| Basic Information | |
|---|---|
| Family ID | F055885 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 44 residues |
| Representative Sequence | SFVLLSRQRDVMSGALMARLKNRRPRGPGFRARLEEGARAEDQD |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.38 % |
| % of genes from short scaffolds (< 2000 bps) | 91.30 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.580 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.638 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.841 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.826 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.39% β-sheet: 0.00% Coil/Unstructured: 48.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF01583 | APS_kinase | 62.32 |
| PF01747 | ATP-sulfurylase | 9.42 |
| PF14306 | PUA_2 | 7.25 |
| PF02559 | CarD_CdnL_TRCF | 2.17 |
| PF03551 | PadR | 1.45 |
| PF01850 | PIN | 1.45 |
| PF00722 | Glyco_hydro_16 | 1.45 |
| PF03372 | Exo_endo_phos | 0.72 |
| PF07704 | PSK_trans_fac | 0.72 |
| PF13424 | TPR_12 | 0.72 |
| PF01670 | Glyco_hydro_12 | 0.72 |
| PF01370 | Epimerase | 0.72 |
| PF14012 | DUF4229 | 0.72 |
| PF02720 | DUF222 | 0.72 |
| PF01070 | FMN_dh | 0.72 |
| PF11716 | MDMPI_N | 0.72 |
| PF13692 | Glyco_trans_1_4 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 62.32 |
| COG2046 | ATP sulfurylase (sulfate adenylyltransferase) | Inorganic ion transport and metabolism [P] | 9.42 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.45 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.45 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.45 |
| COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 1.45 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.72 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.72 |
| COG4423 | Uncharacterized conserved protein | Function unknown [S] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.58 % |
| Unclassified | root | N/A | 9.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502001|FACENC_GAMC6GA01AZYZ6 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10396707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 560 | Open in IMG/M |
| 3300004092|Ga0062389_102981495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300004092|Ga0062389_103629553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
| 3300005340|Ga0070689_101261770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 665 | Open in IMG/M |
| 3300005343|Ga0070687_100203348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1201 | Open in IMG/M |
| 3300005435|Ga0070714_102142354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 545 | Open in IMG/M |
| 3300005436|Ga0070713_101464193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 662 | Open in IMG/M |
| 3300005451|Ga0066681_10595965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 681 | Open in IMG/M |
| 3300005537|Ga0070730_10340418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 978 | Open in IMG/M |
| 3300005545|Ga0070695_100037395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3059 | Open in IMG/M |
| 3300005602|Ga0070762_10158125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1361 | Open in IMG/M |
| 3300005614|Ga0068856_100943279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 881 | Open in IMG/M |
| 3300005764|Ga0066903_106491367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 609 | Open in IMG/M |
| 3300005921|Ga0070766_10794119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
| 3300006028|Ga0070717_11144519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 708 | Open in IMG/M |
| 3300006050|Ga0075028_100903906 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300006176|Ga0070765_100451293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1205 | Open in IMG/M |
