Basic Information | |
---|---|
Family ID | F055880 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 138 |
Average Sequence Length | 40 residues |
Representative Sequence | GRTGLDGRPVPVEQDGSAAPALLLLAAQLIEPFQAQR |
Number of Associated Samples | 113 |
Number of Associated Scaffolds | 138 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 97.83 % |
% of genes from short scaffolds (< 2000 bps) | 91.30 % |
Associated GOLD sequencing projects | 110 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (67.391 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (37.681 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.580 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.899 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.77% β-sheet: 0.00% Coil/Unstructured: 69.23% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 138 Family Scaffolds |
---|---|---|
PF12697 | Abhydrolase_6 | 5.07 |
PF00296 | Bac_luciferase | 4.35 |
PF04199 | Cyclase | 3.62 |
PF10648 | Gmad2 | 3.62 |
PF13672 | PP2C_2 | 2.90 |
PF00106 | adh_short | 2.90 |
PF02771 | Acyl-CoA_dh_N | 2.90 |
PF00583 | Acetyltransf_1 | 2.17 |
PF13483 | Lactamase_B_3 | 2.17 |
PF01641 | SelR | 2.17 |
PF00999 | Na_H_Exchanger | 2.17 |
PF12833 | HTH_18 | 1.45 |
PF13411 | MerR_1 | 1.45 |
PF02518 | HATPase_c | 1.45 |
PF01850 | PIN | 1.45 |
PF12706 | Lactamase_B_2 | 1.45 |
PF07859 | Abhydrolase_3 | 1.45 |
PF05222 | AlaDh_PNT_N | 1.45 |
PF01262 | AlaDh_PNT_C | 1.45 |
PF13561 | adh_short_C2 | 1.45 |
PF00501 | AMP-binding | 1.45 |
PF00403 | HMA | 0.72 |
PF07969 | Amidohydro_3 | 0.72 |
PF00144 | Beta-lactamase | 0.72 |
PF13673 | Acetyltransf_10 | 0.72 |
PF13424 | TPR_12 | 0.72 |
PF13450 | NAD_binding_8 | 0.72 |
PF13520 | AA_permease_2 | 0.72 |
PF01872 | RibD_C | 0.72 |
PF08241 | Methyltransf_11 | 0.72 |
PF08240 | ADH_N | 0.72 |
PF00857 | Isochorismatase | 0.72 |
PF00376 | MerR | 0.72 |
PF04185 | Phosphoesterase | 0.72 |
PF02021 | UPF0102 | 0.72 |
PF08443 | RimK | 0.72 |
PF03061 | 4HBT | 0.72 |
PF00561 | Abhydrolase_1 | 0.72 |
PF13472 | Lipase_GDSL_2 | 0.72 |
PF06441 | EHN | 0.72 |
PF00196 | GerE | 0.72 |
PF13847 | Methyltransf_31 | 0.72 |
PF03795 | YCII | 0.72 |
PF02852 | Pyr_redox_dim | 0.72 |
PF08281 | Sigma70_r4_2 | 0.72 |
PF00996 | GDI | 0.72 |
PF00155 | Aminotran_1_2 | 0.72 |
PF13377 | Peripla_BP_3 | 0.72 |
PF00903 | Glyoxalase | 0.72 |
PF07681 | DoxX | 0.72 |
PF00596 | Aldolase_II | 0.72 |
PF08922 | DUF1905 | 0.72 |
PF08818 | DUF1801 | 0.72 |
PF13466 | STAS_2 | 0.72 |
PF00392 | GntR | 0.72 |
PF13006 | Nterm_IS4 | 0.72 |
COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
---|---|---|---|
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 4.35 |
COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 3.62 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 2.90 |
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 2.17 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 2.17 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 2.17 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 2.17 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 2.17 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 2.17 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 1.45 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.72 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.72 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.72 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.72 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.72 |
COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.72 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.72 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.72 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.72 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.72 |
COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.72 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.72 |
