NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055911

Metagenome / Metatranscriptome Family F055911

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055911
Family Type Metagenome / Metatranscriptome
Number of Sequences 138
Average Sequence Length 47 residues
Representative Sequence MILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEAVLEFGEVAG
Number of Associated Samples 96
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 24.64 %
% of genes near scaffold ends (potentially truncated) 98.55 %
% of genes from short scaffolds (< 2000 bps) 84.06 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.957 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(45.652 % of family members)
Environment Ontology (ENVO) Unclassified
(61.594 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.725 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 68.89%    β-sheet: 0.00%    Coil/Unstructured: 31.11%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF05559DUF763 3.62
PF13495Phage_int_SAM_4 2.17
PF06186DUF992 2.17
PF01547SBP_bac_1 2.17
PF13737DDE_Tnp_1_5 1.45
PF01527HTH_Tnp_1 1.45
PF07883Cupin_2 1.45
PF02738MoCoBD_1 1.45
PF13683rve_3 1.45
PF06689zf-C4_ClpX 1.45
PF12762DDE_Tnp_IS1595 1.45
PF13289SIR2_2 1.45
PF00903Glyoxalase 1.45
PF02371Transposase_20 0.72
PF06155GBBH-like_N 0.72
PF00005ABC_tran 0.72
PF09106SelB-wing_2 0.72
PF00144Beta-lactamase 0.72
PF01758SBF 0.72
PF00239Resolvase 0.72
PF06574FAD_syn 0.72
PF13650Asp_protease_2 0.72
PF13181TPR_8 0.72
PF12681Glyoxalase_2 0.72
PF13649Methyltransf_25 0.72
PF01823MACPF 0.72
PF13676TIR_2 0.72
PF00202Aminotran_3 0.72
PF12697Abhydrolase_6 0.72
PF01648ACPS 0.72
PF10518TAT_signal 0.72
PF13924Lipocalin_5 0.72
PF13419HAD_2 0.72
PF00365PFK 0.72
PF00497SBP_bac_3 0.72
PF04471Mrr_cat 0.72
PF13561adh_short_C2 0.72
PF01555N6_N4_Mtase 0.72
PF067253D 0.72
PF13489Methyltransf_23 0.72
PF00078RVT_1 0.72
PF08281Sigma70_r4_2 0.72
PF08357SEFIR 0.72
PF05717TnpB_IS66 0.72
PF03150CCP_MauG 0.72
PF07859Abhydrolase_3 0.72
PF00892EamA 0.72
PF13286HD_assoc 0.72
PF01243Putative_PNPOx 0.72
PF16576HlyD_D23 0.72
PF00118Cpn60_TCP1 0.72
PF01966HD 0.72
PF00486Trans_reg_C 0.72
PF13701DDE_Tnp_1_4 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG1415Uncharacterized conserved protein, DUF763 domainFunction unknown [S] 3.62
COG1858Cytochrome c peroxidasePosttranslational modification, protein turnover, chaperones [O] 0.72
COG3547TransposaseMobilome: prophages, transposons [X] 0.72
COG3536Uncharacterized conserved protein, DUF971 familyFunction unknown [S] 0.72
COG3436TransposaseMobilome: prophages, transposons [X] 0.72
COG3276Selenocysteine-specific translation elongation factor SelBTranslation, ribosomal structure and biogenesis [J] 0.72
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.72
COG2367Beta-lactamase class ADefense mechanisms [V] 0.72
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.72
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.72
COG0196FAD synthaseCoenzyme transport and metabolism [H] 0.72
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.72
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.72
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.72
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.72
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.72
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.72
COG02056-phosphofructokinaseCarbohydrate transport and metabolism [G] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.96 %
UnclassifiedrootN/A13.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001867|JGI12627J18819_10182308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis850Open in IMG/M
3300002245|JGIcombinedJ26739_100198518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1897Open in IMG/M