| 3300006358|Ga0068871_100476963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1121 | Open in IMG/M |
| 3300006804|Ga0079221_10866655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 658 | Open in IMG/M |
| 3300006854|Ga0075425_100724499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1142 | Open in IMG/M |
| 3300006854|Ga0075425_101917916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| 3300006871|Ga0075434_102509621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
| 3300006914|Ga0075436_100586073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 821 | Open in IMG/M |
| 3300009011|Ga0105251_10541835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
| 3300009522|Ga0116218_1359458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
| 3300009525|Ga0116220_10219437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 826 | Open in IMG/M |
| 3300009525|Ga0116220_10400620 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300009672|Ga0116215_1234127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 805 | Open in IMG/M |
| 3300010396|Ga0134126_12452399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
| 3300010399|Ga0134127_11602733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 725 | Open in IMG/M |
| 3300010399|Ga0134127_13334085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300010876|Ga0126361_10017598 | Not Available | 541 | Open in IMG/M |
| 3300012476|Ga0157344_1006046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 771 | Open in IMG/M |
| 3300012491|Ga0157329_1004030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 932 | Open in IMG/M |
| 3300012503|Ga0157313_1038251 | Not Available | 577 | Open in IMG/M |
| 3300012519|Ga0157352_1084939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300012685|Ga0137397_10205049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1467 | Open in IMG/M |
| 3300012929|Ga0137404_10108910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2246 | Open in IMG/M |
| 3300012955|Ga0164298_10037737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2228 | Open in IMG/M |
| 3300012984|Ga0164309_10153856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1532 | Open in IMG/M |
| 3300014201|Ga0181537_11140778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300014657|Ga0181522_10217187 | Not Available | 1126 | Open in IMG/M |
| 3300014745|Ga0157377_10341885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1001 | Open in IMG/M |
| 3300014968|Ga0157379_11152304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300015200|Ga0173480_10308808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 886 | Open in IMG/M |
| 3300016422|Ga0182039_11881003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
| 3300017823|Ga0187818_10283026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 727 | Open in IMG/M |
| 3300017926|Ga0187807_1024617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1859 | Open in IMG/M |
| 3300017926|Ga0187807_1117408 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300017926|Ga0187807_1224041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
| 3300017959|Ga0187779_10512320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 795 | Open in IMG/M |
| 3300017972|Ga0187781_10166079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1553 | Open in IMG/M |
| 3300017999|Ga0187767_10201454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 629 | Open in IMG/M |
| 3300018012|Ga0187810_10481594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
| 3300018044|Ga0187890_10719254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300018062|Ga0187784_11526847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