COG0792 | Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 family | Replication, recombination and repair [L] | 0.72 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.72 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 71.74 % |
Unclassified | root | N/A | 28.26 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003505|JGIcombinedJ51221_10272776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 688 | Open in IMG/M |
3300004633|Ga0066395_10642697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
3300005332|Ga0066388_102097897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1017 | Open in IMG/M |
3300005450|Ga0066682_10584836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 703 | Open in IMG/M |
3300005541|Ga0070733_10575102 | Not Available | 755 | Open in IMG/M |
3300005541|Ga0070733_10977256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
3300005591|Ga0070761_10818457 | Not Available | 587 | Open in IMG/M |
3300005610|Ga0070763_10674856 | Not Available | 604 | Open in IMG/M |
3300005921|Ga0070766_10061279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2141 | Open in IMG/M |
3300005921|Ga0070766_10585709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 748 | Open in IMG/M |
3300005921|Ga0070766_11126745 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 542 | Open in IMG/M |
3300006059|Ga0075017_101401986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
3300006176|Ga0070765_100711844 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 948 | Open in IMG/M |
3300006176|Ga0070765_101108109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
3300006854|Ga0075425_100033095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5747 | Open in IMG/M |
3300006903|Ga0075426_11433523 | Not Available | 525 | Open in IMG/M |
3300009524|Ga0116225_1102839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1325 | Open in IMG/M |
3300009525|Ga0116220_10560132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ag109_G2-15 | 523 | Open in IMG/M |
3300009683|Ga0116224_10149274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. E3298 | 1126 | Open in IMG/M |
3300009698|Ga0116216_10028443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3489 | Open in IMG/M |
3300009698|Ga0116216_10548664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 697 | Open in IMG/M |
3300010048|Ga0126373_11752481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 685 | Open in IMG/M |
3300010162|Ga0131853_11325926 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300010335|Ga0134063_10555579 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300010361|Ga0126378_10263333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1820 | Open in IMG/M |
3300010361|Ga0126378_10592492 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300010361|Ga0126378_12581183 | Not Available | 580 | Open in IMG/M |
3300010376|Ga0126381_103023334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 668 | Open in IMG/M |
3300010376|Ga0126381_103811454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
3300010401|Ga0134121_11376980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 715 | Open in IMG/M |
3300011035|Ga0138542_136954 | Not Available | 545 | Open in IMG/M |
3300012210|Ga0137378_10602093 | Not Available | 1009 | Open in IMG/M |
3300012971|Ga0126369_10774134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1041 | Open in IMG/M |
3300012971|Ga0126369_13472428 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300014165|Ga0181523_10489700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
3300014169|Ga0181531_10377018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
3300016270|Ga0182036_10228330 | Not Available | 1381 | Open in IMG/M |
3300016294|Ga0182041_10836229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 824 | Open in IMG/M |
