NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055868

Metagenome / Metatranscriptome Family F055868

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055868
Family Type Metagenome / Metatranscriptome
Number of Sequences 138
Average Sequence Length 37 residues
Representative Sequence MLADIASTQALTFAIPLGVLCVVLLWGFFQRRPTR
Number of Associated Samples 94
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.76 %
% of genes near scaffold ends (potentially truncated) 17.39 %
% of genes from short scaffolds (< 2000 bps) 75.36 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.870 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil
(13.768 % of family members)
Environment Ontology (ENVO) Unclassified
(28.261 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.696 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 47.62%    β-sheet: 0.00%    Coil/Unstructured: 52.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF09678Caa3_CtaG 39.86
PF00115COX1 7.97
PF16640Big_3_5 0.72
PF11255DUF3054 0.72
PF11583AurF 0.72
PF00116COX2 0.72
PF00583Acetyltransf_1 0.72
PF00850Hist_deacetyl 0.72
PF02630SCO1-SenC 0.72
PF06271RDD 0.72
PF00578AhpC-TSA 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG0123Acetoin utilization deacetylase AcuC or a related deacetylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 1.45
COG1225PeroxiredoxinPosttranslational modification, protein turnover, chaperones [O] 0.72
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 0.72
COG1714Uncharacterized membrane protein YckC, RDD familyFunction unknown [S] 0.72
COG1999Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC familyPosttranslational modification, protein turnover, chaperones [O] 0.72
COG4263Nitrous oxide reductaseInorganic ion transport and metabolism [P] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.87 %
UnclassifiedrootN/A39.13 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003368|JGI26340J50214_10071663Not Available920Open in IMG/M
3300005602|Ga0070762_10157724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1362Open in IMG/M
3300005602|Ga0070762_10701821Not Available679Open in IMG/M
3300005712|Ga0070764_11056387Not Available513Open in IMG/M
3300006052|Ga0075029_100646402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix710Open in IMG/M
3300006059|Ga0075017_100428448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria996Open in IMG/M
3300006162|Ga0075030_100364709Not Available1152Open in IMG/M
3300006162|Ga0075030_100408055All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300006162|Ga0075030_101463086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300006176|Ga0070765_101672521Not Available598Open in IMG/M
3300006176|Ga0070765_102071404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK532Open in IMG/M
3300009520|Ga0116214_1017787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2529Open in IMG/M
3300009520|Ga0116214_1221019Not Available716Open in IMG/M
3300009523|Ga0116221_1229685Not Available802Open in IMG/M
3300009640|Ga0116126_1181894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria686Open in IMG/M
3300009698|Ga0116216_10381718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria856Open in IMG/M
3300009700|Ga0116217_10310868Not Available1011Open in IMG/M
3300009700|Ga0116217_10493391Not Available770Open in IMG/M
3300010049|Ga0123356_10062719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-73-93472Open in IMG/M
3300010379|Ga0136449_100119544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5305Open in IMG/M
3300010379|Ga0136449_100204045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3754Open in IMG/M
3300010379|Ga0136449_100307483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2884Open in IMG/M