| 3300020582|Ga0210395_10036745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3591 | Open in IMG/M |
| 3300021088|Ga0210404_10889031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300021171|Ga0210405_11115839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 589 | Open in IMG/M |
| 3300021180|Ga0210396_10526042 | Not Available | 1033 | Open in IMG/M |
| 3300021402|Ga0210385_11552804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300021403|Ga0210397_10058325 | Not Available | 2496 | Open in IMG/M |
| 3300021404|Ga0210389_11557911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300021474|Ga0210390_11080578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 652 | Open in IMG/M |
| 3300021477|Ga0210398_10430379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1076 | Open in IMG/M |
| 3300021559|Ga0210409_11713286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300021560|Ga0126371_12483781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 627 | Open in IMG/M |
| 3300022557|Ga0212123_10836877 | Not Available | 549 | Open in IMG/M |
| 3300022714|Ga0242671_1014336 | Not Available | 1024 | Open in IMG/M |
| 3300024055|Ga0247794_10202321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 641 | Open in IMG/M |
| 3300024271|Ga0224564_1129555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300025910|Ga0207684_10093856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2559 | Open in IMG/M |
| 3300025910|Ga0207684_11187734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
| 3300025961|Ga0207712_11259166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
| 3300026377|Ga0257171_1028397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 955 | Open in IMG/M |
| 3300027676|Ga0209333_1048114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1178 | Open in IMG/M |
| 3300027842|Ga0209580_10348478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 738 | Open in IMG/M |
| 3300027855|Ga0209693_10172291 | Not Available | 1068 | Open in IMG/M |
| 3300027857|Ga0209166_10713522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300027867|Ga0209167_10739808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300027869|Ga0209579_10156061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1218 | Open in IMG/M |
| 3300027879|Ga0209169_10009670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 5427 | Open in IMG/M |
| 3300027905|Ga0209415_10625995 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300027911|Ga0209698_11257619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
| 3300028379|Ga0268266_10386208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1321 | Open in IMG/M |
| 3300028381|Ga0268264_10150393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2086 | Open in IMG/M |
| 3300028742|Ga0302220_10115906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1040 | Open in IMG/M |
| 3300028781|Ga0302223_10277464 | Not Available | 554 | Open in IMG/M |
| 3300028808|Ga0302228_10170319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 998 | Open in IMG/M |
| 3300028906|Ga0308309_10906364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 765 | Open in IMG/M |
| 3300029920|Ga0302142_1037738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1539 | Open in IMG/M |
| 3300029999|Ga0311339_10286837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1781 | Open in IMG/M |
| 3300030053|Ga0302177_10062254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2230 | Open in IMG/M |
| 3300030057|Ga0302176_10207277 | Not Available | 782 | Open in IMG/M |
| 3300030520|Ga0311372_10770157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1324 | Open in IMG/M |