3300016294|Ga0182041_10893900 | Not Available | 798 | Open in IMG/M |
3300016319|Ga0182033_10269534 | Not Available | 1392 | Open in IMG/M |
3300016357|Ga0182032_11069852 | Not Available | 691 | Open in IMG/M |
3300016357|Ga0182032_11632848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus → unclassified Actinoallomurus → Actinoallomurus sp. WRP6H-15 | 561 | Open in IMG/M |
3300016404|Ga0182037_11191358 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 669 | Open in IMG/M |
3300017926|Ga0187807_1285508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ag109_G2-15 | 546 | Open in IMG/M |
3300017942|Ga0187808_10099875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus fascians | 1261 | Open in IMG/M |
3300017942|Ga0187808_10130932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. E3298 | 1100 | Open in IMG/M |
3300017946|Ga0187879_10485276 | Not Available | 685 | Open in IMG/M |
3300017947|Ga0187785_10175741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 916 | Open in IMG/M |
3300017948|Ga0187847_10123687 | Not Available | 1418 | Open in IMG/M |
3300017955|Ga0187817_10894526 | Not Available | 568 | Open in IMG/M |
3300017961|Ga0187778_10474317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 828 | Open in IMG/M |
3300017970|Ga0187783_10342620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1088 | Open in IMG/M |
3300017972|Ga0187781_10067584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2461 | Open in IMG/M |
3300018001|Ga0187815_10015004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3371 | Open in IMG/M |
3300018043|Ga0187887_10232325 | Not Available | 1094 | Open in IMG/M |
3300018085|Ga0187772_11384066 | Not Available | 522 | Open in IMG/M |
3300021088|Ga0210404_10493193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 691 | Open in IMG/M |
3300021180|Ga0210396_11214533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 630 | Open in IMG/M |
3300021402|Ga0210385_10756603 | Not Available | 744 | Open in IMG/M |
3300021404|Ga0210389_10255394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1371 | Open in IMG/M |
3300021405|Ga0210387_10028900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4359 | Open in IMG/M |
3300021433|Ga0210391_10626181 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 844 | Open in IMG/M |
3300021474|Ga0210390_10188621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1743 | Open in IMG/M |
3300022557|Ga0212123_10606436 | Not Available | 690 | Open in IMG/M |
3300022709|Ga0222756_1069897 | Not Available | 558 | Open in IMG/M |
3300027096|Ga0208099_1063143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 523 | Open in IMG/M |
3300027528|Ga0208985_1103875 | Not Available | 544 | Open in IMG/M |
3300027545|Ga0209008_1043060 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
3300027590|Ga0209116_1026683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1210 | Open in IMG/M |
3300027609|Ga0209221_1052320 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Spirosoma → Spirosoma profusum | 1082 | Open in IMG/M |
3300027609|Ga0209221_1088610 | Not Available | 802 | Open in IMG/M |
3300027854|Ga0209517_10093627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Actinacidiphila → Actinacidiphila soli | 2045 | Open in IMG/M |
3300027857|Ga0209166_10206743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1054 | Open in IMG/M |
3300027867|Ga0209167_10326986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 831 | Open in IMG/M |
3300027867|Ga0209167_10787377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
3300027882|Ga0209590_10573528 | Not Available | 727 | Open in IMG/M |
3300028715|Ga0307313_10048553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana | 1240 | Open in IMG/M |
3300028773|Ga0302234_10252424 | Not Available | 759 | Open in IMG/M |