3300003219|JGI26341J46601_10219095All Organisms → cellular organisms → Bacteria → Proteobacteria513Open in IMG/M
3300004152|Ga0062386_100901190Not Available731Open in IMG/M
3300006175|Ga0070712_101533341Not Available582Open in IMG/M
3300006176|Ga0070765_101727844All Organisms → cellular organisms → Bacteria → Proteobacteria587Open in IMG/M
3300006755|Ga0079222_11227983Not Available674Open in IMG/M
3300006755|Ga0079222_11554337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium624Open in IMG/M
3300006854|Ga0075425_102944764Not Available522Open in IMG/M
3300006954|Ga0079219_12375524All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300007788|Ga0099795_10320655All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300009792|Ga0126374_10247029All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300010042|Ga0126314_10266304All Organisms → cellular organisms → Bacteria → Proteobacteria1218Open in IMG/M
3300010046|Ga0126384_10490036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1057Open in IMG/M
3300010048|Ga0126373_12047526Not Available635Open in IMG/M
3300010154|Ga0127503_10199182All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300010359|Ga0126376_10220818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1588Open in IMG/M
3300010362|Ga0126377_12062758Not Available646Open in IMG/M
3300010376|Ga0126381_102729074All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300011270|Ga0137391_10393774All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300011444|Ga0137463_1188495Not Available774Open in IMG/M
3300012078|Ga0153999_1064195Not Available687Open in IMG/M
3300012203|Ga0137399_10888852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121750Open in IMG/M
3300012205|Ga0137362_11016721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae706Open in IMG/M
3300012469|Ga0150984_114911994All Organisms → cellular organisms → Bacteria1836Open in IMG/M
3300012469|Ga0150984_123028919Not Available711Open in IMG/M
3300012685|Ga0137397_10315141All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300012948|Ga0126375_10993934Not Available682Open in IMG/M
3300012960|Ga0164301_10454050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum912Open in IMG/M
3300016270|Ga0182036_10810776All Organisms → cellular organisms → Bacteria → Proteobacteria763Open in IMG/M
3300016270|Ga0182036_11126584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis650Open in IMG/M
3300016270|Ga0182036_11844113All Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300016294|Ga0182041_10002420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria9614Open in IMG/M
3300016294|Ga0182041_12191762All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300016319|Ga0182033_10019125All Organisms → cellular organisms → Bacteria4121Open in IMG/M
3300016341|Ga0182035_10011499All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria5181Open in IMG/M
3300016341|Ga0182035_10042491All Organisms → cellular organisms → Bacteria3029Open in IMG/M
3300016341|Ga0182035_10330366All Organisms → cellular organisms → Bacteria → Proteobacteria1260Open in IMG/M
3300016341|Ga0182035_11571555Not Available593Open in IMG/M
3300016357|Ga0182032_10743388All Organisms → cellular organisms → Bacteria → Proteobacteria826Open in IMG/M
3300016357|Ga0182032_11108842All Organisms → cellular organisms → Bacteria → Proteobacteria679Open in IMG/M
3300016371|Ga0182034_10026917All Organisms → cellular organisms → Bacteria3532Open in IMG/M
3300016371|Ga0182034_11886616All Organisms → cellular organisms → Bacteria → Proteobacteria527Open in IMG/M
3300016422|Ga0182039_10385426Not Available1186Open in IMG/M
3300016422|Ga0182039_10419472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1140Open in IMG/M
