| Basic Information | |
|---|---|
| Family ID | F055931 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 48 residues |
| Representative Sequence | QRKLGVVILVNRGKQHATGIGRQILHALAQDQSEPSNEGEPEPDGD |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.45 % |
| % of genes near scaffold ends (potentially truncated) | 96.38 % |
| % of genes from short scaffolds (< 2000 bps) | 91.30 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.884 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.62% β-sheet: 0.00% Coil/Unstructured: 78.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF13602 | ADH_zinc_N_2 | 24.64 |
| PF12697 | Abhydrolase_6 | 13.77 |
| PF00583 | Acetyltransf_1 | 7.97 |
| PF00561 | Abhydrolase_1 | 2.17 |
| PF01230 | HIT | 2.17 |
| PF14329 | DUF4386 | 1.45 |
| PF07585 | BBP7 | 1.45 |
| PF08818 | DUF1801 | 1.45 |
| PF00067 | p450 | 0.72 |
| PF00144 | Beta-lactamase | 0.72 |
| PF03641 | Lysine_decarbox | 0.72 |
| PF13875 | DUF4202 | 0.72 |
| PF11954 | DUF3471 | 0.72 |
| PF01544 | CorA | 0.72 |
| PF01321 | Creatinase_N | 0.72 |
| PF01521 | Fe-S_biosyn | 0.72 |
| PF08291 | Peptidase_M15_3 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 1.45 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 1.45 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 1.45 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.72 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.72 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.72 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.72 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.72 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.72 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02GA484 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 517 | Open in IMG/M |
| 2170459021|G14TP7Y01EXQ30 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 2209111022|2221198655 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 526 | Open in IMG/M |
| 2228664021|ICCgaii200_c0905341 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 691 | Open in IMG/M |
| 3300000550|F24TB_10078554 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
| 3300000787|JGI11643J11755_11598173 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300000955|JGI1027J12803_105053584 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300000955|JGI1027J12803_106996773 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 983 | Open in IMG/M |
| 3300002128|JGI24036J26619_10073481 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300003911|JGI25405J52794_10069142 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300004156|Ga0062589_101469661 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300004479|Ga0062595_100933734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300005166|Ga0066674_10452535 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005180|Ga0066685_10307271 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300005184|Ga0066671_10687234 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005187|Ga0066675_11034911 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005294|Ga0065705_10158423 | All Organisms → cellular organisms → Bacteria | 1825 | Open in IMG/M |
| 3300005332|Ga0066388_106493100 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 590 | Open in IMG/M |
| 3300005347|Ga0070668_101090935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300005367|Ga0070667_100050132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3518 | Open in IMG/M |
| 3300005435|Ga0070714_100293601 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300005436|Ga0070713_100269934 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300005440|Ga0070705_100019166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3598 | Open in IMG/M |