3300028784|Ga0307282_10250685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana | 850 | Open in IMG/M |
3300028877|Ga0302235_10439711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 556 | Open in IMG/M |
3300028906|Ga0308309_10366854 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1230 | Open in IMG/M |
3300030618|Ga0311354_10116586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2962 | Open in IMG/M |
3300031543|Ga0318516_10288625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 948 | Open in IMG/M |
3300031543|Ga0318516_10333030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Moorena | 876 | Open in IMG/M |
3300031543|Ga0318516_10463871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia brasiliensis | 728 | Open in IMG/M |
3300031544|Ga0318534_10596766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Moorena | 628 | Open in IMG/M |
3300031572|Ga0318515_10101750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1507 | Open in IMG/M |
3300031572|Ga0318515_10713557 | Not Available | 530 | Open in IMG/M |
3300031573|Ga0310915_11198981 | Not Available | 525 | Open in IMG/M |
3300031679|Ga0318561_10264931 | Not Available | 938 | Open in IMG/M |
3300031680|Ga0318574_10096420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1634 | Open in IMG/M |
3300031680|Ga0318574_10096933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1630 | Open in IMG/M |
3300031708|Ga0310686_107381429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 1345 | Open in IMG/M |
3300031708|Ga0310686_109427794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 606 | Open in IMG/M |
3300031708|Ga0310686_114396602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces specialis | 702 | Open in IMG/M |
3300031713|Ga0318496_10188492 | Not Available | 1132 | Open in IMG/M |
3300031715|Ga0307476_10773496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis vastitatis | 710 | Open in IMG/M |
3300031724|Ga0318500_10041073 | Not Available | 1917 | Open in IMG/M |
3300031754|Ga0307475_10925010 | Not Available | 688 | Open in IMG/M |
3300031764|Ga0318535_10091670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus fascians | 1323 | Open in IMG/M |
3300031764|Ga0318535_10488508 | Not Available | 547 | Open in IMG/M |
3300031765|Ga0318554_10224439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1070 | Open in IMG/M |
3300031768|Ga0318509_10378019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 792 | Open in IMG/M |
3300031771|Ga0318546_10268904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leifsonia | 1176 | Open in IMG/M |
3300031778|Ga0318498_10006282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4579 | Open in IMG/M |
3300031779|Ga0318566_10114478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1328 | Open in IMG/M |
3300031779|Ga0318566_10414698 | Not Available | 662 | Open in IMG/M |
3300031781|Ga0318547_10861200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella panacisegetis | 565 | Open in IMG/M |
3300031792|Ga0318529_10393021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 646 | Open in IMG/M |
3300031796|Ga0318576_10039830 | All Organisms → cellular organisms → Bacteria | 1994 | Open in IMG/M |
3300031798|Ga0318523_10265583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 857 | Open in IMG/M |
3300031833|Ga0310917_10814112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Moorena | 630 | Open in IMG/M |
3300031859|Ga0318527_10130332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1047 | Open in IMG/M |
3300031896|Ga0318551_10670846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
3300031897|Ga0318520_10286266 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 990 | Open in IMG/M |
3300031910|Ga0306923_11598922 | Not Available | 678 | Open in IMG/M |
3300031942|Ga0310916_10344073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1266 | Open in IMG/M |