3300016445|Ga0182038_10053232All Organisms → cellular organisms → Bacteria2716Open in IMG/M
3300020018|Ga0193721_1151032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales560Open in IMG/M
3300020580|Ga0210403_10027211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4557Open in IMG/M
3300020583|Ga0210401_11047395All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300021168|Ga0210406_11104430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300021170|Ga0210400_10333315All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300021171|Ga0210405_10140229All Organisms → cellular organisms → Bacteria → Proteobacteria1913Open in IMG/M
3300021181|Ga0210388_11232922All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300021406|Ga0210386_10176492All Organisms → cellular organisms → Bacteria1799Open in IMG/M
3300021406|Ga0210386_10995065All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300021420|Ga0210394_10441620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1145Open in IMG/M
3300021433|Ga0210391_10470476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria987Open in IMG/M
3300021560|Ga0126371_10476468All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1395Open in IMG/M
3300021560|Ga0126371_12675928All Organisms → cellular organisms → Bacteria → Proteobacteria605Open in IMG/M
3300022508|Ga0222728_1011628All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300025928|Ga0207700_10443522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1143Open in IMG/M
3300025928|Ga0207700_11601990All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300025986|Ga0207658_10721979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria901Open in IMG/M
3300026142|Ga0207698_12350665All Organisms → cellular organisms → Bacteria → Proteobacteria544Open in IMG/M
3300026467|Ga0257154_1010972All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300026524|Ga0209690_1214700All Organisms → cellular organisms → Bacteria → Proteobacteria607Open in IMG/M
3300027703|Ga0207862_1129694All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300027903|Ga0209488_10300883All Organisms → cellular organisms → Bacteria → Proteobacteria1198Open in IMG/M
3300029636|Ga0222749_10553266All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300031128|Ga0170823_13332310All Organisms → cellular organisms → Bacteria → Proteobacteria849Open in IMG/M
3300031543|Ga0318516_10001795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales8536Open in IMG/M
3300031543|Ga0318516_10576521All Organisms → cellular organisms → Bacteria → Proteobacteria643Open in IMG/M
3300031545|Ga0318541_10027051All Organisms → cellular organisms → Bacteria2808Open in IMG/M
3300031545|Ga0318541_10065760All Organisms → cellular organisms → Bacteria1891Open in IMG/M
3300031545|Ga0318541_10124193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1403Open in IMG/M
3300031545|Ga0318541_10149973All Organisms → cellular organisms → Bacteria → Proteobacteria1279Open in IMG/M
3300031545|Ga0318541_10229909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1029Open in IMG/M
3300031545|Ga0318541_10332207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium848Open in IMG/M
3300031545|Ga0318541_10585353All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300031546|Ga0318538_10635513All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300031561|Ga0318528_10573261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium606Open in IMG/M
3300031564|Ga0318573_10310005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria845Open in IMG/M
3300031564|Ga0318573_10343684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium800Open in IMG/M
3300031564|Ga0318573_10726397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales534Open in IMG/M