| 3300030531|Ga0210274_1396582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia nigra | 773 | Open in IMG/M |
| 3300030578|Ga0210275_10204024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 637 | Open in IMG/M |
| 3300030618|Ga0311354_10161015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2439 | Open in IMG/M |
| 3300030706|Ga0310039_10012415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 4412 | Open in IMG/M |
| 3300030730|Ga0307482_1096927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. | 801 | Open in IMG/M |
| 3300031544|Ga0318534_10411560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 776 | Open in IMG/M |
| 3300031544|Ga0318534_10789494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300031682|Ga0318560_10242198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 968 | Open in IMG/M |
| 3300031708|Ga0310686_102786449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 889 | Open in IMG/M |
| 3300031708|Ga0310686_109107077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
| 3300031708|Ga0310686_109786539 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031708|Ga0310686_111944882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
| 3300031713|Ga0318496_10180469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1158 | Open in IMG/M |
| 3300031747|Ga0318502_10743322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
| 3300031765|Ga0318554_10815524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
| 3300031778|Ga0318498_10416091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
| 3300031805|Ga0318497_10359501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 813 | Open in IMG/M |
| 3300031805|Ga0318497_10631630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 601 | Open in IMG/M |
| 3300031835|Ga0318517_10553359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
| 3300031890|Ga0306925_10769397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1002 | Open in IMG/M |
| 3300031890|Ga0306925_12212847 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031893|Ga0318536_10216423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 975 | Open in IMG/M |
| 3300031942|Ga0310916_10215602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1610 | Open in IMG/M |
| 3300031947|Ga0310909_11145507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 631 | Open in IMG/M |
| 3300031962|Ga0307479_11312964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 684 | Open in IMG/M |
| 3300032010|Ga0318569_10519882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 554 | Open in IMG/M |
| 3300032010|Ga0318569_10550378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
| 3300032041|Ga0318549_10460243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300032054|Ga0318570_10555806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300032066|Ga0318514_10449044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
| 3300032076|Ga0306924_12388586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
| 3300032089|Ga0318525_10715604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300032091|Ga0318577_10286992 | Not Available | 788 | Open in IMG/M |
| 3300032160|Ga0311301_12495164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300032261|Ga0306920_101943015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 826 | Open in IMG/M |
| 3300032261|Ga0306920_102762199 | Not Available | 669 | Open in IMG/M |
| 3300032770|Ga0335085_10064411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4883 | Open in IMG/M |
| 3300032782|Ga0335082_10842235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 779 | Open in IMG/M |
| 3300032895|Ga0335074_11228323 | Not Available | 628 | Open in IMG/M |