3300031946|Ga0310910_10286262 | Not Available | 1294 | Open in IMG/M |
3300031954|Ga0306926_10998054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 996 | Open in IMG/M |
3300031954|Ga0306926_12795926 | Not Available | 527 | Open in IMG/M |
3300031959|Ga0318530_10497138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
3300031981|Ga0318531_10153139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1033 | Open in IMG/M |
3300032008|Ga0318562_10336826 | Not Available | 877 | Open in IMG/M |
3300032010|Ga0318569_10566631 | Not Available | 529 | Open in IMG/M |
3300032035|Ga0310911_10184952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1181 | Open in IMG/M |
3300032041|Ga0318549_10384175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus fascians | 633 | Open in IMG/M |
3300032059|Ga0318533_10759042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 712 | Open in IMG/M |
3300032064|Ga0318510_10037758 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 1655 | Open in IMG/M |
3300032067|Ga0318524_10727280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
3300032068|Ga0318553_10038540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2321 | Open in IMG/M |
3300032076|Ga0306924_11169223 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300032089|Ga0318525_10268474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 877 | Open in IMG/M |
3300032089|Ga0318525_10601998 | Not Available | 561 | Open in IMG/M |
3300032261|Ga0306920_101697784 | Not Available | 895 | Open in IMG/M |
3300032770|Ga0335085_11904404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leifsonia | 606 | Open in IMG/M |
3300032892|Ga0335081_10103612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4221 | Open in IMG/M |
3300033290|Ga0318519_10052404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2045 | Open in IMG/M |
3300033290|Ga0318519_10207233 | Not Available | 1120 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 37.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.80% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.80% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.07% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.07% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.62% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.62% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.62% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.17% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.17% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.45% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.45% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.45% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.45% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.45% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.72% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.72% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011035 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 23 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ51221_102727761 | 3300003505 | Forest Soil | GGAVGRTGLNGRPVPVEQDASSDPVLLLLAEQLIEPFQAAR* |
Ga0066395_106426971 | 3300004633 | Tropical Forest Soil | RGQAPGRTGLAGRPVPVEQDDPGPALLLLAGQLGEPFQARGR* |
Ga0066388_1020978971 | 3300005332 | Tropical Forest Soil | ARGDAVGRTGLDGRPVPVEQDDSAGRALLLMAEQLIEPFRAPG* |
Ga0066682_105848361 | 3300005450 | Soil | DSVNRTGLDGRPVPVEQEASAGPALLLVAEQLAEPFRARA* |
Ga0070733_105751021 | 3300005541 | Surface Soil | TGLDGRPVPVEQEAAARPALLLMAEQLAEPFQVQR* |
Ga0070733_109772561 | 3300005541 | Surface Soil | GVGRTGLNGRPVPVEQAESARPAPLLLAEQLIAPFRAQT* |
Ga0070761_108184572 | 3300005591 | Soil | RGESLGRTGLDGRPVPVEQDAPATSPLLLMAEQLIEPFQAQR* |
Ga0070763_106748561 | 3300005610 | Soil | ARADRLGQAGRTGLNGRPVPVEQDSLRPALLLMAGQLIEPFRAPP* |
Ga0070766_100612791 | 3300005921 | Soil | RTGLTGRPVPVEQDASSDPVLLLLAEQLIEPFQAAR* |