| 3300005544|Ga0070686_100611225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 860 | Open in IMG/M |
| 3300005556|Ga0066707_10689501 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005558|Ga0066698_11070537 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
| 3300005587|Ga0066654_10200590 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300005587|Ga0066654_10497386 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005764|Ga0066903_107642754 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 557 | Open in IMG/M |
| 3300006031|Ga0066651_10242038 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300006031|Ga0066651_10503860 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300006038|Ga0075365_10801377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
| 3300006175|Ga0070712_100434414 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300006575|Ga0074053_10064210 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300006796|Ga0066665_11402408 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 541 | Open in IMG/M |
| 3300006844|Ga0075428_101339069 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300006854|Ga0075425_101505173 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300006854|Ga0075425_102725511 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300009012|Ga0066710_101909409 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 888 | Open in IMG/M |
| 3300009012|Ga0066710_103819153 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 565 | Open in IMG/M |
| 3300009098|Ga0105245_11703791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methyloglobulus → unclassified Methyloglobulus → Methyloglobulus sp. | 683 | Open in IMG/M |
| 3300009100|Ga0075418_11484859 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 736 | Open in IMG/M |
| 3300009137|Ga0066709_100251205 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2368 | Open in IMG/M |
| 3300009137|Ga0066709_100368420 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
| 3300009137|Ga0066709_101424714 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1006 | Open in IMG/M |
| 3300009137|Ga0066709_103515059 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 569 | Open in IMG/M |
| 3300009156|Ga0111538_12426472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300009177|Ga0105248_13316772 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 512 | Open in IMG/M |
| 3300010301|Ga0134070_10303505 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300010303|Ga0134082_10225339 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300010321|Ga0134067_10071372 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300010325|Ga0134064_10148371 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300010329|Ga0134111_10026643 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
| 3300010333|Ga0134080_10202907 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 860 | Open in IMG/M |
| 3300010333|Ga0134080_10220669 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300010333|Ga0134080_10571551 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 546 | Open in IMG/M |
| 3300010366|Ga0126379_10109233 | All Organisms → cellular organisms → Bacteria | 2482 | Open in IMG/M |
| 3300010371|Ga0134125_12068768 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 619 | Open in IMG/M |
| 3300010376|Ga0126381_101525807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 966 | Open in IMG/M |
| 3300010399|Ga0134127_10130953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2249 | Open in IMG/M |
| 3300012198|Ga0137364_10105100 | All Organisms → cellular organisms → Bacteria | 1994 | Open in IMG/M |
| 3300012198|Ga0137364_10196305 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1477 | Open in IMG/M |