| 3300032898|Ga0335072_10475707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1306 | Open in IMG/M |
| 3300033134|Ga0335073_10728308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1078 | Open in IMG/M |
| 3300033134|Ga0335073_10986179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 874 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.80% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.35% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.62% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.17% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.17% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.45% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.45% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.72% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.72% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.72% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
| 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029920 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030531 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030578 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCE_448250 | 2040502001 | Soil | GERDSQLRPASRQRDVMSGALMTRLKNRGPRTGGFRTRLEEGARAEDEE |
| JGIcombinedJ51221_103967072 | 3300003505 | Forest Soil | FVVSGIASFVLLSRQRDVMSGALLSRLKNGRSRAAGFRARLEEGARAEDED* |
| Ga0062389_1029814952 | 3300004092 | Bog Forest Soil | RQRDVMSSALMSRIRTRQQRRPGLRARLEDGARAEDDDL* |
| Ga0062389_1036295532 | 3300004092 | Bog Forest Soil | RQRDVMSSALMSRIRTRQQQRPGLRARLEDGARAEDEDS* |
| Ga0070689_1012617702 | 3300005340 | Switchgrass Rhizosphere | ASFVLLSRQRDVMSGALMTRLKNRRPRGPGVRARLEEGARAEDQE* |
| Ga0070687_1002033482 | 3300005343 | Switchgrass Rhizosphere | SGIASFVLLSRQRDVMSGALMTRLKNRRHRGPGFRARLEEGSRAEDQD* |
| Ga0070714_1021423541 | 3300005435 | Agricultural Soil | LAFLVSGIASFVLLSRQRDVMSSALMTRLKNRGPRTGGFRTRLEEGARAEDEE* |
| Ga0070713_1014641932 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RDVMSGALMARLKNRRPRGPGFRARLEEGARAEDQADQD* |
| Ga0066681_105959651 | 3300005451 | Soil | SFVLLSRQRDVMSGALMARLKNRRPRGPGFRARLEEGARAEDQD* |
| Ga0070730_103404181 | 3300005537 | Surface Soil | ASFVLLSRQRDVMSGALMARIKNGRGRLGGFRARIEDGARAEDED* |
| Ga0070695_1000373951 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | FVVSGIASFVLLSRQRDVMSGALMTRLKNRRHRGPGFRARLEEGTRAEDQD* |
| Ga0070762_101581251 | 3300005602 | Soil | SFVLLSRQRDVMSGVLTGRLGNRRTRTAGLRSRLEEGARSEDDD* |
| Ga0068856_1009432792 | 3300005614 | Corn Rhizosphere | AMSGALMARLKNRRPRSEGLRARLEEGARAEDED* |
| Ga0066903_1064913671 | 3300005764 | Tropical Forest Soil | MSGALLARLKNRRAGTAGFRARLEEGVRAEDEDEG* |
| Ga0070766_107941192 | 3300005921 | Soil | RQRDVMSGALMARIRTGQRRTTGFRARLEEGARAEDED* |
| Ga0070717_111445191 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FLVSGIASFVLLSRQRDAMSGALMTRLKNRGPRTGGFRARLEEGARAEDKD* |
| Ga0075028_1009039062 | 3300006050 | Watersheds | VVSGIASFVLLSRQRDRMSGALMARIRTGERRAAGFRARLEEGARAEDED* |
| Ga0070765_1004512932 | 3300006176 | Soil | SGIASFVLLSRQRDRMSGALMARIKSRRGRVAGFRARLDEGAQAEDDD* |
| Ga0068871_1004769632 | 3300006358 | Miscanthus Rhizosphere | FVLLSRQRDVMSGALMTRLKNRRPRGPGVRARLEEGARAEDQD* |
| Ga0079221_108666551 | 3300006804 | Agricultural Soil | AVSGIVSFVLLSRQRDMMSGALLARLKNRRPRGPGFRARLEEGARAEDRD* |
| Ga0075425_1007244992 | 3300006854 | Populus Rhizosphere | QRDAMSGALMARLKNRGPRTGGFRARLEEGARAEDED* |
| Ga0075425_1019179161 | 3300006854 | Populus Rhizosphere | ASFVLLSRQRDVMSGALMTRLKNRRHGGPGFRARLDEGARAEDQD* |
| Ga0075434_1025096211 | 3300006871 | Populus Rhizosphere | RQRDVMSGALMTRLKNRRHRGPGFRARLEEGTRAEDQD* |
| Ga0075436_1005860731 | 3300006914 | Populus Rhizosphere | LSRQRDAMSGALMARLKNRRPRSGGFRTRLEEGARAEDED* |