Ga0070766_105857092 | 3300005921 | Soil | VGRTGLDGRPVPVEQSDPAAPPLRLMVGQLIEPFQAQR* |
Ga0070766_111267452 | 3300005921 | Soil | RTGLDGRPVPVEQDVAAGPALRLMAGQLIEPFQAQD* |
Ga0075017_1014019861 | 3300006059 | Watersheds | AVGRTGLDGRPVPVEQDDSAGLVLLLLGEQLIEPFQARG* |
Ga0070765_1007118442 | 3300006176 | Soil | AVGRTGLDGRPVPVEQDGATAPALLLMAGQLIEPFQAQR* |
Ga0070765_1011081092 | 3300006176 | Soil | RRDAVGRTGLDGRPVPVEQDAPSRPALLLLANQLAEPFRTQF* |
Ga0075425_1000330956 | 3300006854 | Populus Rhizosphere | MTGGLDGRPVPVEQERAATPGPLLLAEQLIEPFQAQR* |
Ga0075426_114335233 | 3300006903 | Populus Rhizosphere | TGLDGRPVPVEQEASAGPALLLVAEQLAEPFRARG* |
Ga0116225_11028394 | 3300009524 | Peatlands Soil | VGRTGLDSRPIPVEQDDPAGPGLLLLAGQLIEPFHGRG* |
Ga0116220_105601322 | 3300009525 | Peatlands Soil | GGAVGRTGLDGRPVPVEQDDSAGPALRLLTEQLLEPFRG* |
Ga0116224_101492741 | 3300009683 | Peatlands Soil | AVGRTGLDGRPVPVEQDDSAGPALRLLTEQLLEPFRG* |
Ga0116216_100284431 | 3300009698 | Peatlands Soil | TGLDGRPVPVEQDDSAGLVLLLLGEQLIEPFQARG* |
Ga0116216_105486642 | 3300009698 | Peatlands Soil | VGRTGLDGRPVPVEQDDPAAPPLRLMVGQLIEPFQAQR* |
Ga0126373_117524812 | 3300010048 | Tropical Forest Soil | DAVGRTGLDGRPVPVEQDDSAGSVLLLLAEQLAEPFQAQR* |
Ga0131853_113259262 | 3300010162 | Termite Gut | AVGRTGLDGRPVPVEQDGSARPVLRVVAEQLLEPFQAARG* |
Ga0134063_105555792 | 3300010335 | Grasslands Soil | PSRTDSVNRTGLDGRPVPVEQEASAGPALLLVAEQLAEPFRARA* |
Ga0126378_102633331 | 3300010361 | Tropical Forest Soil | TGLDGRPVPVEQDDSAGRALLLMAEQLIEPFRAPG* |
Ga0126378_105924921 | 3300010361 | Tropical Forest Soil | GRTGLDGRPVPVEQDYPAAAPGPLLLAGQLIEPLQARR* |
Ga0126378_125811831 | 3300010361 | Tropical Forest Soil | GRTGLDGRPVPVEQGDSARPALLLLAEQLIEPFQARS* |
Ga0126381_1030233341 | 3300010376 | Tropical Forest Soil | TGLDGRPVPVEQDSSAGPALLLMAEQLIEPFAAQRG* |
Ga0126381_1038114541 | 3300010376 | Tropical Forest Soil | LTRTGLDGRPVPVEQDGSARPVLLLMAEQLAEPFQAQR* |
Ga0134121_113769802 | 3300010401 | Terrestrial Soil | VGRTGLNGRPVPVEQDHSAGPVLLLLAEQLIEPFGASPG* |
Ga0138542_1369541 | 3300011035 | Peatlands Soil | GLDSRPIPVEQDDSAGPGLLLLAGQLIEPFHGRG* |
Ga0137378_106020931 | 3300012210 | Vadose Zone Soil | SRTGLDGRPVPVEQDDPAAPPLRLMAGQLIEPFQARR* |
Ga0126369_107741342 | 3300012971 | Tropical Forest Soil | RDAVAGRTGLDGRPVPVEQDYPAAAPGPLLLAGQLIEPFQARR* |
Ga0126369_134724282 | 3300012971 | Tropical Forest Soil | AVGRTGLDGRPVPVEQDDSAGSALLLLAEQLAEPFQAHG* |
Ga0181523_104897003 | 3300014165 | Bog | RASRVGRTGLDGRPVPVEQGDPAAPPLRLMASQLIEPFQAQR* |
Ga0181531_103770181 | 3300014169 | Bog | RASRVGRTGLDHRPVPVEQDDPAARPLRLMAHQLIEPFQAQR* |
Ga0182036_102283302 | 3300016270 | Soil | DGVGRTGLDGRPVPVEQDAPARLAPLLVAEQLAEPFQAQR |
Ga0182041_108362292 | 3300016294 | Soil | RTGLAGRPVPVEQDHRTRPALVLVAEQLLEPFQARR |
Ga0182041_108939002 | 3300016294 | Soil | DGRPVPVEQDEAAGPVLLLLAEQLIEPFQAARAGGS |
Ga0182033_102695342 | 3300016319 | Soil | GRTGLDGRPVPVEQDAPARLAPLLVAEQLAEPFQAQR |
Ga0182032_110698521 | 3300016357 | Soil | GRTGLDGRPVPVEQDNSAAPVLLLLAEQLIEPFQAQH |
Ga0182032_116328482 | 3300016357 | Soil | DAAGRTGLDGRPVPVEQDNSAGPALVLLASQLAEPFAARRG |
Ga0182037_111913581 | 3300016404 | Soil | SLTRTGLDGRPVPVEQDGSGRPVLLLMAGQLAEPFQAQG |
Ga0187807_12855081 | 3300017926 | Freshwater Sediment | GRTGLDGRPVPVEQDDSAGPALRLLTEQLLEPFRG |
Ga0187808_100998753 | 3300017942 | Freshwater Sediment | VGRTGLDGRPIPVEQDDSTGPALLLIAEQLIEPFQARD |
Ga0187808_101309321 | 3300017942 | Freshwater Sediment | GGAVGRTGLDGRPVPVEQDDSAGPALRLLTEQLLEPFRG |
Ga0187879_104852762 | 3300017946 | Peatland | SARASGVGRTGLDGRPVPVEQDNPAAPPLRLMAGQLIEPFQAQR |
Ga0187785_101757411 | 3300017947 | Tropical Peatland | RTGLDGRPVPVEQDAPARRAPVLVARQLIEPFQAQR |
Ga0187847_101236872 | 3300017948 | Peatland | SGVGRTGLDGRPVPVEQDNPAAPPLRLMAGQLIEPFQAQR |
Ga0187817_108945262 | 3300017955 | Freshwater Sediment | ASIPSRGDAVGRTGLAGRPVPVEQDDSAVPALLLLAEQLIEPFQARG |
