV |
| Ga0209222_10230651 | 3300027559 | Forest Soil | VLTECIEFHPEADVEIFSSIAAAPAVFLLRGEDAHSEPYVSK |
| Ga0209106_11088921 | 3300027616 | Forest Soil | VLTERIEFRPEADAEVFSTVAAAPAVFLLRGEDTSS |
| Ga0209588_12601331 | 3300027671 | Vadose Zone Soil | VLTERIEFRPEADAEVFSAVATASAVFLLRGEDANS |
| Ga0209333_11649642 | 3300027676 | Forest Soil | VLTERIEFRPEADAEVFSAVAAAPAVFLLRGADANSEPYVSK |
| Ga0209448_100304141 | 3300027783 | Bog Forest Soil | VLSLEFLPERDAEFFAAIPAAPAVFLLRAGDPQAEPYVSRP |
| Ga0209656_102827852 | 3300027812 | Bog Forest Soil | VLTERLEFSPERDAETLAAVPAAPAVFLLRGEDAYAEPY |
| Ga0209040_101943103 | 3300027824 | Bog Forest Soil | VLSERIEFHPEADAEVFAAVAAAPAVFLLRGEDPNTEPYVSK |
| Ga0209580_101629562 | 3300027842 | Surface Soil | MLAQRLEFVPERDAEIFASVPAAAAVFLLQGPEAGSEPYVSKTAN |
| Ga0209590_100564481 | 3300027882 | Vadose Zone Soil | VLTERLEFASERVAEVFAIAPAAPAVFLLRGEDAQAEPYVSKTAN |
| Ga0209380_104892642 | 3300027889 | Soil | MEFHPEADSKVFSSVADAPAVFLLRAEDADSEPYV |
| Ga0209526_100260431 | 3300028047 | Forest Soil | VLTERLEFVAERDSETLAAVPASPAVFLLRGGEQHSEPYI |
| Ga0302144_101857121 | 3300028560 | Bog | VLTERVEFAAERDAEIFAAIPATPAVFLLCGEDAQ |
| Ga0302294_100830491 | 3300028740 | Fen | MTHYNRLVLSERIEFRPEADNEIFASVPPAPAIFLLRGADP |
| Ga0302156_101400013 | 3300028748 | Bog | VLTERLEFAPERDASVFATVPAEPAVFLLRGADPQGEPYVSKT |
| Ga0302156_102001973 | 3300028748 | Bog | VLTERVEFAAERDAEIFAAIPATPAVFLLCGEDAQAEPYVSKTANLR |
| Ga0302224_102031091 | 3300028759 | Palsa | VLTDRLEFAPERDAEVFGAVPAAPAVFLLRGDDPHAEPYVSKTA |
| Ga0302278_102509233 | 3300028866 | Bog | VLTERLEFAPECDAEVFAAVAAAPAVFMLRGQDVQAE |
| Ga0302155_100687563 | 3300028874 | Bog | VLTERLEFAPECDAEVFAAVAAAPAVFMLRGQDAQAEPYVSKTANLR |
| Ga0311340_107526522 | 3300029943 | Palsa | VLTERLEFAPERDSEIFAAVSAAPAVFLLRGADPQSEPYVSKT |
| Ga0311352_100179438 | 3300029944 | Palsa | VLSERLEFRPEADNEIFFAVPAAPAVFVLRGEVANSEPYVGKTANLR |
| Ga0311331_109922691 | 3300029954 | Bog | VLTERIEFHPEADAEIFSTLGTAPAVFLLRGADANSEPYVSKTAN |
| Ga0311344_110183281 | 3300030020 | Bog | VLTERIEFHPEADAEIFSTLGTAPAVFLLRGADANSEPYVSK |
| Ga0302182_102293201 | 3300030054 | Palsa | VLTEHLEFAPEQDAEIFSAVPAAPAVFLLRGEDTHAE |
| Ga0302179_102781912 | 3300030058 | Palsa | VLTERIEFRPEVDAEVFAAVAAAPAVFLLRAADAN |
| Ga0302194_103511991 | 3300030506 | Bog | VLTERIEFHPEADAEIFSTLGTAPAVFLLRGADANSE |
| Ga0302275_106444372 | 3300030518 | Bog | VLTERLEFAPECDAEVFAAVAAAPAVFMLRGQDAQAEPYVSKTAN |
| Ga0302193_102106691 | 3300030519 | Bog | VLTERIEFRPEADGEIFSAVAAAPAVFLLRGTDAGAEPYVSKT |
| Ga0302317_100947601 | 3300030677 | Palsa | VLTERLEFVPERDAEVFAAVPSAPAVFLLRGHDSQA |
| Ga0311345_101152575 | 3300030688 | Bog | VLTERVEFAAERDAEIFAAIPATPAVFLLCGEDAQAEPYVSKTAN |
| Ga0310039_100585663 | 3300030706 | Peatlands Soil | VLSLEFLPERDAEFFAAIPAAPAVFLLRAGDPQAEPYVSKT |
| Ga0265765_10000518 | 3300030879 | Soil | VLTERLEFAPERDAEIFSAVPAAPAVFSLRGEDTQ |
| Ga0302325_102807771 | 3300031234 | Palsa | VLTERVEFVPENDSQILSAFPAAPGVFLLRGENTEAEPYVS |
| Ga0265316_112371551 | 3300031344 | Rhizosphere | VLSERIEFRPEADAEVFSSVAAAPAVFLLRGEDEHSEPYVSKT |
| Ga0302326_122942033 | 3300031525 | Palsa | VLTERVEFAAERDAEIFAAIPATPAVFLLCGEDAQAEP |
| Ga0310813_118623901 | 3300031716 | Soil | MLAERLEFAPERDAEVFASVPARPAVFLLRGPEAGA |
| Ga0307474_106322341 | 3300031718 | Hardwood Forest Soil | VLTERIEFRPERDNDIFSAVAAAPAVFLLRGDDANSEPYVSKT |
| Ga0307469_107721922 | 3300031720 | Hardwood Forest Soil | VLTERLEFAAERDTEIFAAVPAAPAVFLLRGDDAHAEPYVSKTANL |
| Ga0348332_126901312 | 3300032515 | Plant Litter | VLTERLEFAPERDAEIFSAVPAEPAVFSLRGEDTQAEPYVSKTAN |
| Ga0335082_109852603 | 3300032782 | Soil | VLNERIEFHPERDGEVFSAVPTAPAVFLLRGGDPASEPYVS |
| Ga0335079_103608093 | 3300032783 | Soil | VLSLEFLPERDVEFFDAIPAAPAVFLLRADDPQAEP |
| Ga0335078_120700181 | 3300032805 | Soil | VLANRLEFEPDRDRETFALIPAAPAVFLLHGPDPAAQ |
| Ga0335077_113458571 | 3300033158 | Soil | MVLARQLEFVPANDDDIFVSVPPAPAVFLLRPDDPASEPYVSKTA |
| Ga0326726_123752741 | 3300033433 | Peat Soil | VLAERIEFIPERDAELFATVPSGPAVFLLRGEHAL |
| ⦗Top⦘ |