3300031572|Ga0318515_10026826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2778Open in IMG/M
3300031573|Ga0310915_10142685All Organisms → cellular organisms → Bacteria → Proteobacteria1651Open in IMG/M
3300031573|Ga0310915_10211499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1358Open in IMG/M
3300031723|Ga0318493_10680071All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300031736|Ga0318501_10263912All Organisms → cellular organisms → Bacteria → Proteobacteria913Open in IMG/M
3300031736|Ga0318501_10298491All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300031736|Ga0318501_10525435Not Available646Open in IMG/M
3300031763|Ga0318537_10114406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Dankookia → Dankookia rubra1001Open in IMG/M
3300031768|Ga0318509_10355041All Organisms → cellular organisms → Bacteria → Proteobacteria820Open in IMG/M
3300031777|Ga0318543_10022912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae2357Open in IMG/M
3300031777|Ga0318543_10086762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1331Open in IMG/M
3300031777|Ga0318543_10230118All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300031780|Ga0318508_1111728All Organisms → cellular organisms → Bacteria → Proteobacteria763Open in IMG/M
3300031781|Ga0318547_10100971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella → Skermanella aerolata1647Open in IMG/M
3300031792|Ga0318529_10596949All Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300031794|Ga0318503_10020256Not Available1867Open in IMG/M
3300031819|Ga0318568_10148840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1430Open in IMG/M
3300031879|Ga0306919_11308857All Organisms → cellular organisms → Bacteria → Proteobacteria548Open in IMG/M
3300031890|Ga0306925_10019777Not Available6699Open in IMG/M
3300031890|Ga0306925_10021992All Organisms → cellular organisms → Bacteria6385Open in IMG/M
3300031890|Ga0306925_10327133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1647Open in IMG/M
3300031890|Ga0306925_11045716All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae829Open in IMG/M
3300031890|Ga0306925_11067957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SRS2818Open in IMG/M
3300031893|Ga0318536_10451644All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria647Open in IMG/M
3300031896|Ga0318551_10163185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1221Open in IMG/M
3300031897|Ga0318520_10546739Not Available717Open in IMG/M
3300031897|Ga0318520_11028029All Organisms → cellular organisms → Bacteria → Proteobacteria521Open in IMG/M
3300031910|Ga0306923_10083856All Organisms → cellular organisms → Bacteria3574Open in IMG/M
3300031912|Ga0306921_10108542All Organisms → cellular organisms → Bacteria3223Open in IMG/M
3300031912|Ga0306921_10902589All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae1003Open in IMG/M
3300031941|Ga0310912_10080398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2366Open in IMG/M
3300031945|Ga0310913_10098918All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae1970Open in IMG/M
3300031945|Ga0310913_11256092All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300031946|Ga0310910_10333439All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae1197Open in IMG/M
3300031946|Ga0310910_10821514All Organisms → cellular organisms → Bacteria → Proteobacteria731Open in IMG/M
3300031947|Ga0310909_10050419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3197Open in IMG/M
3300031947|Ga0310909_10251485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1476Open in IMG/M
3300031954|Ga0306926_10083873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3882Open in IMG/M
3300031954|Ga0306926_11206896Not Available888Open in IMG/M