3300010379|Ga0136449_100579808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix1919Open in IMG/M
3300010379|Ga0136449_102458858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix749Open in IMG/M
3300010379|Ga0136449_103322034Not Available618Open in IMG/M
3300010880|Ga0126350_11582385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1301Open in IMG/M
3300011404|Ga0153951_1036431Not Available850Open in IMG/M
3300014156|Ga0181518_10217114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK986Open in IMG/M
3300014158|Ga0181521_10304972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria815Open in IMG/M
3300014167|Ga0181528_10121226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1419Open in IMG/M
3300014168|Ga0181534_10049404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2073Open in IMG/M
3300014169|Ga0181531_10035705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-73-92876Open in IMG/M
3300014201|Ga0181537_11230702Not Available505Open in IMG/M
3300014489|Ga0182018_10115856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1557Open in IMG/M
3300014489|Ga0182018_10681346Not Available536Open in IMG/M
3300014492|Ga0182013_10067681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-73-92580Open in IMG/M
3300014492|Ga0182013_10314770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria872Open in IMG/M
3300014493|Ga0182016_10232104Not Available1168Open in IMG/M
3300014493|Ga0182016_10498174Not Available705Open in IMG/M
3300014493|Ga0182016_10558027Not Available655Open in IMG/M
3300014493|Ga0182016_10805644Not Available522Open in IMG/M
3300014495|Ga0182015_10446257Not Available831Open in IMG/M
3300014499|Ga0182012_10023761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae5405Open in IMG/M
3300014499|Ga0182012_10062676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae2931Open in IMG/M
3300014499|Ga0182012_10178244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium1508Open in IMG/M
3300014501|Ga0182024_10001548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria59012Open in IMG/M
3300014501|Ga0182024_10003936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria34741Open in IMG/M
3300014501|Ga0182024_10248011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2390Open in IMG/M
3300014501|Ga0182024_10397873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-73-91783Open in IMG/M
3300014501|Ga0182024_10416576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1732Open in IMG/M
3300014501|Ga0182024_11945202Not Available652Open in IMG/M
3300014658|Ga0181519_10567920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria699Open in IMG/M
3300014838|Ga0182030_10055171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae6221Open in IMG/M
3300014838|Ga0182030_10065314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae5497Open in IMG/M
3300014838|Ga0182030_10983061Not Available745Open in IMG/M
3300014838|Ga0182030_11432317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK574Open in IMG/M
3300014838|Ga0182030_11516125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300015206|Ga0167644_1159240Not Available548Open in IMG/M
3300017821|Ga0187812_1044857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1497Open in IMG/M
3300017932|Ga0187814_10221337Not Available714Open in IMG/M
3300017932|Ga0187814_10332678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300017933|Ga0187801_10427969Not Available553Open in IMG/M
3300017946|Ga0187879_10429777Not Available732Open in IMG/M
3300017959|Ga0187779_11040447Not Available570Open in IMG/M
3300017973|Ga0187780_10345238Not Available1051Open in IMG/M
3300018007|Ga0187805_10584396Not Available527Open in IMG/M
3300018016|Ga0187880_1101743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1415Open in IMG/M