| 3300012198|Ga0137364_10407863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1017 | Open in IMG/M |
| 3300012198|Ga0137364_10436677 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 981 | Open in IMG/M |
| 3300012201|Ga0137365_10457147 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300012201|Ga0137365_11047878 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 590 | Open in IMG/M |
| 3300012203|Ga0137399_10213140 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300012205|Ga0137362_10600758 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300012205|Ga0137362_11357477 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 596 | Open in IMG/M |
| 3300012207|Ga0137381_10366993 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300012208|Ga0137376_10245682 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1552 | Open in IMG/M |
| 3300012208|Ga0137376_10607772 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300012285|Ga0137370_10345060 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300012350|Ga0137372_10690457 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 740 | Open in IMG/M |
| 3300012354|Ga0137366_10504209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300012354|Ga0137366_11114962 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012357|Ga0137384_11075211 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300012360|Ga0137375_11075219 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300012683|Ga0137398_10480300 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300012897|Ga0157285_10306221 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 542 | Open in IMG/M |
| 3300012924|Ga0137413_10412834 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300012924|Ga0137413_10948556 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300012925|Ga0137419_10092757 | All Organisms → cellular organisms → Bacteria | 2071 | Open in IMG/M |
| 3300012972|Ga0134077_10001254 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 7002 | Open in IMG/M |
| 3300012975|Ga0134110_10420761 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 596 | Open in IMG/M |
| 3300012976|Ga0134076_10571770 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300014154|Ga0134075_10004981 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 4940 | Open in IMG/M |
| 3300015356|Ga0134073_10071258 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300015356|Ga0134073_10367574 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300015374|Ga0132255_101700618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
| 3300015374|Ga0132255_105432793 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 539 | Open in IMG/M |
| 3300016319|Ga0182033_11538322 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 601 | Open in IMG/M |
| 3300016422|Ga0182039_10994119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 752 | Open in IMG/M |
| 3300018028|Ga0184608_10522334 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 507 | Open in IMG/M |
| 3300018075|Ga0184632_10111062 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300018433|Ga0066667_10571362 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300018433|Ga0066667_12193527 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300019865|Ga0193748_1029001 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 518 | Open in IMG/M |
| 3300019878|Ga0193715_1079305 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 682 | Open in IMG/M |
| 3300019887|Ga0193729_1190081 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300019999|Ga0193718_1071363 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 742 | Open in IMG/M |