3300031954|Ga0306926_12203594All Organisms → cellular organisms → Bacteria → Proteobacteria613Open in IMG/M
3300032001|Ga0306922_10073665All Organisms → cellular organisms → Bacteria3573Open in IMG/M
3300032001|Ga0306922_10242941All Organisms → cellular organisms → Bacteria → Proteobacteria1934Open in IMG/M
3300032010|Ga0318569_10172693All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300032044|Ga0318558_10348224All Organisms → cellular organisms → Bacteria → Proteobacteria735Open in IMG/M
3300032063|Ga0318504_10327309All Organisms → cellular organisms → Bacteria → Proteobacteria727Open in IMG/M
3300032068|Ga0318553_10063290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S1031840Open in IMG/M
3300032076|Ga0306924_10003996Not Available14318Open in IMG/M
3300032091|Ga0318577_10122271All Organisms → cellular organisms → Bacteria1229Open in IMG/M
3300032094|Ga0318540_10352071All Organisms → cellular organisms → Bacteria → Proteobacteria711Open in IMG/M
3300032261|Ga0306920_100027362All Organisms → cellular organisms → Bacteria8078Open in IMG/M
3300032261|Ga0306920_100280423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2484Open in IMG/M
3300032261|Ga0306920_101768748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis873Open in IMG/M
3300033289|Ga0310914_10329716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1378Open in IMG/M
3300033290|Ga0318519_10126390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S1031406Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil45.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.52%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.35%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.17%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.45%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.45%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.45%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.72%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.72%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.72%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.72%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.72%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.72%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012078Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC083 MetaGHost-AssociatedOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022508Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026467Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-AEnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12627J18819_1018230823300001867Forest SoilMMLSQSEEAVWHWRGSDCDIAEAWHHGGEVVSAVEAILEFGEVAGYMLVADGAVSASDGA
JGIcombinedJ26739_10019851853300002245Forest SoilMILSQFEEAVWHRWGSDRDIAEAWHHGGEIVSAIEAVLEFGEVAGYMLVVD
JGI26341J46601_1021909513300003219Bog Forest SoilMILSQFEEAVWDRRGSDCDRAEAWHHGGEIVSAVEAALEFGEVAGYMLVADGAVSVS
Ga0062386_10090119013300004152Bog Forest SoilMILSQFEEAVWRRRGSDCDIAEAWHHRGEIVSAVEAVLEFGEVAGY
Ga0070712_10153334123300006175Corn, Switchgrass And Miscanthus RhizosphereMILRPFEEAVWHRRGSDGDIAEAWHHGGEIVSAVEAVLEFGEVAGYMLVAD
Ga0070765_10172784413300006176SoilMILSQFEEAVWHRRGSGCDIAEAWHHGGEIVSAVEAVLEFGEVAGYMLVADGAVSA
Ga0079222_1122798323300006755Agricultural SoilMILSQFEEVVWHRRGSDCDMAEAWHHGGEIVSAVE
Ga0079222_1155433733300006755Agricultural SoilMILSQSGEAVWHRRGSDCDIAEAWHHGGEIVSAVEA
Ga0075425_10294476423300006854Populus RhizosphereMILSQSQEAVWHRRGSDCDIAEAWQHGGEIVSAVEAVLEFGEVAGYMLV
Ga0079219_1237552413300006954Agricultural SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEAVFEFGEVAGCMLVADGAVSASDGALD
Ga0099795_1032065533300007788Vadose Zone SoilMILSQFEEAVWHRWGSDCDIAEAWHHGGEIVSAVEAVLEFG
Ga0126374_1024702913300009792Tropical Forest SoilMILSQVEEAVWHGRSSDGDVAEPWHHGGEIVASVETVFE