Ga0187778_104743171 | 3300017961 | Tropical Peatland | RTGLDGRPVPVEQDGAAGPALRLLAGQLIEPFQARG |
Ga0187783_103426204 | 3300017970 | Tropical Peatland | GRTGLDGRPVPVEQDDSSRFALALLAEQLIEPFQAQR |
Ga0187781_100675841 | 3300017972 | Tropical Peatland | GRTGLEGRPIPVEQDDSAGPVLLLLAGQLMEPFQARD |
Ga0187815_100150043 | 3300018001 | Freshwater Sediment | GRTGLDGRPVPVEQDDSAGPALRLLTDQLLEPFRG |
Ga0187887_102323253 | 3300018043 | Peatland | ASRVGRTGLDGRPVPVEQDDPAARPLRLMACQLIEPFKAQR |
Ga0187772_113840661 | 3300018085 | Tropical Peatland | LSGRPVPVEQADPARPARPAPLLMAEQLIEPFRART |
Ga0210404_104931931 | 3300021088 | Soil | ADSVNRTGLDGRPVPVEQEASAGPALLLVAGQLAEPFRARS |
Ga0210396_112145331 | 3300021180 | Soil | GGAVGRTGLTGRPVPVEQDASSDPVLLLLAEQLIEPFQAAR |
Ga0210385_107566032 | 3300021402 | Soil | AAAGRTGLDGRPVPVEQGDAARPVLLLMAEQLIEPFQAQR |
Ga0210389_102553943 | 3300021404 | Soil | GYVRFPARRAPVGRTGLDGRPVPVEQAARPQPALLLLAHQLAEPFRPQP |
Ga0210387_100289001 | 3300021405 | Soil | FPARRAPVGRTGLDGRPVPVEQAARPQPALLLLAHQLAEPFRPQP |
Ga0210391_106261811 | 3300021433 | Soil | SDAVGRTGLDGRPVPVEQDVAAGPALRLMAGQLIEPFQAQD |
Ga0210390_101886213 | 3300021474 | Soil | AAGRTGLDGRPVPVEQGDAARPVLLLMAEQLIEPFQAQR |
Ga0212123_106064361 | 3300022557 | Iron-Sulfur Acid Spring | ARRDAVGSTGLDGRPVPVEQDDAARPVLLLMAEQLIEPFQAQR |
Ga0222756_10698971 | 3300022709 | Soil | TGLDGRPVPVEQDDPAAPPLRLMAGQLIEPFQAQR |
Ga0208099_10631432 | 3300027096 | Forest Soil | RTGLTGRPVPVEQDASSDPVLLLLAEQLIEPFQAAR |
Ga0208985_11038752 | 3300027528 | Forest Soil | GRTGLDGRPVPVEQDAAAGSALLLMAEQLIEPFQTQR |
Ga0209008_10430601 | 3300027545 | Forest Soil | AGRPVPVEQDACAASALVLMAGQLIEPFTAARPGSGS |
Ga0209116_10266831 | 3300027590 | Forest Soil | RTGLEGRPVPVEQDNPAETPLRLMAGQLIEPFQARR |
Ga0209221_10523201 | 3300027609 | Forest Soil | AVGRTGLDGRPVPVEQDGPARPALLILADQLIEPFQPRG |
Ga0209221_10886101 | 3300027609 | Forest Soil | RGAAVGRTGLDGRPVPVEQDGSAGPALRLLAEQLLEPFQARG |
Ga0209517_100936271 | 3300027854 | Peatlands Soil | RTGLDSRPIPVEQDDPAGPGLLLLAGQLIEPFHGRG |
Ga0209166_102067431 | 3300027857 | Surface Soil | PTRRHPVGRTGLDGRPVPVEQDRSSRPALLLLAGQLAEPFRTHP |
Ga0209167_103269862 | 3300027867 | Surface Soil | VGRTGLDGRPVPVEQGGAAGPALLLLAGQLIEPFQAQG |
Ga0209167_107873772 | 3300027867 | Surface Soil | GQGVGRTGLDGRPVPVEQAESARPAPLLLAEQLIAPFRAQT |
Ga0209590_105735282 | 3300027882 | Vadose Zone Soil | SDAVGRTGLDGRPIPVEQDDSAGLGLLLLGEQLIEPFQARG |
Ga0307313_100485533 | 3300028715 | Soil | PNRTALDGRPVPVEQEAAAGPALLLLAGQLAEPFRARA |
Ga0302234_102524241 | 3300028773 | Palsa | SRPGPTGLDGRPVPVEQDNPAAPPLRLMASQLLEPFQAHRSGG |
Ga0307282_102506851 | 3300028784 | Soil | SVNRTGLDGRPVPVEQEAAAGPALLLLAGQLAEPFRARA |
Ga0302235_104397112 | 3300028877 | Palsa | RASGAGRTGLDGRPVPVEQGNPAAPPLRLMADQLIEPFQARR |
Ga0308309_103668541 | 3300028906 | Soil | VFRSRSDGAGRTGLDGRPIPVEQDDAAAPALLLLAEQLIERFQARG |
Ga0311354_101165861 | 3300030618 | Palsa | ASRVGRTGLDGRPVPVEQDNPAARPLRLMACQLIEPFQAQR |
Ga0318516_102886251 | 3300031543 | Soil | DSLTRTGLDGRPVPVEQDAPARPALLLMAGQLAEPFQAQG |
Ga0318516_103330301 | 3300031543 | Soil | GRTGLDGRPVPVEQDDSAGSALLLLAEQLAEPFQAQS |
Ga0318516_104638712 | 3300031543 | Soil | PARPGPVGRTGLDGRPVPVEQDGSAAPALLLMAEQLTEPFQTQRS |
Ga0318534_105967662 | 3300031544 | Soil | RTGLDGRPIPVEQDDSAGSALLLMAEQLAEPFQAQG |
Ga0318515_101017503 | 3300031572 | Soil | VDGLTRTGLDGRPVPVEQDGSARPVMLLMAGQLAEPFRAQD |
Ga0318515_107135572 | 3300031572 | Soil | AGAVGRTGLDGRPVPVEQDNSAAPVLLLLAEQLIEPFQAQH |
Ga0310915_111989811 | 3300031573 | Soil | VGRTGLDGRPVPVEQDGAARAALLLLAEQLIEPFQAQR |
Ga0318561_102649311 | 3300031679 | Soil | PHGAGLDGRPVPVEQDDTAAPVLLLLAEQLIEPFRAQG |
Ga0318574_100964201 | 3300031680 | Soil | AVGRTGLAGRPVPVEQDNSAGPALALLAEQLIEPFAAPRS |
Ga0318574_100969331 | 3300031680 | Soil | PCRSDSAGRTGLDGRPVPVEQDDSARSVLLLLAEQLIEPFQAQR |
Ga0310686_1073814291 | 3300031708 | Soil | RVGRTGLDGRPVPVEQGDPAAPPLRLMVGQLIEPFQAPR |
Ga0310686_1094277942 | 3300031708 | Soil | AGRTGLDGRPVPVEQGASAAPALLLMAEQLIEPFQPQR |