| 3300020002|Ga0193730_1001675 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 6012 | Open in IMG/M |
| 3300020018|Ga0193721_1098081 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300021073|Ga0210378_10148589 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300021080|Ga0210382_10059992 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1517 | Open in IMG/M |
| 3300021411|Ga0193709_1097342 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 636 | Open in IMG/M |
| 3300021418|Ga0193695_1035106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1079 | Open in IMG/M |
| 3300022694|Ga0222623_10191230 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300022756|Ga0222622_10987227 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 618 | Open in IMG/M |
| 3300025885|Ga0207653_10156410 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 841 | Open in IMG/M |
| 3300025918|Ga0207662_11364261 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300025921|Ga0207652_11899373 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 501 | Open in IMG/M |
| 3300026308|Ga0209265_1150023 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 599 | Open in IMG/M |
| 3300026312|Ga0209153_1048156 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300026323|Ga0209472_1002766 | All Organisms → cellular organisms → Bacteria | 9774 | Open in IMG/M |
| 3300026328|Ga0209802_1181232 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300026333|Ga0209158_1334856 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300026475|Ga0257147_1050503 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 621 | Open in IMG/M |
| 3300026523|Ga0209808_1064731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 1616 | Open in IMG/M |
| 3300026664|Ga0207558_101334 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300026920|Ga0208575_1014821 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300027717|Ga0209998_10132403 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 633 | Open in IMG/M |
| 3300027876|Ga0209974_10034521 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300027903|Ga0209488_10243640 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300028799|Ga0307284_10309284 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 636 | Open in IMG/M |
| 3300028819|Ga0307296_10030745 | All Organisms → cellular organisms → Bacteria | 2832 | Open in IMG/M |
| 3300028881|Ga0307277_10207064 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 861 | Open in IMG/M |
| 3300028884|Ga0307308_10380931 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300031226|Ga0307497_10206019 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300031474|Ga0170818_108628668 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 723 | Open in IMG/M |
| 3300031716|Ga0310813_10900467 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300031846|Ga0318512_10335327 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 755 | Open in IMG/M |
| 3300031908|Ga0310900_11130717 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 649 | Open in IMG/M |
| 3300031910|Ga0306923_12571076 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 500 | Open in IMG/M |
| 3300031943|Ga0310885_10447427 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300031954|Ga0306926_10459175 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1569 | Open in IMG/M |
| 3300032261|Ga0306920_101831959 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 855 | Open in IMG/M |