| Ga0105251_105418351 | 3300009011 | Switchgrass Rhizosphere | SFVLLSRQRDAMSGALMARLKNRGPRTGGFRARLEEGARAEDED* |
| Ga0116218_13594581 | 3300009522 | Peatlands Soil | LSRQRDIMSGALLARLKNGRARATSFRTRLEEGARAEDED* |
| Ga0116220_102194371 | 3300009525 | Peatlands Soil | VLLSRQRDVMSSALMNRIRNGRRRAGGFRARLEEGARAEDED* |
| Ga0116220_104006202 | 3300009525 | Peatlands Soil | LLSRQRDIMSGALLTRLKNGRARATGFRTRLEEGARAEDED* |
| Ga0116215_12341271 | 3300009672 | Peatlands Soil | SGIASFVLLSRQRDVMSSALMNRIRNGRRRAGGFRARLEEGARAEDDD* |
| Ga0134126_124523992 | 3300010396 | Terrestrial Soil | RQRDVMSGALMARLKNRRPRGSGFRARLEEGARAEDQD* |
| Ga0134127_116027331 | 3300010399 | Terrestrial Soil | SFVLLSRQRDVMSGALMTRLKNRRHRGPGFRARLDEGARAEDRD* |
| Ga0134127_133340852 | 3300010399 | Terrestrial Soil | VLLSRQRDVMSGALMTRLKNRRHRGPGFRARLEEGSRAEDQD* |
| Ga0126361_100175982 | 3300010876 | Boreal Forest Soil | VVSGIASFVLLSRQRDVMSSALMARIRPGQRRAGGFRARLEEGARAEDDD* |
| Ga0157344_10060461 | 3300012476 | Arabidopsis Rhizosphere | IASFVLLSRQRDVMSGALMTRLKNRRHRGPGFRARLDEGARAEDED* |
| Ga0157329_10040301 | 3300012491 | Arabidopsis Rhizosphere | VMSGALMTRLKNRRRRGPGFRARLEEGARAEDPD* |
| Ga0157313_10382511 | 3300012503 | Arabidopsis Rhizosphere | RDVMSGALMTRLKNRRHRGPGFRARLDEGARAEDQD* |
| Ga0157352_10849391 | 3300012519 | Unplanted Soil | FVVSGIASFVLLSRQRDVMSGALMTRLKNRRHRGPGFRARLDEGARAEDQD* |
| Ga0137397_102050491 | 3300012685 | Vadose Zone Soil | RDVMSGALMARLKSRRPRGPGFRARLEEGTRAEDED* |
| Ga0137404_101089102 | 3300012929 | Vadose Zone Soil | ASFVLLSRQRDVMSGALMARLKSRRPRGPGFRARLEEGARAEDRD* |
| Ga0164298_100377371 | 3300012955 | Soil | IASFVLLSRQRDAMSGALMKRLKNRRPRGPGFRARLEEGARAEDQE* |
| Ga0164309_101538561 | 3300012984 | Soil | LLSRQRDVMSGALMTRLKNRRHRGPGLRARLEEGTRAEDQD* |
| Ga0181537_111407781 | 3300014201 | Bog | ASFVLLSKQRDIMSGALTGRLRNGRQRVSGFRSRLDEGARAEDED* |
| Ga0181522_102171872 | 3300014657 | Bog | DVMSGALTARLRNRRARTTSLRARLDEGARSEDDD* |
| Ga0157377_103418852 | 3300014745 | Miscanthus Rhizosphere | GIASFVLLSRQRDVMSGALMTRLKNRRPRGPGFRARLEEGARAEDQD* |
| Ga0157379_111523042 | 3300014968 | Switchgrass Rhizosphere | VSGIASFVLLSRQRDVMSGALMARLKNRRPRGSGFRARLEEGARAEDQD* |
| Ga0173480_103088081 | 3300015200 | Soil | GIASFVLLSRQRDIMSGALMTRLKNRRHRGPGFRARLDEGARAEDQD* |
| Ga0182039_118810032 | 3300016422 | Soil | VLLSRQRDVMSGALMARIRAGRRRAAGFRVRIEEGTRAEDED |
| Ga0187818_102830262 | 3300017823 | Freshwater Sediment | AFVVSGIASFVLLSRQRDIMSGALLTRLKNGRARATSFRTRLEEGARAEDED |
| Ga0187807_10246171 | 3300017926 | Freshwater Sediment | FVLLSRQRDVMSSALMNRIRNGQRRAGGFRARLEEGARAEDDD |
| Ga0187807_11174082 | 3300017926 | Freshwater Sediment | LSRQRDVMSSALMNRIRSGQRRAAGFRARLEEGARAEDDD |
| Ga0187807_12240412 | 3300017926 | Freshwater Sediment | IASFVLLSRQRDLMSSALMNRIRNGQRRASGFRTRIEEGARAEDDD |
| Ga0187779_105123202 | 3300017959 | Tropical Peatland | LALACVISGIASFVLLSRQRDVMSRVLVARFRTRPRRAGGFRARIEEGARAEDED |
| Ga0187781_101660791 | 3300017972 | Tropical Peatland | ASFVLLSRQRDVISRALSARIGNGRGRVAEFRARIEEGARAEDED |
| Ga0187767_102014542 | 3300017999 | Tropical Peatland | VLLSRQRDRMSGALMTRLKSGRLRGSGLRARLEEGARAEDQD |
| Ga0187810_104815942 | 3300018012 | Freshwater Sediment | LLSRQRDVMSGALMSRIRNRQRRAAGFRARLEEGARAEDDD |
| Ga0187890_107192541 | 3300018044 | Peatland | SFVLLSRQRDIMSGALLTRLRNGRARGTSFRARLEEGARAEDED |
| Ga0187784_115268471 | 3300018062 | Tropical Peatland | ALLSFVLLSRQRDTVAGALSARFKRTAERAGSFRARLDEGARSEDDD |
| Ga0210395_100367451 | 3300020582 | Soil | LLSRQRDVMSGALLSRLKNGRSRAAGFRARLEEGARAEDED |
| Ga0210404_108890312 | 3300021088 | Soil | IASFVLLSRQRDVMSGALMARLKNRRPRGPGFRARLEEGTRAEDQD |
| Ga0210405_111158392 | 3300021171 | Soil | SRQRDRMSGALMARIKSRRGRVAGFRARLDEGAQAEDDD |
