Basic Information | |
---|---|
Family ID | F055868 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 138 |
Average Sequence Length | 37 residues |
Representative Sequence | MLADIASTQALTFAIPLGVLCVVLLWGFFQRRPTR |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 138 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 86.76 % |
% of genes near scaffold ends (potentially truncated) | 17.39 % |
% of genes from short scaffolds (< 2000 bps) | 75.36 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (60.870 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (13.768 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.261 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.696 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.62% β-sheet: 0.00% Coil/Unstructured: 52.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 138 Family Scaffolds |
---|---|---|
PF09678 | Caa3_CtaG | 39.86 |
PF00115 | COX1 | 7.97 |
PF16640 | Big_3_5 | 0.72 |
PF11255 | DUF3054 | 0.72 |
PF11583 | AurF | 0.72 |
PF00116 | COX2 | 0.72 |
PF00583 | Acetyltransf_1 | 0.72 |
PF00850 | Hist_deacetyl | 0.72 |
PF02630 | SCO1-SenC | 0.72 |
PF06271 | RDD | 0.72 |
PF00578 | AhpC-TSA | 0.72 |
COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
---|---|---|---|
COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.45 |
COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.72 |
COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.72 |
COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.87 % |
Unclassified | root | N/A | 39.13 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003368|JGI26340J50214_10071663 | Not Available | 920 | Open in IMG/M |
3300005602|Ga0070762_10157724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1362 | Open in IMG/M |
3300005602|Ga0070762_10701821 | Not Available | 679 | Open in IMG/M |
3300005712|Ga0070764_11056387 | Not Available | 513 | Open in IMG/M |
3300006052|Ga0075029_100646402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix | 710 | Open in IMG/M |
3300006059|Ga0075017_100428448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 996 | Open in IMG/M |
3300006162|Ga0075030_100364709 | Not Available | 1152 | Open in IMG/M |
3300006162|Ga0075030_100408055 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
3300006162|Ga0075030_101463086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300006176|Ga0070765_101672521 | Not Available | 598 | Open in IMG/M |
3300006176|Ga0070765_102071404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 532 | Open in IMG/M |
3300009520|Ga0116214_1017787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2529 | Open in IMG/M |
3300009520|Ga0116214_1221019 | Not Available | 716 | Open in IMG/M |
3300009523|Ga0116221_1229685 | Not Available | 802 | Open in IMG/M |
3300009640|Ga0116126_1181894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
3300009698|Ga0116216_10381718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 856 | Open in IMG/M |
3300009700|Ga0116217_10310868 | Not Available | 1011 | Open in IMG/M |
3300009700|Ga0116217_10493391 | Not Available | 770 | Open in IMG/M |
3300010049|Ga0123356_10062719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-73-9 | 3472 | Open in IMG/M |
3300010379|Ga0136449_100119544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5305 | Open in IMG/M |
3300010379|Ga0136449_100204045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3754 | Open in IMG/M |
3300010379|Ga0136449_100307483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2884 | Open in IMG/M |
3300010379|Ga0136449_100579808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix | 1919 | Open in IMG/M |
3300010379|Ga0136449_102458858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix | 749 | Open in IMG/M |
3300010379|Ga0136449_103322034 | Not Available | 618 | Open in IMG/M |
3300010880|Ga0126350_11582385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1301 | Open in IMG/M |