3300018034|Ga0187863_10639378Not Available599Open in IMG/M
3300018037|Ga0187883_10371371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae732Open in IMG/M
3300018040|Ga0187862_10441618Not Available791Open in IMG/M
3300018047|Ga0187859_10863515Not Available521Open in IMG/M
3300018085|Ga0187772_10660027Not Available748Open in IMG/M
3300020580|Ga0210403_10179160Not Available1737Open in IMG/M
3300020581|Ga0210399_10008532All Organisms → cellular organisms → Bacteria8008Open in IMG/M
3300020582|Ga0210395_10722176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix745Open in IMG/M
3300020583|Ga0210401_10097127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-73-92768Open in IMG/M
3300021170|Ga0210400_10650844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria868Open in IMG/M
3300021403|Ga0210397_10676847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300021439|Ga0213879_10272521Not Available515Open in IMG/M
3300021474|Ga0210390_10002124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria17903Open in IMG/M
3300021478|Ga0210402_10605367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1016Open in IMG/M
3300022528|Ga0242669_1095641Not Available569Open in IMG/M
3300023090|Ga0224558_1034917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2238Open in IMG/M
3300025625|Ga0208219_1001402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae8520Open in IMG/M
3300025633|Ga0208480_1132148Not Available574Open in IMG/M
3300025679|Ga0207933_1005921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans6550Open in IMG/M
3300026928|Ga0207779_1004597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-73-92029Open in IMG/M
3300027641|Ga0208827_1188597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix553Open in IMG/M
3300027696|Ga0208696_1107841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria922Open in IMG/M
3300027783|Ga0209448_10116027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria897Open in IMG/M
3300027812|Ga0209656_10062112Not Available2063Open in IMG/M
3300027812|Ga0209656_10105904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrithrix → Ferrithrix thermotolerans1471Open in IMG/M
3300027908|Ga0209006_10331417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1293Open in IMG/M
3300027911|Ga0209698_10038887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4276Open in IMG/M
3300027911|Ga0209698_10337998All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300027911|Ga0209698_10353521Not Available1154Open in IMG/M
3300027911|Ga0209698_11408601Not Available507Open in IMG/M
3300028745|Ga0302267_10012449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae7265Open in IMG/M
3300028745|Ga0302267_10259814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK749Open in IMG/M
3300028882|Ga0302154_10359432Not Available706Open in IMG/M
3300028906|Ga0308309_11617010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK551Open in IMG/M
3300029913|Ga0311362_10531299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1078Open in IMG/M
3300029954|Ga0311331_10765116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria878Open in IMG/M
3300029999|Ga0311339_10098556All Organisms → cellular organisms → Bacteria3619Open in IMG/M
3300030707|Ga0310038_10501014Not Available513Open in IMG/M
3300031236|Ga0302324_100471891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1843Open in IMG/M
3300031239|Ga0265328_10345853Not Available579Open in IMG/M
3300031251|Ga0265327_10119255Not Available1252Open in IMG/M
3300031524|Ga0302320_11047595Not Available858Open in IMG/M
3300031543|Ga0318516_10063653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae2033Open in IMG/M