| Ga0210396_105260422 | 3300021180 | Soil | VSGIASFVLLSRQRDKMSGALMARIRTGQRRATGFRARLEEGARAEDDD |
| Ga0210385_115528042 | 3300021402 | Soil | SGIASFVLLSRQRDVMSSALMARIRPGQRRAAGFRARLEEGARAEDDD |
| Ga0210397_100583251 | 3300021403 | Soil | SGIASFVLLSRQRDIMSGALMAHLKNGRNRVGSFRARLEEGTRAEDED |
| Ga0210389_115579112 | 3300021404 | Soil | GGGILSFVLLSRQRDVMSGALMARLKNRRPRGPGFRARLEEGARGEDED |
| Ga0210390_110805782 | 3300021474 | Soil | LLSRQRDVMSGALLSRLKNGRSRAAGFRARLEEGARAEDEE |
| Ga0210398_104303791 | 3300021477 | Soil | SGIASFVLLSKQRDVMSGALAARLRNRREATTSLRSRLDEGARAEDDD |
| Ga0210409_117132862 | 3300021559 | Soil | FVQLSRQRDVMSGALMARLKNRRPRGPGFRARLEEGTRAEDKD |
| Ga0126371_124837812 | 3300021560 | Tropical Forest Soil | VLLSRQRDVMSGALMTRLKSRRPRGPGLRARLEEGARAEDED |
| Ga0212123_108368772 | 3300022557 | Iron-Sulfur Acid Spring | VLLSRQRDMMSGALMARIKTGRGRMAGFRARLEEGARAEDDD |
| Ga0242671_10143362 | 3300022714 | Soil | DVMSGALIARLMNGKRRATGFRARLEEGARAEDDD |
| Ga0247794_102023212 | 3300024055 | Soil | SFVLLSRQRDVMSGALMARLKSRRPRGPGFRARLEEGARAEDRD |
| Ga0224564_11295551 | 3300024271 | Soil | VLLSGQRDVMSGALMARIKNGRRRATGLRARIEEGARAEDEDL |
| Ga0207684_100938564 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VVSGIASFVLLSRQRDVMSGALMARLKNRRTRGPGFGARLEEGARAEDED |
| Ga0207684_111877342 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GIASFVLLSRQRDVMSGALMARLKNRRPRGPGFRARLEEGARAEDKD |
| Ga0207712_112591661 | 3300025961 | Switchgrass Rhizosphere | VLLSRQRDVMSGALMTRLKNRRPRGPGFRARLEEGARAEDQD |
| Ga0257171_10283971 | 3300026377 | Soil | LLSRQRDVMSGALMARLKSRRPRGPGFRARLEEGARAEDKD |
| Ga0209333_10481141 | 3300027676 | Forest Soil | IASFVLLSRQRDVMSGALAARLRNRRERTTSLGARLDEGARAEDDD |
| Ga0209580_103484782 | 3300027842 | Surface Soil | VVSGIASFVLLSRQRDVISRALAARVGRGRGRLAEFRTRIDEGARAEDDD |
| Ga0209693_101722913 | 3300027855 | Soil | RQRDKMSGQLMNRLKSGKPRANGFRARLEEGARAEDED |
| Ga0209166_107135221 | 3300027857 | Surface Soil | ASFVLLSRQRDVMSGALMARIKNGRGRLGGFRARIEDGARAEDED |
| Ga0209167_107398082 | 3300027867 | Surface Soil | ACLVSGIASFVLLSRQRDVMSGALMARIKTGRGRAAGFRTRLEDGARAEDDD |
| Ga0209579_101560612 | 3300027869 | Surface Soil | QRDVISRALAARIGSGRGRLGEFRARIDEGARAEDDD |
| Ga0209169_100096701 | 3300027879 | Soil | SKQRDVMSGALAARLRNRREATTSLRSRLDEGARAEDDD |
| Ga0209415_106259951 | 3300027905 | Peatlands Soil | VSGIASFVLLSRQRDIMSGALLTRLRNGRARAPSFRSRLEEGARAEDED |
| Ga0209698_112576192 | 3300027911 | Watersheds | VVSGIASFVLLSRQRDIMSGALLARLKNGRARATSFRTRLEEGARAEDED |
| Ga0268266_103862082 | 3300028379 | Switchgrass Rhizosphere | SRQRDVMSGALMTRLKNRRPRGPGFRARLEEGARAEDQD |
| Ga0268264_101503931 | 3300028381 | Switchgrass Rhizosphere | VSGIASFVLLSRQRDVMSGALMTRLKNRRPRGPGVRARLEEGARAEDQD |
| Ga0302220_101159061 | 3300028742 | Palsa | LSGQRDRMSGALIGRLRNGRQRASGLRARLDEGARAEDED |
| Ga0302223_102774641 | 3300028781 | Palsa | SGIASFVLLSRQRDKMSGQLMNRLKNGKQRTTGFRARLEEGARAEDDD |
| Ga0302228_101703191 | 3300028808 | Palsa | SRQRDRMSGALIGRLRNGRQRASGFRARLEEGARAEDED |
| Ga0308309_109063641 | 3300028906 | Soil | SGIASFVLLSRQRDRMSGALMARIKSRRGRVAGFRARLDEGAQAEDDD |
| Ga0302142_10377382 | 3300029920 | Bog | GIASFVLLSRQRDRMSGALTSRLRGVRSRTGELRTRLDEGTRAEDED |
| Ga0311339_102868372 | 3300029999 | Palsa | SKQRDVMSGALTGRLRNGRQRVSGFRSRLDEGARAEDED |
| Ga0302177_100622544 | 3300030053 | Palsa | QRDKMSGQLMNRLKNGKQRTTGFRARLEEGARAEDDD |
| Ga0302176_102072772 | 3300030057 | Palsa | RDKMSGQLMNRLKNGKQRTTGFRARLEEGARAEDDD |
| Ga0311372_107701571 | 3300030520 | Palsa | VSGIASFVLLSKQRDIMSGALTGRLRSGRQRVSGFRSRLDEGARAEDED |
| Ga0210274_13965821 | 3300030531 | Soil | VVRGIASFVLLSRQRDRMSGALMARIRTGERRAAGFRARLEEGARAEDDD |
| Ga0210275_102040243 | 3300030578 | Soil | ASFVLLSRPRDVMSGALAARLRNRREAATSLRARLNEGARAEDDD |