Ga0126314_1026630413300010042Serpentine SoilMILRQFEEAVWHRWGSDCNEAKPWDQDGEIVSPVEAVFEFGEVARHVLAADGTVSAGDRALD
Ga0126384_1049003613300010046Tropical Forest SoilMILSQFEEAVWHRRSSESDVAEAWHHGGEIVSAVEAVLEFGE
Ga0126373_1204752613300010048Tropical Forest SoilMILSQFEEPVWHRRGPDCDIAEAWHHSGEIVSAVE
Ga0127503_1019918223300010154SoilMILSQFKEAVWHRRGSDCDIAEAWHHGGEIVSAVEAVLEFGEV
Ga0126376_1022081813300010359Tropical Forest SoilMILSQFEEAVWHRRSSESDVAEAWHHGGEIVSAVEA
Ga0126377_1206275833300010362Tropical Forest SoilMILSQFEEAVWHRRSSENDVAEARHHGGEIVSAVEAVLEFGEVAGYMLVADG
Ga0126381_10272907423300010376Tropical Forest SoilMILSQFEEAVWHRRSSESDVAEAWHHGGEIVSAVE
Ga0137391_1039377423300011270Vadose Zone SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEAVLEFG
Ga0137463_118849533300011444SoilMILRQFEEAVWHGRGSDGEVAEAWQHGGEIVSPVEAVFE
Ga0153999_106419513300012078Attine Ant Fungus GardensSQFEEALWHWRSLNCDATEPRHHRSEIVSPVEPVFEFDEVAGYMLVADGAVSVLTRQAG*
Ga0137399_1088885223300012203Vadose Zone SoilMILSEFEEAVWHRRGSDCDIAEAWHHGGEIVSAVKAV
Ga0137362_1101672113300012205Vadose Zone SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEAVLEF
Ga0150984_11491199443300012469Avena Fatua RhizosphereMILSQFEEAVWGSDCDKAEAWHHGGEIVSAVEAVLEFGEVAGYML
Ga0150984_12302891933300012469Avena Fatua RhizosphereMILSQFEEAVWHWRGSDCDIAEAWHHGGEIVSAVEAVLEFGEVAG
Ga0137397_1031514113300012685Vadose Zone SoilMILSQFEEAIGHGWSSDGDVAEPRHHGGEIVSPVEPVFEFGEVAG
Ga0126375_1099393423300012948Tropical Forest SoilMILSQFEEAVWHRRSSESDVAEAWHHGGEIVSAVEAVLEFGEVAG
Ga0164301_1045405033300012960SoilMILRQFEEAVWHRWGSDCDEAKPWNQDGEIVSPVEAVFEFGEVARHVLAAEGTVSAGDRALAIAT
Ga0182036_1081077623300016270SoilMILSQFEEAVWHRRGSECDIAEAWHHGGEIVSAVEAVLEFGEVAGYMLVADGAVSASD
Ga0182036_1112658423300016270SoilMMLSQFEEAVWHRGGSDCDIAEAWHHGGEIVSAVEAVLEFG
Ga0182036_1184411313300016270SoilMILSQFEKAVWHRRGPDCDKAEAWHHGGEIVSAVEAVLEFGEVAGYMLVADGA
Ga0182041_1000242013300016294SoilMILSQFEEAVRHRRGSDCDIAEAWHHGGESVSAVKAVLE
Ga0182041_1219176213300016294SoilMILSQFEKAVWHRRGPDCDKAEAWHHGGEIVSAVEAVLEFGEVAGYMLVADGAVSASDGA
Ga0182033_1001912513300016319SoilMILSQFEKAVWHRRGPDCDKAEAWHHGGEIVSAVEAVLEFGEVAGYM
Ga0182035_1001149973300016341SoilMILSQFEEAVRHRRGSDCDIAEAWHHGGEIVSAVEAV
Ga0182035_1004249153300016341SoilMILSQFEEAVWHQRGSDCDIAEAWHHGSEIVSAVEAVLEFGEVAGYMLV
Ga0182035_1033036643300016341SoilMILSQFEEAVRHRRGSDCDIAEAWHHGGEIVSAVKAVLEFGEV
Ga0182035_1157155513300016341SoilMILSQFEEAVWHRRGSDCDIAEAWDHGGEIVSAIKAVLEFGEVAGYMLVADGAVSASDGALDVAE
Ga0182032_1074338813300016357SoilMMLSQFEEAVWHRGRSDCDIAEAWHHGGEIVSAVEAVLEFGEVAGSMLVVDGAVS
Ga0182032_1110884213300016357SoilMMLSQFEEAVWHRGGSDCDIAEAWHHGGEIVSAVEAVLEFGEVAGSMLVVDGAVS
Ga0182034_1002691713300016371SoilMILSQFEEAVWHQRGSDCDIAEAWHHGSEIVSAVEAVLEFGEVAGYMLVTDGA
Ga0182034_1188661613300016371SoilMILSQFEEAVWHRRGSDCDIAEAWHHGSEIVSAVEAVLEFGEVAGYMLVTDGA
Ga0182039_1038542613300016422SoilMILSQFEEAVWHRRGSDCDIAEAWHPGGEVVSAIKAVLEFGEVAGYM
Ga0182039_1041947223300016422SoilMILSQFEEAVWHQRGSDCDIAEAWHHGSEIVSAVEAV
Ga0182038_1005323213300016445SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEAVLEFGE
Ga0193721_115103233300020018SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEAV
Ga0210403_1002721153300020580SoilMIFSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEAVL
Ga0210401_1104739513300020583SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEA
Ga0210406_1110443013300021168SoilMILSQFEQAVWHRRGSDCDIPEAWHHGGEIVSAVEAVLEFGEVAGRML
Ga0210400_1033331533300021170SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIEAVL
Ga0210405_1014022913300021171SoilMILSQFEEAVWHRRGSNCDIAEAWHHGGEIVSAVEAVLEFGEVAGY
Ga0210388_1123292213300021181SoilMIFSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEAV
Ga0210386_1017649213300021406SoilMIFSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVE
Ga0210386_1099506523300021406SoilMILSQFEEAIWHRRGSDCDIAEAWHHGGEIVSAVEAVLE
Ga0210394_1044162013300021420SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEAVLEFGEVAGYMRLSGMVRK
Ga0210391_1047047613300021433SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIEAV
Ga0126371_1047646813300021560Tropical Forest SoilMILSQFEEAIWHRWGSDCDVAEAWHHGGEIVSAVKA
Ga0126371_1267592833300021560Tropical Forest SoilMILSQFEEAVWHRRGSECDIAEAWHHGGEIVSAVEAVLEFGEVAGDMLV
Ga0222728_101162833300022508SoilMIFSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEAVLEFGEVAGYMLVADGAV
Ga0207700_1044352243300025928Corn, Switchgrass And Miscanthus RhizosphereMILSQFEEAIWHWRGSDCDTAEAWHHGGEIVSAVEAVLEFGEVAGYMLVGDG
Ga0207700_1160199023300025928Corn, Switchgrass And Miscanthus RhizosphereMILSQFEEAIWHRRGSDCDTAEAWHHGGEIVSAVEAV
Ga0207658_1072197923300025986Switchgrass RhizosphereMILRQFEEAVWHRRGSGCDEAEPWHHGGEIVSPVEPV
Ga0207698_1235066533300026142Corn RhizosphereMILRQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEAVLEFGEVAGYM
Ga0257154_101097223300026467SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEAVLEFGEVAGYMLVADGAVSASDGALDVAEGGC
Ga0209690_121470033300026524SoilMILSQFKEAVWHRRGSECDIAQAWHHGGEIVSAVEAVLEFGEVAGYMLVADGAVSASDGALD
Ga0207862_112969413300027703Tropical Forest SoilMMLSQFEEAVWHRGGSDCDIAEAWHHGGEIVSAVEAVLEFGELAGYMLVVDGAVSASDGALDVAEGGVDPL
Ga0209488_1030088313300027903Vadose Zone SoilMILSQFEEAVWHRRGSDRDIAEAWHHGGEIVSAVEAVLEFGEVAGYMLVA
Ga0222749_1055326613300029636SoilMIFSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEA
Ga0170823_1333231023300031128Forest SoilMILSQFEEAVRHRRGSDCDIAEAWHDGGEIVSAVEAVLEFG
Ga0318516_10001795113300031543SoilMILSQFEEVVWHRRGSDCDKAEAWHHGGEIVSAIEA
Ga0318516_1057652113300031543SoilMILSQFEKAVWHRRGPDCDKAEAWHHGGEIVSAVEAVL
Ga0318541_1002705113300031545SoilMILSQFEEAVRHRRGSDCDIAEAWHHGGEIVSAVKAV
Ga0318541_1006576043300031545SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVL
Ga0318541_1012419313300031545SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVLEFGEVAGYM
Ga0318541_1014997313300031545SoilMMLSQFEEAVWHRGGSDRDIAEAWHHGGEIVSVVE
Ga0318541_1022990923300031545SoilMILSQFEEAVWHRRGSDCDIAEAWDHGGEIVSAIKA
Ga0318541_1033220713300031545SoilMILSQFEEAVRHRRGSDCDIAEAWHHGGEIVSAVEAVLEFGEVAGYM
Ga0318541_1058535313300031545SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIK
Ga0318538_1063551313300031546SoilMILSQFEKAVWHRRGPDCDKAEAWHHGGEIVSAVEAV
Ga0318528_1057326123300031561SoilMILSQFEEAVRHRRGSDCDIAEAWHHGGEIVSAVK
Ga0318573_1031000523300031564SoilMILSQFEEAVWHQRGSDCDIAEAWHHGSEIVSAVEAVLEFGEVAGYMLVTDGAVSASDGALDVA
Ga0318573_1034368423300031564SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAV
Ga0318573_1072639733300031564SoilMILSQFEEAVWHRRGSDCDIAEAWHHGSEIVSAVEA
Ga0318515_1002682623300031572SoilMILSQFEEVVWHRRGSDCDKAEAWHHGGEIVSAIEAVLEFGEVAGYMLVADGGKCP
Ga0310915_1014268553300031573SoilMMLSQFEEAVWHRGGSDCDIAEAWHHGGEIVSAVEAVLEFGEVAGY
Ga0310915_1021149923300031573SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVLEFGEVAGY
Ga0318493_1068007113300031723SoilMILSQFEEAVWHRRGSDCDMAEAWHHGGEIVSAVEAVLEFGEVAGYMLVADGA
Ga0318501_1026391213300031736SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVLEFGEVAGYMLVADRAVSASDGALDVAEGGVD
Ga0318501_1029849113300031736SoilMILSQFEEAVRHRRGSDCDIAEAWHHGGEIVSAVE
Ga0318501_1052543513300031736SoilMILSQFEEVVWHRRGSDCDKAEAWHHGGEIVSAIEAVL
Ga0318537_1011440633300031763SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVLEFSEVAGYMLVADGAVSASDGAFDVAEGVVL
Ga0318509_1035504123300031768SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVLEFGEVAGYMLVADRAVSA
Ga0318543_1002291253300031777SoilMILSQFEEAVWHQRGSDCDIAEAWHHGSEIVSAVEAVLEFGEVAGYMLVTDGAVSASDGALDVAE
Ga0318543_1008676213300031777SoilMILSQFEEAVRHRRGSDCDIAEAWHHGGEIVSAVEAVL
Ga0318543_1023011813300031777SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVLE
Ga0318508_111172813300031780SoilMILSQFEKAVWHRRGPDCDKAEAWHHGGEIVSAVEAVLEFGEVAGYMLVADG
Ga0318547_1010097133300031781SoilMILSQFEEAVRHRRGSDCDIAEAWHHGGEIVSAIKAVL
Ga0318529_1059694913300031792SoilMILSQFEEAVRHRRGSDCDIAEAWHHGGEIVSAVKAVL
Ga0318503_1002025613300031794SoilMVLSQFEEAVWHRRGPDCDKAEAWHHGGEIVPAVEAVL
Ga0318568_1014884033300031819SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVLEFGEVAGYMLVADRAVSASDGALDVAEG
Ga0306919_1130885723300031879SoilMILSQFEEAVRHRRGSDCDIAEAWHHGGEIVSAVKAVLE
Ga0306925_1001977713300031890SoilMILSQFEEAVRHRRGSDCDIAEAWHHGGEIVSAVEAVLEFGEVAGYMLVADGAVSAS
Ga0306925_1002199213300031890SoilMILSQFEEAVRHRRGSDCDIAEAWHHGGEIVSAVKAVLEFGEVA
Ga0306925_1032713313300031890SoilMILSQFEEAVWHRRGSDCDIAEAWDHGGEIVSAIKAVL
Ga0306925_1104571613300031890SoilMLSQFEEAVWHRGGSDCDIAEAWHHGGEIVSAVEAVLEFGEV
Ga0306925_1106795723300031890SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEAVLE
Ga0318536_1045164423300031893SoilMLSQFEEAVWHRGGSDCDIAEAWHHGGEIVSAVEAVLEFGEVAGSMLV
Ga0318551_1016318513300031896SoilMLSQFEEAVWHRGGSDCDIAEAWHHGGEIVSAVEAVLEFGELAGY
Ga0318520_1054673923300031897SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVLEFGEVAGYMLVAD
Ga0318520_1102802913300031897SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVLEFGEVAGYMFVADGAVSASD
Ga0306923_1008385613300031910SoilMILSQFEEAVWHRRGSDCDIAEAWHHGSEIVSAVEAVLEFGEVAGYMLVTD
Ga0306921_1010854263300031912SoilMILSQFEEAVWHQRGSDCDIAEAWHHGSEIVSAVEAVLEFGEVAGYMLVTDGAV
Ga0306921_1090258933300031912SoilMLSQFEEAVWHRGGSDCDIAEAWHHGGEIVSAVEAVLEFGEVAGYM
Ga0310912_1008039813300031941SoilMILSQFEEAVWHRRGSDCDIAEAWDHGGEIVSAIKAV
Ga0310913_1009891813300031945SoilMILSQFEEAVWHRRGSDCDIAEAWHHGSEIVSAVEAVLEFGEVA
Ga0310913_1125609223300031945SoilMILSQFEEAVWHRRGSDCDMAEAWHHGGEIVSAVEAVLEFGEVAGYMLVADGAVSAS
Ga0310910_1033343933300031946SoilMILSQFEEAVWHRRGSDCDIAEAWHHGSEIVSAVEAVLEFGEVAGYMLVTDGAV
Ga0310910_1082151423300031946SoilMILSQFEKAVRHRRGPDCDKAEAWHHGGEIVSAVEAVLEFGEVAGYMLVADG
Ga0310909_1005041953300031947SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEAVLEFGEVAGYML
Ga0310909_1025148513300031947SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVLEF
Ga0306926_1008387333300031954SoilMILSQFEEAVWHRRGSDCDIAEAWDHGGEIVSAIK
Ga0306926_1120689623300031954SoilMILSQFEEAVWHRRGSDCDMAEAWHHGGEIVSAVEAVLEFGEVAGYMLVADGAVSASDGALD
Ga0306926_1220359413300031954SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEAVLEFGEVAG
Ga0306922_1007366573300032001SoilMILSQFEEAVWHQRGSDCDIAEAWHHGSEIVSAVEAVL
Ga0306922_1024294113300032001SoilMILSQFEEVVWHRRGSDCDKAEAWHHGGEIVSAIEAV
Ga0318569_1017269313300032010SoilMILSQFEEAVRHRRGSDCDIAEAWHHGGEIVSAIKAVLE
Ga0318558_1034822413300032044SoilMILSQFEEAVWHRRGSDSDIAEAWYHGGEIVSAVKAVLEFGEVAGYMLVA
Ga0318504_1032730913300032063SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVLEFSEVAGYMLVADGAVSASDGAFDVAEGVVLT
Ga0318553_1006329043300032068SoilMILSQFEEAVRHRRGSDCDIAEAWHHGGEIVSAVKAVLEFGEVAGYMLVADGAVSAG
Ga0306924_10003996223300032076SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVLEFGEVAGYMLVADG
Ga0318577_1012227133300032091SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVLEFSEVAGYMLVADGAVSASDGAFDVAEGVVLTHLKAGFR
Ga0318540_1035207123300032094SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVLEFGEVAGYMLVADRAVSASDGALD
Ga0306920_10002736213300032261SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAVEAVLEFGEVAGYMLVADGAVS
Ga0306920_10028042353300032261SoilMILSQFEEAVWHRRGSDCDIAEAWDHGGEIVSAVKAVL
Ga0306920_10176874823300032261SoilMILSQFEEAVWHRRGSDCDRAEAWDHGGEIVSAIKAVLEFG
Ga0310914_1032971623300033289SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVLEFGE
Ga0318519_1012639033300033290SoilMILSQFEEAVWHRRGSDCDIAEAWHHGGEIVSAIKAVLEFSEVAGYMLVADGAVSASDGAFDVAEGVVLTHLK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.