3300031543|Ga0318516_10128010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1451Open in IMG/M
3300031543|Ga0318516_10442268Not Available748Open in IMG/M
3300031640|Ga0318555_10128813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1348Open in IMG/M
3300031640|Ga0318555_10784785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300031670|Ga0307374_10001749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria39765Open in IMG/M
3300031670|Ga0307374_10133706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1992Open in IMG/M
3300031708|Ga0310686_100962724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK630Open in IMG/M
3300031708|Ga0310686_105672189Not Available547Open in IMG/M
3300031708|Ga0310686_119898663Not Available754Open in IMG/M
3300031715|Ga0307476_10305949Not Available1166Open in IMG/M
3300031719|Ga0306917_11453734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300031769|Ga0318526_10140034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria982Open in IMG/M
3300031771|Ga0318546_10099653Not Available1904Open in IMG/M
3300031799|Ga0318565_10300052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M
3300031823|Ga0307478_11701391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK520Open in IMG/M
3300031910|Ga0306923_11183327Not Available818Open in IMG/M
3300032160|Ga0311301_10154796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4127Open in IMG/M
3300032160|Ga0311301_10187899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3586Open in IMG/M
3300032160|Ga0311301_10321885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2452Open in IMG/M
3300032160|Ga0311301_12317850Not Available610Open in IMG/M
3300032955|Ga0335076_11337295Not Available602Open in IMG/M
3300033888|Ga0334792_089900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria867Open in IMG/M
3300034065|Ga0334827_128314Not Available808Open in IMG/M
3300034163|Ga0370515_0129693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1084Open in IMG/M
3300034282|Ga0370492_0006866All Organisms → cellular organisms → Bacteria4610Open in IMG/M
3300034282|Ga0370492_0141882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria982Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil13.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.32%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog10.14%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds6.52%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog5.80%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.07%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost4.35%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.35%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.35%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.62%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.17%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.17%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil2.17%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.17%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa2.17%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.45%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.45%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.45%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.45%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.45%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.72%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.72%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.72%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.72%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.72%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.72%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011404Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ035 