| Ga0311354_101610153 | 3300030618 | Palsa | LLSRQRDRMSGALIGRLKNGRQRASGLRARLEEGARSEDEE |
| Ga0310039_100124153 | 3300030706 | Peatlands Soil | SGVASFVLLSRQRDVMSSALMNRIRNGRRRAGGFRARLEEGARAEDED |
| Ga0307482_10969271 | 3300030730 | Hardwood Forest Soil | MSGALMARIRTGQRRTTGFRARLEEGARAEDEDYVADD |
| Ga0318534_104115602 | 3300031544 | Soil | VMSGALLARLKNGRARAAGFRERLEEGTRAEDEDKDRER |
| Ga0318534_107894941 | 3300031544 | Soil | RDQMSGALLARLTNRRPRGPGFRARLEEGARSEDED |
| Ga0318560_102421982 | 3300031682 | Soil | VLLSRQRDVMSRALMARIRTGQRRVAGFRARIEEGAQAEDDD |
| Ga0310686_1027864493 | 3300031708 | Soil | VLLSRQRDRMSGALMARIKTGPRRPAGFRARLEEGARAEDDD |
| Ga0310686_1091070771 | 3300031708 | Soil | SGIASFVLLSRQRDVISRALAARVGSGRGRLAEFRATIDEGARAEDDE |
| Ga0310686_1097865391 | 3300031708 | Soil | ASFVLLSRQRDVMSGALAGRLRGGRQRAAGFRARLDEGARAEDED |
| Ga0310686_1119448822 | 3300031708 | Soil | RDRMSGALMARIRPGQRRATGFRARLEEGARAEDDD |
| Ga0318496_101804692 | 3300031713 | Soil | VLLSRQRYVMSGALMARIRTGQRRMAGFRTRIEEGAQAEDDD |
| Ga0318502_107433222 | 3300031747 | Soil | SGIASFVLLSRQRDVMSGALMARIRTGQRRMAGFRTRIEEGAQAEDDD |
| Ga0318554_108155242 | 3300031765 | Soil | RDVMSSALMGRIRNGRRRAAGFRARIEEGARAEDED |
| Ga0318498_104160912 | 3300031778 | Soil | LACVVSGIASFVLLSRQRDVMSRALMARIRTGQRRVAGFRARIEEGAQAEDDD |
| Ga0318497_103595012 | 3300031805 | Soil | FVVSGIASFVLLSRQRDTMSGALMTRLKGRSPRGPGLRARLEEGARAEDQD |
| Ga0318497_106316301 | 3300031805 | Soil | VVSGIASFVLLSRQRDVMSGALMARIRAGRRRAAGFRVRIEEGARAEDED |
| Ga0318517_105533591 | 3300031835 | Soil | SRQRDVMSRALMARIRTGQRRVARFRARIEEGAQAEDDD |
| Ga0306925_107693971 | 3300031890 | Soil | SGTASFVLLSRQRDIMSGALLARLRNRRAAGFRARLDEGARAEDDED |
| Ga0306925_122128471 | 3300031890 | Soil | VLLSRQRDRMSGALLARLKNRRAGTAGFRARLEEGARAEDDDEDEG |
| Ga0318536_102164232 | 3300031893 | Soil | VSGIASFVLLSRQRDVMSGALMARIRAGRRRAAGFRVRIEEGARAEDED |
| Ga0310916_102156021 | 3300031942 | Soil | VVSGIASFVLLSRQRDVMSSALIARIRTRKQRASGFRSRIEEGARAEDDD |
| Ga0310909_111455072 | 3300031947 | Soil | ASFVLLSRQRDMMSGALMTRLKIRRPRGPGLRARLEEGARAEDQEL |
| Ga0307479_113129641 | 3300031962 | Hardwood Forest Soil | FVLLSRQRDRMSGALMARIKSRRGRVAGFRARLDEGAQAEDDD |
| Ga0318569_105198821 | 3300032010 | Soil | LSRQRDVMSGALMARIRTGQRRMAGFRTRIEEGAQAEDDD |
| Ga0318569_105503782 | 3300032010 | Soil | IASFVLLSRQRDAMSSALMNRLRNGQRRAAGFRARIEEGARAEDDD |
| Ga0318549_104602432 | 3300032041 | Soil | VSGIASFVLLSRQRDTMSGALMTRLKGRSPRGPGLRARLEEGARAEDQD |
| Ga0318570_105558062 | 3300032054 | Soil | IASFVLLSRQRDVMSGALMARIRTGQRRMAGFRTRIEEGAQAEDDD |
| Ga0318514_104490441 | 3300032066 | Soil | IASFVLLSRQRDQMSGALLARLTNRRPRGPGIRARLEEGARSEDED |
| Ga0306924_123885862 | 3300032076 | Soil | LSRQRDQMSGALLARLTNRRPRGPGFRARLEEGARSEDED |
| Ga0318525_107156041 | 3300032089 | Soil | QRDVMSSALMTRMRNGQRRAARFRARIEEGARAEDEDL |
| Ga0318577_102869921 | 3300032091 | Soil | ACVVSGIASFVLLSRQRDVMSSTLMNRIRNGKQRAAGFRSRIEEGARAEDDD |
| Ga0311301_124951642 | 3300032160 | Peatlands Soil | VLLSRQRDIMSGALLARLKNGRNRAASFRTRLEEGARAEDED |
| Ga0306920_1019430152 | 3300032261 | Soil | CVVSGIASFVLLSRQRDVMSGALMARIRTGQRRMAGFRTRIEEGAQAEDDD |
| Ga0306920_1027621991 | 3300032261 | Soil | VLLSRQRDAMSSALMARIRTGKQRAAGFRARIEEGARAEDED |
| Ga0335085_100644111 | 3300032770 | Soil | RQRDAMSGALMARLKNRGPRTGGFRARLEEGARAEDED |
| Ga0335082_108422351 | 3300032782 | Soil | LAFVVSGIASFVLLSRQRDRMSGALMTRLKSGRLRGPGLRARLEEGARAEDQD |
| Ga0335074_112283233 | 3300032895 | Soil | VLSRQRDRMSGALINRLKNGRGRVSSFRSRLDEGAAAEDED |
| Ga0335072_104757071 | 3300032898 | Soil | VSGIASFVLLSKQRDVMSGALMVRNGDGQRRATGFLAQLKEGARAEDED |
| Ga0335073_107283082 | 3300033134 | Soil | MLSRQRDRMSGALMARVRNGQRRAAGFRARIEDGARAEDED |
| Ga0335073_109861791 | 3300033134 | Soil | SRQRDAMSGALMARLKNRRPRGPGFRARLEEGARAEDQD |
| ⦗Top⦘ |