Ga0310686_1143966021 | 3300031708 | Soil | FPARGARAGRTGLDGRPVPVEQGGQGPALLVMAGQLAEPFQAQR |
Ga0318496_101884922 | 3300031713 | Soil | GRAGAVGRTGLDGRPVPVEQDDTAAPVLLLLAEQLIEPFRAQG |
Ga0307476_107734962 | 3300031715 | Hardwood Forest Soil | AVGRTGLDGRPVPVEQDGPARPALLLVAEQLIEPFQAQG |
Ga0318500_100410732 | 3300031724 | Soil | GVGRTGLDGRPVPVEQDAPARLAPLLVAEQLAEPFQAQR |
Ga0307475_109250102 | 3300031754 | Hardwood Forest Soil | GAGRTGLDGRPVPVEQAAPARLAPLLVAEQLAEPFQAQR |
Ga0318535_100916702 | 3300031764 | Soil | CRSDSAGRTGLDGRPVPVEQDDSARSVLLLLAEQLIEPFQARR |
Ga0318535_104885082 | 3300031764 | Soil | FLRRAGAVGRTGLDGRPVPVEQDNSAAPVLLLLAEQLIEPFQAQH |
Ga0318554_102244391 | 3300031765 | Soil | GRTGLDGRPVPVEQDDSAGSALLLLAEQLAEPFHARGIG |
Ga0318509_103780192 | 3300031768 | Soil | AGTARGDAVGRTGLAGRPVPVEQDNSAGPALALLAEQLIEPFAAPRS |
Ga0318546_102689041 | 3300031771 | Soil | TRTGLDGRPVPVEQDAPARPALLVMAGQLAEPFQAQG |
Ga0318498_100062827 | 3300031778 | Soil | GLDGRPVPVEQDNSAGPALVLLAGQLIEPFAAPKS |
Ga0318566_101144783 | 3300031779 | Soil | GRTGLDGRPVPIEQGSAAAPGPLLLAGQLIEPFQAQR |
Ga0318566_104146982 | 3300031779 | Soil | AGAVGRTGLDGRPVPVEQDDTAAPVLLLLAEQLIEPFRAQG |
Ga0318547_108612002 | 3300031781 | Soil | DGRPVPVEQDDSAAPVLLLVAGQLAEPFQAHRPGGYHS |
Ga0318529_103930211 | 3300031792 | Soil | LARFPVHADAVGRTGLDGRPIPVEQDDSAGSALLLMAEQLAEPFQAQG |
Ga0318576_100398301 | 3300031796 | Soil | RFPARGDAVGRTGLDGRPVPIEQGSAAAPGPLLLAGQLIEPFQAQR |
Ga0318523_102655832 | 3300031798 | Soil | STGTGLDGRPVPVEQDGSAAPALLLLAAQLIEPFQAQR |
Ga0310917_108141121 | 3300031833 | Soil | RTGLDGRPVPVEQDDSAGSALLLLAEQLAEPFQAQS |
Ga0318527_101303321 | 3300031859 | Soil | GRTGLDGRPVPVEQDGAARAALLLLAEQLIEPFQAQR |
Ga0318551_106708462 | 3300031896 | Soil | EGAGRTGLDGRPIPVEQDDSTGPVLLLLAEQLIEPFQARD |
Ga0318520_102862662 | 3300031897 | Soil | ARFPARGDSLTRTGLDGRPVPVEQDGSGRPVLLLMAGQLAEPFQAQG |
Ga0306923_115989222 | 3300031910 | Soil | FTGRSDDVGRTGLEGRPIPVEQDGSAVPALRLLAEQLIEPFQAQR |
Ga0310916_103440731 | 3300031942 | Soil | PSRGDAVGRTGLDGRPVPVEQGSAAAPGPLLLAGQLIEPFQAQR |
Ga0310910_102862621 | 3300031946 | Soil | TGLDGRPVTVEQDHAAAPGPLLLAEQLIEPFQAQR |
Ga0306926_109980542 | 3300031954 | Soil | VGRTGLAGRPVPVEQDNSAGPALALLAEQLIEPFAAPRS |
Ga0306926_127959261 | 3300031954 | Soil | RTGLAGRPVPVEQDDRAAPVLLLIAEQLAEPFQAQRPGGYHS |
Ga0318530_104971382 | 3300031959 | Soil | VGRTGLDGRPVPVEQDDTAAPVLLLLAEQLIEPFRAQR |
Ga0318531_101531393 | 3300031981 | Soil | RGNAVGRTGLDGRPVPVEQGNAATPGPLLLAEQLIEPFQAPR |
Ga0318562_103368261 | 3300032008 | Soil | VGRTGLDGRPVPVEQDAPARLAPLLVAEQLAEPFQAQR |
Ga0318569_105666311 | 3300032010 | Soil | SSDAVGRTGLNGRPVPVEQNDSAAPGPLLLAGQLIEPFQARR |
Ga0310911_101849521 | 3300032035 | Soil | FPARGDAVGRTGLDGRPVPIEQGSAAAPGPLLLAGQLIEPFQAQR |
Ga0318549_103841752 | 3300032041 | Soil | RFPCRSDRAGRTGLHGRPVPVEQDDSARPALLLLLEQLIEPFQAHG |
Ga0318533_107590422 | 3300032059 | Soil | GRTGLDGRPVPVEQDGSAAPALLLLAAQLIEPFQAQR |
Ga0318510_100377581 | 3300032064 | Soil | RGDSLTRTGLDGRPVPVEQDGSGRPVLLLMAGQLAEPFQAQG |
Ga0318524_107272801 | 3300032067 | Soil | ADAVGRTGLDGRPVPVEQDGSAGSALLVLAEQLAEPFQAQR |
Ga0318553_100385404 | 3300032068 | Soil | AMSSSTGRPVPVEQDGSGRPVLLLMAGQLAEPFQAQG |
Ga0306924_111692231 | 3300032076 | Soil | GRTGLEGRPVPVEQHHAAAPGPLLLAEQLIEPFQAQR |
Ga0318525_102684742 | 3300032089 | Soil | GRPSRPVPVEQDGSAGPALLVMAGQLAEPFAARRS |
Ga0318525_106019982 | 3300032089 | Soil | GRTGLDGRPVPVEQNGSAAPGPLLLAGQLIEPFQARG |
Ga0306920_1016977842 | 3300032261 | Soil | GAVGRTGLDGRPVPVEQDDSAGPALLLLAGQLMEPFQAPR |
Ga0335085_119044041 | 3300032770 | Soil | DSLTGTGLDGRLVPVEQDDSARPVLLLMAGQLAEPFQAQR |
Ga0335081_101036121 | 3300032892 | Soil | ARGDSLTRTGLDGRPVPVEQDAPARPALLLMAGQLAEPFQAQG |
Ga0318519_100524041 | 3300033290 | Soil | FPARGDSLTRTGLDGRPVPVEQDAPARPALLLMAGQLAEPFQAQG |
Ga0318519_102072331 | 3300033290 | Soil | VQAGAVGRTGLDGRPVPVEQDNSAAPVLLLLAEQLIEPFQAQH |
⦗Top⦘ |