MetaGHost-AssociatedOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015206Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300016730Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022528Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025633Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025679Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300026928Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033888Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1EnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26340J50214_1007166323300003368Bog Forest SoilEQEGEHVLASVAGTQALTFAIPLGFFVFVLIWGFFQRRPTR*
Ga0070762_1015772423300005602SoilMMAASDIAATQALTFAIPLGFFAVVLLWGFFQRRSTR*
Ga0070762_1070182123300005602SoilVITASDLAATQALTFAIPNGVLFVVCLWGFFQRRPTKRRSTR*
Ga0070764_1105638723300005712SoilMTIADLAGTQALTFAIPIGTLTAVCLWGFFVRRPTKRRSSQ*
Ga0075029_10064640213300006052WatershedsVITASDVAATQALTFAIPLGVFCVGLLWGFFQRDPPDE
Ga0075017_10042844823300006059WatershedsMITADVAATQALTFAIPIGVLCVVILWGFFQRRPTR*
Ga0075030_10036470923300006162WatershedsMITADVAATQALTFAIPIGVLSVVILWGFFQRRPTR*
Ga0075030_10040805533300006162WatershedsVTIASDMAATQALTIAIPLGTLCVVLLWGFFQRRPTR*
Ga0075030_10146308623300006162WatershedsMITADVATTQALTFAIPIGVLCVVILWGFFQRRPTR*
Ga0070765_10167252123300006176SoilMTIVADVAGTQALTFAIPIGTLFVVSLWGFFVRRP
Ga0070765_10207140423300006176SoilMIANVAATQALTFAIPLGTLFAVLLWGFFQRRPTR*
Ga0116214_101778733300009520Peatlands SoilMASDVAATQALTFAIPLGVFCVVLLWGFFQRRPTR*
Ga0116214_122101923300009520Peatlands SoilASDTAATQALTFAIPLGVFCVVLLWGFFQRRPTK*
Ga0116221_122968523300009523Peatlands SoilAVLRDLRLGGQRVILASDAAATQALTLAIPLGTLCVVLLWGFFQRRPTR*
Ga0116126_118189413300009640PeatlandMLLADIAGVQALTFAIPLGAFCVVLLWGFFQHRST
Ga0116216_1038171823300009698Peatlands SoilMISDVASTQALTFAIPLGVFCVVLLWGFFQRRPTK*
Ga0116217_1031086823300009700Peatlands SoilVITADLAGTQALTLAIPLGVFVVFLLCAFFQRRSTR*
Ga0116217_1049339123300009700Peatlands SoilVLASIAGTQALTFAIPLGFFVFVLIWGFFQRRPTR*
Ga0123356_1006271933300010049Termite GutMTADLASTQALTFAIPVGTLAIVCIWGFFVRRPTKRRSTR*
Ga0136449_10011954463300010379Peatlands SoilMLASASVDGPQVLTFALPLGVFVLVVLWGFFQRRSAR*
Ga0136449_10020404533300010379Peatlands SoilVITADLAGTQALTLAIPLGVFVVFLLWAFFQRRSTR*
Ga0136449_10030748323300010379Peatlands SoilMASDVAATQALTFAIPLGVLCVVLLWGFFQRRPTR*
Ga0136449_10057980833300010379Peatlands SoilMASDAAATQALTFAIPLGVFCVVLLWGFFQRRPTR*
Ga0136449_10245885813300010379Peatlands SoilVITADVAGTQALTFAIPLGVLFVVLLWGFFQRRPVE*
Ga0136449_10332203423300010379Peatlands SoilVRVEGGEPVITASDIAGTQALTFAIPLGFFALVLFWGFFQRRSTR*
Ga0126350_1158238523300010880Boreal Forest SoilMITASDIAGTQALTFAIPLGFFAVALLWGFFQRRSTR*
Ga0153951_103643123300011404Attine Ant Fungus GardensVTTATDLAATQALTFAIPLGTLFLVMLWGFFQRRPTRR*
Ga0181518_1000107753300014156BogMSHSLVGAQVLTFAIPLGTFCVALLLGFFVRQRRL*
Ga0181518_1021711423300014156BogMLLADIAGIQALTFAIPLGTFCVVLLWGFFQRRSTR*
Ga0181521_1030497223300014158BogMLLADIAGVQALTFAIPLGAFCVVLLWGFFQHRSTR*
Ga0181528_1012122623300014167BogMGDVVGTQALTFAIPLGVFVAVCVWGFFQRRPTR*
Ga0181534_1004940423300014168BogMLATYDLFVTQALTFAIPIGAFFAILLWGFFQRRSNQ*
Ga0181531_1003570533300014169BogMVLADIAGVQALTFAIPLGTFLVVLLWGYFQRRSNP*
Ga0181537_1123070223300014201BogMLASDIAGTQALTLAIPLGTLFVVMLWGFFQRRSTR*
Ga0182018_1011585623300014489PalsaMLIADIAGVQALTFAIPLGTFVVVLLWGFFQRRPTR*
Ga0182018_1068134623300014489PalsaMLLADIAGVQALTFAIPLGTLFVVLLWGFFQRRSTR*
Ga0182013_1006768133300014492BogMPLFSDIASTQALTFAIPLGTLFVVLLWGFFQRRSTR*
Ga0182013_1031477023300014492BogMLASDIAGTQALTFAIPLGTFVIVLLWGFFQRRSTQ*
Ga0182016_1023210433300014493BogLMLASDIAGTQALTFAIPLGTFVIVLLWGFFQRRSTQ*
Ga0182016_1049817423300014493BogMMIASDVAGTQALTFAIPIGVLLGVLLWGFFQRQHTR*
Ga0182016_1055802723300014493BogMLIADIAGVQALTFAIPLGTFLVVLLWGFFQRRSTR*