3300011404|Ga0153951_1036431 | Not Available | 850 | Open in IMG/M |
3300014156|Ga0181518_10217114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 986 | Open in IMG/M |
3300014158|Ga0181521_10304972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 815 | Open in IMG/M |
3300014167|Ga0181528_10121226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1419 | Open in IMG/M |
3300014168|Ga0181534_10049404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2073 | Open in IMG/M |
3300014169|Ga0181531_10035705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-73-9 | 2876 | Open in IMG/M |
3300014201|Ga0181537_11230702 | Not Available | 505 | Open in IMG/M |
3300014489|Ga0182018_10115856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1557 | Open in IMG/M |
3300014489|Ga0182018_10681346 | Not Available | 536 | Open in IMG/M |
3300014492|Ga0182013_10067681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-73-9 | 2580 | Open in IMG/M |
3300014492|Ga0182013_10314770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 872 | Open in IMG/M |
3300014493|Ga0182016_10232104 | Not Available | 1168 | Open in IMG/M |
3300014493|Ga0182016_10498174 | Not Available | 705 | Open in IMG/M |
3300014493|Ga0182016_10558027 | Not Available | 655 | Open in IMG/M |
3300014493|Ga0182016_10805644 | Not Available | 522 | Open in IMG/M |
3300014495|Ga0182015_10446257 | Not Available | 831 | Open in IMG/M |
3300014499|Ga0182012_10023761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 5405 | Open in IMG/M |
3300014499|Ga0182012_10062676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 2931 | Open in IMG/M |
3300014499|Ga0182012_10178244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1508 | Open in IMG/M |
3300014501|Ga0182024_10001548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 59012 | Open in IMG/M |
3300014501|Ga0182024_10003936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 34741 | Open in IMG/M |
3300014501|Ga0182024_10248011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2390 | Open in IMG/M |
3300014501|Ga0182024_10397873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-73-9 | 1783 | Open in IMG/M |
3300014501|Ga0182024_10416576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1732 | Open in IMG/M |
3300014501|Ga0182024_11945202 | Not Available | 652 | Open in IMG/M |
3300014658|Ga0181519_10567920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
3300014838|Ga0182030_10055171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 6221 | Open in IMG/M |
3300014838|Ga0182030_10065314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 5497 | Open in IMG/M |
3300014838|Ga0182030_10983061 | Not Available | 745 | Open in IMG/M |
3300014838|Ga0182030_11432317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 574 | Open in IMG/M |
3300014838|Ga0182030_11516125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
3300015206|Ga0167644_1159240 | Not Available | 548 | Open in IMG/M |
3300017821|Ga0187812_1044857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1497 | Open in IMG/M |
3300017932|Ga0187814_10221337 | Not Available | 714 | Open in IMG/M |
3300017932|Ga0187814_10332678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
3300017933|Ga0187801_10427969 | Not Available | 553 | Open in IMG/M |
3300017946|Ga0187879_10429777 | Not Available | 732 | Open in IMG/M |
3300017959|Ga0187779_11040447 | Not Available | 570 | Open in IMG/M |
3300017973|Ga0187780_10345238 | Not Available | 1051 | Open in IMG/M |
3300018007|Ga0187805_10584396 | Not Available | 527 | Open in IMG/M |
3300018016|Ga0187880_1101743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1415 | Open in IMG/M |
3300018034|Ga0187863_10639378 | Not Available | 599 | Open in IMG/M |
3300018037|Ga0187883_10371371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 732 | Open in IMG/M |