| 3300033412|Ga0310810_10191758 | All Organisms → cellular organisms → Bacteria | 2321 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.14% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.17% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.45% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.45% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.45% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.72% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.72% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.72% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019865 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026664 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE15-C (SPAdes) | Environmental | Open in IMG/M |
| 3300026920 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes) | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_03895080 | 2170459005 | Grass Soil | VILVNRGKQHATGIGRQILHALAQEKSEPSNEGEPDPDAD |
| 4NP_03035260 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | GGLPNTSTWIGFTPEQHIGVVLLCNRGKQPATKIGRQILHALAQDQSQPSTQGEPDPNAN |
| 2222022332 | 2209111022 | Grass Soil | ILVNRGKQQATGIGRQILHALAQEKSEPSNEGEPDPDAD |
| ICCgaii200_09053412 | 2228664021 | Soil | VILVNRGKQHATGIGRQILHALAQEKSEPSTEGEPEQDTD |
| F24TB_100785544 | 3300000550 | Soil | KLGVVILVNRGKQHATGIGRQMLHALAQDQSQPSTEGELEPDGD* |
| JGI11643J11755_115981732 | 3300000787 | Soil | LVNRGKQHATGIGRQILHALAQDQSTPSSEGEPNPDTD* |
| JGI1027J12803_1050535843 | 3300000955 | Soil | GVIILINRGKQHATGIGRQILHALAQDQSEPSPEGESEPDNN* |
| JGI1027J12803_1069967733 | 3300000955 | Soil | GFAPQQKIGAVILCKRGKQHATQIGQQILHALANNQSEPSTEGESEPDRD* |
| JGI24036J26619_100734812 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | NTSTYIGFAPQRKIGVVILVNRGRQNATIYGRQIIHALAQDQSEPSSEGEANPDNE* |
| JGI25405J52794_100691422 | 3300003911 | Tabebuia Heterophylla Rhizosphere | STYIGFVPRKKLGVVILVNRGKQRATIYGRQIIHALAQDQAQPSSEGEPNPDNE* |
| Ga0062589_1014696611 | 3300004156 | Soil | MDNTQSTYIGFAPQRKLGVVILVNRGKQHATGIGRQIIHELAQDQSEPSTEGEPNPDSD* |
| Ga0062595_1009337342 | 3300004479 | Soil | NTSTWIGFAPQRHIGAVILCNRGKQPATRIGRQLLHALAQDQSQPSTEGKPDTDAN* |
| Ga0066674_104525351 | 3300005166 | Soil | GVVILVNRGKQHATGIGRRILHALAQDQSVPSTEGEPEPDGD* |
| Ga0066685_103072711 | 3300005180 | Soil | PQKKLGVIVLVNRGKQHATGIGRQIIHALAQDQSQPSNEGEANPDND* |
| Ga0066671_106872342 | 3300005184 | Soil | YIGFAPQKKLGVVILVNRGRQKATIYGRQIIHALAQDRSAPSNEGEANPDE* |
| Ga0066675_110349112 | 3300005187 | Soil | VVVLVNRGKQHAVEFGRQIIHALAQDQSQPSSEGEADPDSD* |
| Ga0065705_101584231 | 3300005294 | Switchgrass Rhizosphere | QRKLGVVILVNRGKQHATGIGRQILHALAQDQSEPSNEGEPEPDGD* |
| Ga0066388_1064931002 | 3300005332 | Tropical Forest Soil | GVVILCNRGKQPATRIGRQLLHALARDQSQPSTEGKPDPDAN* |
| Ga0070668_1010909351 | 3300005347 | Switchgrass Rhizosphere | VVILVNRGKQNATVYGRKLLHALAQDQSQPSNEGETEPDQE* |
| Ga0070667_1000501321 | 3300005367 | Switchgrass Rhizosphere | GLPNTSTWIGFTPQRHIGVVILCNRGKQPATRIGRQLLHALAQDQSQASTEGQPDPNAN* |
| Ga0070714_1002936011 | 3300005435 | Agricultural Soil | VILVNRGKQHATGIGRQILHALAQDQSQPLTEGEPEPDTD* |
| Ga0070713_1002699343 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VILVNRGKQHATGIGRQILHVLAQDQSQPSTEGEPEPDTD* |
| Ga0070705_1000191661 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | KNGGLPNTSTWIGFTPQRHIGVVILCNRGKQPATRIGRQLLHALAQDQSQASTEGQPDPNAN* |
| Ga0070686_1006112251 | 3300005544 | Switchgrass Rhizosphere | TSTWIGFTPQRHIGVVILCNRGKQPATRIGRQLLHALAQDQSQASTEGQPDPNAN* |
| Ga0066707_106895011 | 3300005556 | Soil | GFAPQKKLGVVILVNRGKQHATVIGRHIIHALAQDQSAPSSEGEPNPDNN* |
| Ga0066698_110705371 | 3300005558 | Soil | GKQHATGIGRQILHALAQDQSEPSTEGESDPDND* |
| Ga0066654_102005901 | 3300005587 | Soil | VNRGKQHATGIGRQIIHALAQDQSQPSNEGEANPDND* |
| Ga0066654_104973862 | 3300005587 | Soil | NNTSTYIGFAPQRKLGVVILVNRGKQHDTGIARQILHALAQGKSEPSAEGEPEQDTD* |
| Ga0066903_1076427542 | 3300005764 | Tropical Forest Soil | PNTSTWIGFAPEQKIGAVILCNRGKQPATKIGRQLLHALAQDRSEPSAEGEPEPDRE* |
| Ga0066651_102420382 | 3300006031 | Soil | QKKLGVVILVNRGRQNATIYGRQIIHALAQNQSQPSSEGEANPDDE* |