Ga0182016_1080564423300014493BogERGGKLMLASDIAGTQALTLAIPLGTLFVVLLWGFFQRRPTR*
Ga0182015_1044625723300014495PalsaMLASDIAGTQALTLAIPLGTLFVVLLWGFFQRRSTR*
Ga0182012_1002376153300014499BogMLVSDIAGVQALTLAIPLGTFIVVLFVAFFQRRSTR*
Ga0182012_1006267633300014499BogMTADVASTQALTFAIPLGVLFVVLVWGFFQRRPTR*
Ga0182012_1017824423300014499BogMLIADIAGVQALTFAIPLGTLFVVLLWGYFQRRSNP*
Ga0182024_10001548493300014501PermafrostMVLFSDVASTQALTFAIPIGTLVVVLLWGFFQRRPTR*
Ga0182024_10003936373300014501PermafrostVLASIATTQALTFAIPLGFFIFVLILGFFQRRPTR*
Ga0182024_1024801133300014501PermafrostMLASDVAATQALTLAIPLGTLFVVLLWGFFQRRSTR*
Ga0182024_1039787333300014501PermafrostVITADVAATQALTFAIPIGVLCVVILWGFFQRRPTR*
Ga0182024_1041657623300014501PermafrostMLLADIAGVQALTFAIPLGTLCVVLLWGFFQHRSTR*
Ga0182024_1194520223300014501PermafrostMVTADIASTQALTFAIPIGVLFVVSMFLFFQRRPSKRRQTPR*
Ga0181519_1056792013300014658BogMLIADIAGVQALTFAIPLGTFLVVLFVAFFQRRSTR*
Ga0182030_1005517173300014838BogMLLADIAGAQALTFAIPLGTFAVVLLWGFFQRRSTR*
Ga0182030_1006531433300014838BogMPLLSDIASTQALTIAIPLGTLFVVLLWGFFQRRSTR*
Ga0182030_1098306123300014838BogMLADIASTQALTFAIPLGVLCVVLLWGFFQRRPTR*
Ga0182030_1143231713300014838BogMLLADIAGVQALTFAIPLGTFAVVLLWGFFQRRSTR*
Ga0182030_1151612513300014838BogMITADVAATQALTFAIPIGVLCIVILWGFFQRRPTR*
Ga0167644_115924023300015206Glacier Forefield SoilMLLADIAGVQALTFSIPLGTLFVVMLWGFFQRRSTR*
Ga0181515_148246743300016730PeatlandMSHSLVGAQVLTFAIPLGTFCVALLLGFFVRQRRL
Ga0187812_104485723300017821Freshwater SedimentVITASDVAGTQALTFAIPLGVLCVVLLWGFFQRRPIE
Ga0187814_1022133723300017932Freshwater SedimentVITADVAGTQALTFAIPLGVLFVVLLWGFFQRRPIE
Ga0187814_1033267823300017932Freshwater SedimentMIADVAATQALTFAIPLGTFCVMLLWGFFQRRPTR
Ga0187801_1042796923300017933Freshwater SedimentSEQEGAVVITADVAGTQALTFAIPLGVLGLVLLWGFFQRRPNQ
Ga0187879_1042977723300017946PeatlandMLLADIAGVQALTFAIPLGTLFVVLFWGFFQRRSTR
Ga0187779_1104044723300017959Tropical PeatlandVITASDIAGTQALTFAIPLGVLAVVILWGFFQRRP
Ga0187780_1034523813300017973Tropical PeatlandHVILASSAAATQALTFAIPLGTFCVGLLWGFFQRRPTR
Ga0187805_1058439623300018007Freshwater SedimentMIASDVAATQALTFAIPLGTLCVMLLWGFFQRRPTR
Ga0187880_110174323300018016PeatlandMLLADIAGVQALTFAIPLGAFCVVLLWGFFQHRSTR
Ga0187863_1063937823300018034PeatlandMLLADIAGVQALTFAIPLGTLFVVLLWGYFQRRSTR
Ga0187883_1037137113300018037PeatlandVITADIASTQALTFAIPLGVLAVVLLWGFFQRRPTQ
Ga0187862_1044161823300018040PeatlandMLLADIAGIQALTFAIPLGTFCVVLLWGFFQRRSTR
Ga0187859_1086351523300018047PeatlandMLLADLAGVQALTFAIPLGTFCVVLLWGFFQRRSTR
Ga0187772_1066002723300018085Tropical PeatlandMLISDIASTQALTFAIPLGVLCLGLLWGFFQRRPVK
Ga0210403_1017916013300020580SoilRRDEPVITASDLAATQALTFAIPIGTLTAVCLWGFFVRRPTKRRSSQ
Ga0210399_1000853293300020581SoilMTIADLAGTQALTFAIPIGTLTAVCLWGFFVRRPTKRRSSQ
Ga0210395_1072217623300020582SoilMTIVADVAGTQALTFAIPIGTLFVVSLWGFFVRRPNKRRQTR
Ga0210401_1009712733300020583SoilMTIADLAGTQALTFAIPIGTLAVVCLWGFFVRRPTKRRSSQ
Ga0210400_1065084413300021170SoilMTIVADVAGTQALTFAIPIGTLFVVSLWGFFVRRPTKRRQTR
Ga0210397_1067684723300021403SoilMMAASDIAATQALTFAIPLGFFAVVLLWGFFQRRAAR
Ga0213879_1027252123300021439Bulk SoilMSTVVADVAATQALTFAIPLGVFAVVCLWGFFQRRPTKERRQSQ
Ga0210390_10002124133300021474SoilMIVADLAGTQALTFAIPIGTLTVVCLWGFFVRRPTKRRSSQ
Ga0210402_1060536723300021478SoilVITADVASTQALTFAIPLGVLAVVLLWGFFQRRPTQ
Ga0242669_109564113300022528SoilMTIVADVAGTQALTFAIPIGTLLVVSLWGFFVRRPNKRRQTR
Ga0224558_103491743300023090SoilMLASDIAAAQALTFAIPLGTLFVVLLWGFFQHRSTR
Ga0208219_100140223300025625Arctic Peat SoilMMAASDIAATQALTFAIPLGFFAVVLLWGFFQRRSTR
Ga0208480_113214823300025633Arctic Peat SoilMMASDIAATQALTFAIPVGTLALVLLWSFFQRRRPTR
Ga0207933_100592123300025679Arctic Peat SoilMPLLSDIASTQALTFAIPLGTLFVVLLWGFFQRRSTR
Ga0207779_100459733300026928Tropical Forest SoilMIADLAGTQALTFAIPVGTLAVVCIWGFFVRRPTRRRSTR
Ga0208827_118859723300027641Peatlands SoilVITADLAGTQALTLAIPLGVFVVFLLWAFFQRRSTR