3300018040|Ga0187862_10441618 | Not Available | 791 | Open in IMG/M |
3300018047|Ga0187859_10863515 | Not Available | 521 | Open in IMG/M |
3300018085|Ga0187772_10660027 | Not Available | 748 | Open in IMG/M |
3300020580|Ga0210403_10179160 | Not Available | 1737 | Open in IMG/M |
3300020581|Ga0210399_10008532 | All Organisms → cellular organisms → Bacteria | 8008 | Open in IMG/M |
3300020582|Ga0210395_10722176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix | 745 | Open in IMG/M |
3300020583|Ga0210401_10097127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-73-9 | 2768 | Open in IMG/M |
3300021170|Ga0210400_10650844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
3300021403|Ga0210397_10676847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
3300021439|Ga0213879_10272521 | Not Available | 515 | Open in IMG/M |
3300021474|Ga0210390_10002124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 17903 | Open in IMG/M |
3300021478|Ga0210402_10605367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1016 | Open in IMG/M |
3300022528|Ga0242669_1095641 | Not Available | 569 | Open in IMG/M |
3300023090|Ga0224558_1034917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2238 | Open in IMG/M |
3300025625|Ga0208219_1001402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 8520 | Open in IMG/M |
3300025633|Ga0208480_1132148 | Not Available | 574 | Open in IMG/M |
3300025679|Ga0207933_1005921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 6550 | Open in IMG/M |
3300026928|Ga0207779_1004597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-73-9 | 2029 | Open in IMG/M |
3300027641|Ga0208827_1188597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix | 553 | Open in IMG/M |
3300027696|Ga0208696_1107841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 922 | Open in IMG/M |
3300027783|Ga0209448_10116027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
3300027812|Ga0209656_10062112 | Not Available | 2063 | Open in IMG/M |
3300027812|Ga0209656_10105904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrithrix → Ferrithrix thermotolerans | 1471 | Open in IMG/M |
3300027908|Ga0209006_10331417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1293 | Open in IMG/M |
3300027911|Ga0209698_10038887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4276 | Open in IMG/M |
3300027911|Ga0209698_10337998 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
3300027911|Ga0209698_10353521 | Not Available | 1154 | Open in IMG/M |
3300027911|Ga0209698_11408601 | Not Available | 507 | Open in IMG/M |
3300028745|Ga0302267_10012449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 7265 | Open in IMG/M |
3300028745|Ga0302267_10259814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 749 | Open in IMG/M |
3300028882|Ga0302154_10359432 | Not Available | 706 | Open in IMG/M |
3300028906|Ga0308309_11617010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 551 | Open in IMG/M |
3300029913|Ga0311362_10531299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1078 | Open in IMG/M |
3300029954|Ga0311331_10765116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 878 | Open in IMG/M |
3300029999|Ga0311339_10098556 | All Organisms → cellular organisms → Bacteria | 3619 | Open in IMG/M |
3300030707|Ga0310038_10501014 | Not Available | 513 | Open in IMG/M |
3300031236|Ga0302324_100471891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1843 | Open in IMG/M |
3300031239|Ga0265328_10345853 | Not Available | 579 | Open in IMG/M |
3300031251|Ga0265327_10119255 | Not Available | 1252 | Open in IMG/M |
3300031524|Ga0302320_11047595 | Not Available | 858 | Open in IMG/M |
3300031543|Ga0318516_10063653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 2033 | Open in IMG/M |
3300031543|Ga0318516_10128010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1451 | Open in IMG/M |
3300031543|Ga0318516_10442268 | Not Available | 748 | Open in IMG/M |