| Ga0066651_105038601 | 3300006031 | Soil | APQQKLGVVILVNRGKQRATGIGRQILHALAQDQSKPSTEGEADPDSD* |
| Ga0075365_108013771 | 3300006038 | Populus Endosphere | STYIGFARQQKLGVVILSNRGEQNATKVGRQILHALAQEKAEPLDEGAEPD* |
| Ga0070712_1004344141 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | QKKLGVVILVNRGKQHATGIGRQIIHALAQEQSEPSREGEPNPDNE* |
| Ga0074053_100642102 | 3300006575 | Soil | IGFAPQSKLGVVILVNRGKQHATGIGRQILHALAQEKSEPSNEGEPDPDAD* |
| Ga0066665_114024082 | 3300006796 | Soil | IILVNRGKQHATGIGRQILHALAQDQSEPSTEGESDPDND* |
| Ga0075428_1013390691 | 3300006844 | Populus Rhizosphere | APQPKLAIVILVNRGKQQPTTNGRQILHALAQEKSEPSNEGEPEPDAD* |
| Ga0075425_1015051731 | 3300006854 | Populus Rhizosphere | GFAPRRKLGVVILVNRGKQHATGIGRQILHALAQDQSQPSSEGESNPDAE* |
| Ga0075425_1027255113 | 3300006854 | Populus Rhizosphere | NTSTYIGFARQQKLGVVILSNRGEQDATKVGRQILHALAQEMAEPLVEGAEPD* |
| Ga0066710_1019094091 | 3300009012 | Grasslands Soil | VIILVNRGKQHATGIGRQILHALAQDQSEPSTEGESDPDND |
| Ga0066710_1038191532 | 3300009012 | Grasslands Soil | RQKLGVIILVNRGKQHATGIGRQILHALAQDQSEPSTEGELDPDND |
| Ga0105245_117037911 | 3300009098 | Miscanthus Rhizosphere | NTSTWIGFTPQRHIGVVILCNRGKQPATRIGRQLLHALAQDQSQASTEGQPDPNAN* |
| Ga0075418_114848592 | 3300009100 | Populus Rhizosphere | FAPQRKLGVVILVNRGKQHATGIGRQILHALAQENSEPSNEGESDPDAD* |
| Ga0066709_1002512054 | 3300009137 | Grasslands Soil | MEAPQRKLGVVILVNRGKQHATGIGRQILHALAQDQSEPSTDGAEPDPDID* |
| Ga0066709_1003684201 | 3300009137 | Grasslands Soil | STYIGFAPQQKLGVVILVNRGKQRATGIGRQILHALAQDQSEPSSEGEAEPDKD* |
| Ga0066709_1014247143 | 3300009137 | Grasslands Soil | VILVNRGKQHATGIGRQIVHALAQEQSEPSSEGEADPDSD* |
| Ga0066709_1035150591 | 3300009137 | Grasslands Soil | RQKLGVIILVNRGKQHATGIGRQILHALAQDQSEPSTEGELDPDND* |
| Ga0111538_124264722 | 3300009156 | Populus Rhizosphere | STYIGFARQQKLGVVILSNRGRQNATKVGRQILHALAQEKAEPLDEGPEPD* |
| Ga0105248_133167721 | 3300009177 | Switchgrass Rhizosphere | KLGVVILVNRGKQHATGIGRQILHALAQDQSQPSTEGEPEPDTD* |
| Ga0134070_103035052 | 3300010301 | Grasslands Soil | VNRGKQHATGIGRLIIHALAQNQSQPSSEGEANPDDE* |
| Ga0134082_102253393 | 3300010303 | Grasslands Soil | PQQKLGIVILVNRGKQHATGIGRQILHALAQDQSEPSSEGEAEPDKD* |
| Ga0134067_100713721 | 3300010321 | Grasslands Soil | NTSTYIGFAPQKQLGVVILVNRGKQHATGIGRLIIHALAQNQSQPSSEGEANPDDE* |
| Ga0134064_101483712 | 3300010325 | Grasslands Soil | VVILVNRGKQHATGFGRQILHALAQEKSEPSNEGESDPDAD* |
| Ga0134111_100266433 | 3300010329 | Grasslands Soil | GFAPQQKLGIVILVNRGKQHATGIGRQILHALAQDQSEPSSEGEAEPDKD* |
| Ga0134080_102029072 | 3300010333 | Grasslands Soil | STYIGFAPQQKLGVVILVNRGKQRATGIGRQILHALAQDQSKPSTEGEADPDSD* |
| Ga0134080_102206691 | 3300010333 | Grasslands Soil | TYIGFAPQPKLGVVILVNRGKQHATGIGRQILHALAQDQSEPSSEGEADPDSD* |
| Ga0134080_105715512 | 3300010333 | Grasslands Soil | PQRKLGVVILVNRGKQHATGIGRQILHALAQEKSEPSTEGEPEQDTD* |
| Ga0126379_101092334 | 3300010366 | Tropical Forest Soil | GFAPQRKLGVVILVNRGKQHATGIGRQILHAIAQDQSQLSTEGEPNPDVN* |
| Ga0134125_120687682 | 3300010371 | Terrestrial Soil | APQRKLAVVILVNRGKQHATGIGRQILHALAQENSEPSNEGESDPDAD* |
| Ga0126381_1015258073 | 3300010376 | Tropical Forest Soil | VNRGRQGATRIGRQILHALAQEHSEPLGEGAEPD* |
| Ga0134127_101309533 | 3300010399 | Terrestrial Soil | YIGFARQQKLGVVILSNRGEQDATKVGRQILHALAQEMAEPLVEGAEPD* |
| Ga0137364_101051004 | 3300012198 | Vadose Zone Soil | STYIGFAPQQKLGVVILVNRGKQRATGIGRQILHALAQDQSEPSSEGEAEPG* |
| Ga0137364_101963053 | 3300012198 | Vadose Zone Soil | STYIGFAPQQKLGVVILVNRGKQRATGIGRQILHALAQDQSKPSTEGEADPNSD* |
| Ga0137364_104078633 | 3300012198 | Vadose Zone Soil | YIGFAPERKLGVAILVNRGKQLATGIGRQILHALAQDQSLPSMEGEPEPDRD* |
| Ga0137364_104366773 | 3300012198 | Vadose Zone Soil | ARQQKLGVVILSNRGRQNATKVGRQILHALAQEKAEPLDEGPEPD* |
| Ga0137365_104571471 | 3300012201 | Vadose Zone Soil | TSTYIGFAPRQKLGVIILVNRGKQHATGIGRQILHALAQDQSQPSTEGESDPDNG* |