Ga0208696_110784123300027696Peatlands SoilMASDVAATQALTFAIPLGVFCVVLLWGFFQRRPTR
Ga0209448_1011602723300027783Bog Forest SoilVITADVAGTQALTFAIPLGVLFVVLLWGFFQRRPVE
Ga0209656_1006211213300027812Bog Forest SoilVLASVAGTQALTFAIPLGFFVFVLIWGFFQRRPTR
Ga0209656_1010590413300027812Bog Forest SoilVIADVAATQALTFAIPLGVLCVVLLWGFFQRRPTR
Ga0209006_1033141723300027908Forest SoilMMAASDIAATQALTFAIPLGFFAVVLMWGFFQRRSTR
Ga0209698_1003888733300027911WatershedsVTIASDMAATQALTFAIPLGTLCVVLLWGFFQRRPTR
Ga0209698_1033799813300027911WatershedsVTIASDMAATQALTIAIPLGTLCVVLLWGFFQRRPT
Ga0209698_1035352123300027911WatershedsMITADVAATQALTFAIPIGVLSVVILWGFFQRRPTR
Ga0209698_1140860123300027911WatershedsMITADVATTQALTFAIPIGVLCVVILWGFFQRRPTR
Ga0302267_1001244933300028745BogMPLFSDIASTQALTFAIPLGTLFVVLLWGFFQRRSTR
Ga0302267_1025981423300028745BogMTADVASTQALTFAIPLGVLFVVLVWGFFQRRPTR
Ga0302154_1035943213300028882BogHIGLEVEPVMTADVASTQALTFAIPLGVLFVVLVWGFFQRRPTR
Ga0308309_1161701023300028906SoilMIANVAATQALTFAIPLGTLFAVLLWGFFQRRPTR
Ga0311362_1053129923300029913BogMLASDIAGTQALTLAIPLGTLFVVLLWGFFQRRSTR
Ga0311331_1076511623300029954BogMLASDIAGTQALTFAIPLGTFVIVLLWGFFQRRSTQ
Ga0311339_1009855653300029999PalsaVITVSDIAGTQALTFAIPLGVLGVVILWGFFQRRPTK
Ga0310038_1050101423300030707Peatlands SoilRGERVITASDTAATQALTFAIPLGVFCVVLLWGFFQRRPTR
Ga0302324_10047189133300031236PalsaMLLADIAGVQALTFAIPLGTLFVVLLWGFFQHRSTR
Ga0265328_1034585323300031239RhizosphereMTADVAATQALTFAIPIGVLCVVMLWGFFQRRPTR
Ga0265327_1011925533300031251RhizosphereMLADIAGTQALTFAIPLGTLAVVLLWGFFERRSTR
Ga0302320_1104759523300031524BogMVLADIAGVQALTFAIPLGTFLVVLLWGYFQRRSNP
Ga0318516_1006365313300031543SoilMIAGLASTQALTFAIPVGTLAVVCIWGFFVRRPTRRRSTR
Ga0318516_1012801023300031543SoilMIADLASTQALTFAIPVGTLAVVCIWGFFVRRPTRRRSTR
Ga0318516_1044226823300031543SoilMIADLASTQALTFAIPVGTLAVVCIWGFFVRRPTKRRSTR
Ga0318555_1012881333300031640SoilRHPMIADLASTQALTFAIPVGTLAVVCIWGFFVRRPTRRRSTR
Ga0318555_1078478513300031640SoilMIADLASTQALTFAIPVGTLAVVCIWGFFVRRPTR
Ga0307374_10001749323300031670SoilMMASDAAATQALTVAIPLGFFVLMLLWGFFQRRPTK
Ga0307374_1013370633300031670SoilVITADVAATQALTFAIPIGVLCIVMLWGFFQRRPTR
Ga0310686_10096272423300031708SoilMVTADIASTQALTFAIPIGVLFVVSMFLFFQRRPSKRRQTPR
Ga0310686_10567218913300031708SoilPTMMAASDIAATQALTFAIPLGFFGVVLLWGFFQRRSTR
Ga0310686_11989866323300031708SoilMSTLADVAATQALTFAIPVGTLAVVCLWGFFQRRPTKSPPTQ
Ga0307476_1030594923300031715Hardwood Forest SoilMTVVADVAGTQALTFAIPIGTLFVVSLWGFFVRRPTKRRQTR
Ga0306917_1145373423300031719SoilMIADLASTQALTFAIPVGTLAVVCIWGFFVRRPARRRSTR
Ga0318526_1014003413300031769SoilMIADLASTQALTFAIPVGTLAVVCIWGFFVRRPTK
Ga0318546_1009965313300031771SoilMIAGLASTQALTVAVPIGTLAVVCIWGFFVRRPTRRRSTR
Ga0318565_1030005223300031799SoilMIADLASTQALTFAIPVGTLAVVCIWGFFVRRPTKRRST
Ga0307478_1170139123300031823Hardwood Forest SoilMTIVADVAGTQALTFAIPIGTLAVVSLWGFFVRRPTKRRQTR
Ga0306923_1118332713300031910SoilLASTQALTFAIPVGTLAVVCIWGFFVRRPTKRRSTR
Ga0311301_1015479633300032160Peatlands SoilMISDVASTQALTFAIPLGVFCVVLLWGFFQRRPTK
Ga0311301_1018789943300032160Peatlands SoilMLASASVDGPQVLTFALPLGVFVLVVLWGFFQRRSAR
Ga0311301_1032188533300032160Peatlands SoilMASDAAATQALTFAIPLGVFCVVLLWGFFQRRPTR
Ga0311301_1231785023300032160Peatlands SoilVRVEGGEPVITASDIAGTQALTFAIPLGFFALVLFWGFFQRRSTR
Ga0335076_1133729523300032955SoilMNTVLADVAATQALTFAIPLGVFAVVCLWGFFQRRPTKSRQSQ
Ga0334792_089900_625_7323300033888SoilMLADIAGTQALTFAIPLGFFSLLLLWGFFQRRSTR
Ga0334827_128314_153_2663300034065SoilMLATYDLFVTQALTFAIPIGAFFAILLWGFFQRRSNQ
Ga0370515_0129693_735_8453300034163Untreated Peat SoilMLLADLAGVQALTFAIPLGTLFVVLLWGFFQHRSTR
Ga0370492_0006866_740_8503300034282Untreated Peat SoilMLLADIAGVQALTFAIPLGTLFVVLLWGYFQRRSNP
Ga0370492_0141882_620_7303300034282Untreated Peat SoilMLLADIAGVQALTFAIPLGTFAVVLLWGFFQRRSTR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.