3300031640|Ga0318555_10128813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1348 | Open in IMG/M |
3300031640|Ga0318555_10784785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
3300031670|Ga0307374_10001749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 39765 | Open in IMG/M |
3300031670|Ga0307374_10133706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1992 | Open in IMG/M |
3300031708|Ga0310686_100962724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 630 | Open in IMG/M |
3300031708|Ga0310686_105672189 | Not Available | 547 | Open in IMG/M |
3300031708|Ga0310686_119898663 | Not Available | 754 | Open in IMG/M |
3300031715|Ga0307476_10305949 | Not Available | 1166 | Open in IMG/M |
3300031719|Ga0306917_11453734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
3300031769|Ga0318526_10140034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 982 | Open in IMG/M |
3300031771|Ga0318546_10099653 | Not Available | 1904 | Open in IMG/M |
3300031799|Ga0318565_10300052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 780 | Open in IMG/M |
3300031823|Ga0307478_11701391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 520 | Open in IMG/M |
3300031910|Ga0306923_11183327 | Not Available | 818 | Open in IMG/M |
3300032160|Ga0311301_10154796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4127 | Open in IMG/M |
3300032160|Ga0311301_10187899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3586 | Open in IMG/M |
3300032160|Ga0311301_10321885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2452 | Open in IMG/M |
3300032160|Ga0311301_12317850 | Not Available | 610 | Open in IMG/M |
3300032955|Ga0335076_11337295 | Not Available | 602 | Open in IMG/M |
3300033888|Ga0334792_089900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
3300034065|Ga0334827_128314 | Not Available | 808 | Open in IMG/M |
3300034163|Ga0370515_0129693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1084 | Open in IMG/M |
3300034282|Ga0370492_0006866 | All Organisms → cellular organisms → Bacteria | 4610 | Open in IMG/M |
3300034282|Ga0370492_0141882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 982 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 13.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.32% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 10.14% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.52% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 5.80% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.07% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 4.35% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.35% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.35% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.62% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.17% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.17% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.17% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.17% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 2.17% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.45% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.45% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.45% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.45% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.45% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.72% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.72% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.72% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.72% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.72% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.72% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011404 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ035 MetaG | Host-Associated | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025679 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI26340J50214_100716632 | 3300003368 | Bog Forest Soil | EQEGEHVLASVAGTQALTFAIPLGFFVFVLIWGFFQRRPTR* |