| Ga0137365_110478782 | 3300012201 | Vadose Zone Soil | QKLGVVILVNRGKQHATKIGRQILHALAQETSEPSSEGAEPDPDID* |
| Ga0137399_102131401 | 3300012203 | Vadose Zone Soil | YIGFTPQRKLAVVILVNRGKQHATGIGRQILHALAQENSEPSNEGESDPDAD* |
| Ga0137362_106007582 | 3300012205 | Vadose Zone Soil | NTSTYIGFAPQPKIGVVILVNRGKQHATGIGRQILHALAQDQSEPSSEGEADPDSD* |
| Ga0137362_113574772 | 3300012205 | Vadose Zone Soil | PNTSTYIGFAPQRKLGVVILVNRGKQRATGIGRQIIHALAQDQSAPSSEGAEPAPDID* |
| Ga0137381_103669933 | 3300012207 | Vadose Zone Soil | VNRGKQHATVFGRQILHAPAQDQSQPSTEGESNPDNG* |
| Ga0137376_102456823 | 3300012208 | Vadose Zone Soil | VVLVNRGKQHAVEFGRQIIHALAQDQSQPSSEGEADPDSD* |
| Ga0137376_106077722 | 3300012208 | Vadose Zone Soil | PQRKLAVVILVNRGKQHATGFGRQILHALAQEKSEPSNAGEPDPDAD* |
| Ga0137370_103450601 | 3300012285 | Vadose Zone Soil | QQKLGVVILVNRGKQRATGIGRQILHALAQDQSEPSSEGEAEPG* |
| Ga0137372_106904572 | 3300012350 | Vadose Zone Soil | PQRKLGVVILVNRGKQHATGFGRQILHALAQEKSEPSNAGEPDPDAD* |
| Ga0137366_105042092 | 3300012354 | Vadose Zone Soil | GFAPRQKLGIIILVNRGKQHATGIGRQILHALAQDQSQPSTEGESDPDND* |
| Ga0137366_111149621 | 3300012354 | Vadose Zone Soil | LVNRGKQHATGIGRQIIHTLAQDQSEPSSEGEPNPDND* |
| Ga0137384_110752111 | 3300012357 | Vadose Zone Soil | TYIGFAPQQKLGVVILVNRGKQHATGIGRQILHALAQDQSAPSSEGEGDPDSD* |
| Ga0137375_110752192 | 3300012360 | Vadose Zone Soil | RGRQNATIYGRQIIHALAQDQSQPSSEGEANPDDE* |
| Ga0137398_104803001 | 3300012683 | Vadose Zone Soil | VVILVNRGKQHATGIGRRILHALAQDQSVPSTEGEPEPDGD* |
| Ga0157285_103062211 | 3300012897 | Soil | TSTYIGFARQQKLGVVILSNRGEQDATKVGRQILHALAQEMAEPLVEGAEPD* |
| Ga0137413_104128341 | 3300012924 | Vadose Zone Soil | TSTYVGFAPQRKLAVVILVNRGKQHATGIGRQILHALAQENSEPSNEGESDPDAD* |
| Ga0137413_109485561 | 3300012924 | Vadose Zone Soil | TSTYIGFAPQRKLGVVILVNRGKQHATGIGRQILHALAQEKSEPSTEGEPEQDTD* |
| Ga0137419_100927573 | 3300012925 | Vadose Zone Soil | QNTSTYIGFASQQKLGVVILVNRGKQHATGIGRQIIHALAQDQSAPSSEGEPNPDND* |
| Ga0134077_100012549 | 3300012972 | Grasslands Soil | GKQRATGIGRQILHALAQDQSKPSIEGEADPDSD* |
| Ga0134110_104207612 | 3300012975 | Grasslands Soil | NRGKQQPTGIGRQILHALAQAQSQPSNEGEPEPDTD* |
| Ga0134076_105717702 | 3300012976 | Grasslands Soil | VVILVNRGRQNATIYGRQIINALAQNQSQPSSEGEANPDDE* |
| Ga0134075_100049817 | 3300014154 | Grasslands Soil | IVILVNRGKQHATGIGRQILHALAQDQSKPSTEGEADPDSD* |
| Ga0134073_100712581 | 3300015356 | Grasslands Soil | IGFAPQKKLGVVILVNRGKQHATGIGRQIIHALAQDQSQPSNEGEANPDND* |
| Ga0134073_103675741 | 3300015356 | Grasslands Soil | KKLGVVILVNRGRQNATIYGRQIIHALAQNQSQPSSEGEANPDDE* |
| Ga0132255_1017006183 | 3300015374 | Arabidopsis Rhizosphere | NNTSTYVGFAPQRKLAVVILVNRGKQRATVIGRQLLHALAQDQSQPSNEGEPEPDQE* |
| Ga0132255_1054327931 | 3300015374 | Arabidopsis Rhizosphere | IGLAPQRKLGVVILVNRGKQHPTGIGRQILHALAQEKSEPSTEGEPEQDTD* |
| Ga0182033_115383222 | 3300016319 | Soil | VILVNRGKQHATGIGRQMLHALAQEKSEPSNEGEPDPNAG |
| Ga0182039_109941192 | 3300016422 | Soil | NTSTYIGFARQQKLGVVLLSNRGPGQQNALKVGRQILHALAHEKAEPLDEGPNPTSSG |
| Ga0184608_105223341 | 3300018028 | Groundwater Sediment | MSSTSTYIGFARQQKLGVVILSNRGRQNATKVGRQILHALAQEKAEPLDEGPEPD |
| Ga0184632_101110622 | 3300018075 | Groundwater Sediment | VLVNRGKQHATGIGRQILHALAQEKSEPSTEGESDPDGD |
| Ga0066667_105713621 | 3300018433 | Grasslands Soil | STYIGFAPQRKLGVVILVNRGKQHATGIGRQIIHALAQDQSQPSSEGEPNPDID |
| Ga0066667_121935272 | 3300018433 | Grasslands Soil | GFATQKKLGVVILVNRGRQKATIYGRQTIHALAQDPSAPSNEGEVNPDE |
| Ga0193748_10290012 | 3300019865 | Soil | LNNTSTYVGFAPQRKLAVVILVNRGKQQATGIGRQILHALAQEKSEPSNEGESDPDAD |
| Ga0193715_10793051 | 3300019878 | Soil | GFAPQQKLGVVILVNRGKQHATGIGRQILHALARDQSEPSNEGEGDLDND |
| Ga0193729_11900811 | 3300019887 | Soil | RKLGVVILVNRGKQHATGIGRQIIHALAQDQSEPSSEGELNPDDD |
| Ga0193718_10713632 | 3300019999 | Soil | NRGKQHATGIGRQILHALAQEKSEPSTEGEPEQDTD |
| Ga0193730_10016758 | 3300020002 | Soil | LGIVILVNRGKQHATGIGRQIIHALAQDQSEPTSEGESNPDND |
| Ga0193721_10980812 | 3300020018 | Soil | GVVILVNRGKQHATGIGRQIIHALAQDQSAPSSEGEANPDND |
| Ga0210378_101485892 | 3300021073 | Groundwater Sediment | VVILVNRGKQHATGIGRQILHALAQEKSEPSNEGELEPDTD |
| Ga0210382_100599921 | 3300021080 | Groundwater Sediment | RGKQHATGIGRQIIHALAQDQSQPSNEGEPNPDND |
| Ga0193709_10973422 | 3300021411 | Soil | STYIGFAPQPKLGIVILVNRGKQQPTGIGRQILHALAQEKSEPANEGEPEPDTD |
| Ga0193695_10351061 | 3300021418 | Soil | IGFAPRQKLGVVILVNRGKQHATGIGRQIIHVLAQDQSAPSTEGESDPDND |
| Ga0222623_101912302 | 3300022694 | Groundwater Sediment | PQQKLGVVILVNRGKQHATKIGRQILHALAQDQSAPSSEGAEPNPDAD |
| Ga0222622_109872272 | 3300022756 | Groundwater Sediment | LGVVILVNRGKQHATGIGRQMLHALAQEKSEPSTEGEPEQDTD |
| Ga0207653_101564102 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | QKLGVVILSNRGEQDATKVGRQILHALAQEMAEPLVEGAEPD |
| Ga0207662_113642612 | 3300025918 | Switchgrass Rhizosphere | GRKLGVVILVNRGKQDATGIGRQIIHALAQDQSQPSSEGEPNPDNE |
| Ga0207652_118993732 | 3300025921 | Corn Rhizosphere | PQPKIGIVILLNRGKQQPTRNGRQILHVLAQDQSQPSTEGEPEPDTD |
| Ga0209265_11500232 | 3300026308 | Soil | NNTSTYIGFAPQRKLGVVILVNRGKQHDTGIARQILHALAQGKSEPSAEGEPEQDTD |
| Ga0209153_10481562 | 3300026312 | Soil | QKKLGVVVLVNRGKQHAVEFGRQIIHALAQDQSQPSNEGEANPDND |
| Ga0209472_100276612 | 3300026323 | Soil | STYIGFALQKKIGAVILVNRGRQNATIYGRQIIHALAQNQSQPSSEGEANPDDE |
| Ga0209802_11812322 | 3300026328 | Soil | VVVLVNRGKQHAVEFGRQIIHALAQDQSQPSNEGEANPDND |
| Ga0209158_13348562 | 3300026333 | Soil | TNTSTYIGFAPQKKLGVIILVNRGKQHAVEFGRQIIHALAQDQSQPSNEGEANPDNE |
| Ga0257147_10505032 | 3300026475 | Soil | ILVNRGKQHATGIGRQILHALAQEKSEPSTEGEPEPDGE |
| Ga0209808_10647311 | 3300026523 | Soil | ILVNRGKQHATGIGRQIIHALAQDQSAPSNEGEPNPDE |
| Ga0207558_1013342 | 3300026664 | Soil | QRKIGVVILVNRGRQNATIYGRQIIHALAQDQSEPSSEGEANPDNE |
| Ga0208575_10148212 | 3300026920 | Soil | VVILVNRGKQHATGIGWQIIHALAQDQSEPSREGEPNPDNE |
| Ga0209998_101324032 | 3300027717 | Arabidopsis Thaliana Rhizosphere | NGGLNNTSTYVGFAPQRKLAVVILVNRGKQHATGIGRQILHALAQENSEPSNEGESDPDA |
| Ga0209974_100345213 | 3300027876 | Arabidopsis Thaliana Rhizosphere | IVILINRGKQHATGIGRQILHALAQDQSEPSNEGEPNPDTD |
| Ga0209488_102436402 | 3300027903 | Vadose Zone Soil | TSTYVGFAPQRKLAVVILVNRGKQHATGIGRQILHALAQENSEPSNEGESDPDAD |
| Ga0307284_103092842 | 3300028799 | Soil | VNRGKQHATGIGRQILHALAQEKSEPSNAGEPEQDAD |
| Ga0307296_100307454 | 3300028819 | Soil | NRGKQHATGIGRQIIHALAQDQSQPSNEGEPNPDND |
| Ga0307277_102070642 | 3300028881 | Soil | PQRKLGVVILVNRGKQHATGIGRQILHALAQEKSEPSTEGEPEQDTD |
| Ga0307308_103809312 | 3300028884 | Soil | YIGFAPRQKLGVVILVNRGKQHATGIGRQILHALAQDQSEPSTQGESDPDND |
| Ga0307497_102060192 | 3300031226 | Soil | TSTYIGFAPQSKLGVVILVNRGKQQATGIGRQILHALAQENSEPSNEGESDPDAD |
| Ga0170818_1086286681 | 3300031474 | Forest Soil | GLNNTSTCIGFAPQRKLGVVILVNRGKQHATGIGRQILQALAQEKSEPSNEGEPEPDTD |
| Ga0310813_109004672 | 3300031716 | Soil | GVVILVNRGKQHATGSGRQILHALAQDQSEPSSEGEPNPDNE |
| Ga0318512_103353272 | 3300031846 | Soil | PNTSTWIGFTPQRHIGVILLCDRGKQPATKIGRQLLHALAQDQSQPSTEGEPNPDAN |
| Ga0310900_111307171 | 3300031908 | Soil | IILVNRGKQHATGFGRQILHALAQEQSEPSNEGEPDPEGN |
| Ga0306923_125710761 | 3300031910 | Soil | FTPQRHIGVILLCDRGKQPATKIGRQLLHALAQDQSQPSTEGEPNPDAN |
| Ga0310885_104474271 | 3300031943 | Soil | YIGFARQQKLGVVILSNRGEQDATKVGRQILHALAQEMAEPLVEGAEPD |
| Ga0306926_104591751 | 3300031954 | Soil | VILVNRGKQHATGIGRQILHALAQDQSQPSTEGEPEQDED |
| Ga0306920_1018319592 | 3300032261 | Soil | NTSTWIGFTPQRHIGVILLCDRGKQPATKIGRQLLHALAQDQSQPSTEGEPNPDAN |
| Ga0310810_101917581 | 3300033412 | Soil | GFAPQRELGIVILINRGKQHATGIGRQILHALAQDQSEPSNEGEPNPDTD |
| ⦗Top⦘ |