Ga0070762_101577242 | 3300005602 | Soil | MMAASDIAATQALTFAIPLGFFAVVLLWGFFQRRSTR* |
Ga0070762_107018212 | 3300005602 | Soil | VITASDLAATQALTFAIPNGVLFVVCLWGFFQRRPTKRRSTR* |
Ga0070764_110563872 | 3300005712 | Soil | MTIADLAGTQALTFAIPIGTLTAVCLWGFFVRRPTKRRSSQ* |
Ga0075029_1006464021 | 3300006052 | Watersheds | VITASDVAATQALTFAIPLGVFCVGLLWGFFQRDPPDE |
Ga0075017_1004284482 | 3300006059 | Watersheds | MITADVAATQALTFAIPIGVLCVVILWGFFQRRPTR* |
Ga0075030_1003647092 | 3300006162 | Watersheds | MITADVAATQALTFAIPIGVLSVVILWGFFQRRPTR* |
Ga0075030_1004080553 | 3300006162 | Watersheds | VTIASDMAATQALTIAIPLGTLCVVLLWGFFQRRPTR* |
Ga0075030_1014630862 | 3300006162 | Watersheds | MITADVATTQALTFAIPIGVLCVVILWGFFQRRPTR* |
Ga0070765_1016725212 | 3300006176 | Soil | MTIVADVAGTQALTFAIPIGTLFVVSLWGFFVRRP |
Ga0070765_1020714042 | 3300006176 | Soil | MIANVAATQALTFAIPLGTLFAVLLWGFFQRRPTR* |
Ga0116214_10177873 | 3300009520 | Peatlands Soil | MASDVAATQALTFAIPLGVFCVVLLWGFFQRRPTR* |
Ga0116214_12210192 | 3300009520 | Peatlands Soil | ASDTAATQALTFAIPLGVFCVVLLWGFFQRRPTK* |
Ga0116221_12296852 | 3300009523 | Peatlands Soil | AVLRDLRLGGQRVILASDAAATQALTLAIPLGTLCVVLLWGFFQRRPTR* |
Ga0116126_11818941 | 3300009640 | Peatland | MLLADIAGVQALTFAIPLGAFCVVLLWGFFQHRST |
Ga0116216_103817182 | 3300009698 | Peatlands Soil | MISDVASTQALTFAIPLGVFCVVLLWGFFQRRPTK* |
Ga0116217_103108682 | 3300009700 | Peatlands Soil | VITADLAGTQALTLAIPLGVFVVFLLCAFFQRRSTR* |
Ga0116217_104933912 | 3300009700 | Peatlands Soil | VLASIAGTQALTFAIPLGFFVFVLIWGFFQRRPTR* |
Ga0123356_100627193 | 3300010049 | Termite Gut | MTADLASTQALTFAIPVGTLAIVCIWGFFVRRPTKRRSTR* |
Ga0136449_1001195446 | 3300010379 | Peatlands Soil | MLASASVDGPQVLTFALPLGVFVLVVLWGFFQRRSAR* |
Ga0136449_1002040453 | 3300010379 | Peatlands Soil | VITADLAGTQALTLAIPLGVFVVFLLWAFFQRRSTR* |
Ga0136449_1003074832 | 3300010379 | Peatlands Soil | MASDVAATQALTFAIPLGVLCVVLLWGFFQRRPTR* |
Ga0136449_1005798083 | 3300010379 | Peatlands Soil | MASDAAATQALTFAIPLGVFCVVLLWGFFQRRPTR* |
Ga0136449_1024588581 | 3300010379 | Peatlands Soil | VITADVAGTQALTFAIPLGVLFVVLLWGFFQRRPVE* |
Ga0136449_1033220342 | 3300010379 | Peatlands Soil | VRVEGGEPVITASDIAGTQALTFAIPLGFFALVLFWGFFQRRSTR* |
Ga0126350_115823852 | 3300010880 | Boreal Forest Soil | MITASDIAGTQALTFAIPLGFFAVALLWGFFQRRSTR* |
Ga0153951_10364312 | 3300011404 | Attine Ant Fungus Gardens | VTTATDLAATQALTFAIPLGTLFLVMLWGFFQRRPTRR* |
Ga0181518_100010775 | 3300014156 | Bog | MSHSLVGAQVLTFAIPLGTFCVALLLGFFVRQRRL* |
Ga0181518_102171142 | 3300014156 | Bog | MLLADIAGIQALTFAIPLGTFCVVLLWGFFQRRSTR* |
Ga0181521_103049722 | 3300014158 | Bog | MLLADIAGVQALTFAIPLGAFCVVLLWGFFQHRSTR* |
Ga0181528_101212262 | 3300014167 | Bog | MGDVVGTQALTFAIPLGVFVAVCVWGFFQRRPTR* |
Ga0181534_100494042 | 3300014168 | Bog | MLATYDLFVTQALTFAIPIGAFFAILLWGFFQRRSNQ* |
Ga0181531_100357053 | 3300014169 | Bog | MVLADIAGVQALTFAIPLGTFLVVLLWGYFQRRSNP* |
Ga0181537_112307022 | 3300014201 | Bog | MLASDIAGTQALTLAIPLGTLFVVMLWGFFQRRSTR* |
Ga0182018_101158562 | 3300014489 | Palsa | MLIADIAGVQALTFAIPLGTFVVVLLWGFFQRRPTR* |
Ga0182018_106813462 | 3300014489 | Palsa | MLLADIAGVQALTFAIPLGTLFVVLLWGFFQRRSTR* |
Ga0182013_100676813 | 3300014492 | Bog | MPLFSDIASTQALTFAIPLGTLFVVLLWGFFQRRSTR* |
Ga0182013_103147702 | 3300014492 | Bog | MLASDIAGTQALTFAIPLGTFVIVLLWGFFQRRSTQ* |
Ga0182016_102321043 | 3300014493 | Bog | LMLASDIAGTQALTFAIPLGTFVIVLLWGFFQRRSTQ* |
Ga0182016_104981742 | 3300014493 | Bog | MMIASDVAGTQALTFAIPIGVLLGVLLWGFFQRQHTR* |
Ga0182016_105580272 | 3300014493 | Bog | MLIADIAGVQALTFAIPLGTFLVVLLWGFFQRRSTR* |
Ga0182016_108056442 | 3300014493 | Bog | ERGGKLMLASDIAGTQALTLAIPLGTLFVVLLWGFFQRRPTR* |
Ga0182015_104462572 | 3300014495 | Palsa | MLASDIAGTQALTLAIPLGTLFVVLLWGFFQRRSTR* |
Ga0182012_100237615 | 3300014499 | Bog | MLVSDIAGVQALTLAIPLGTFIVVLFVAFFQRRSTR* |
Ga0182012_100626763 | 3300014499 | Bog | MTADVASTQALTFAIPLGVLFVVLVWGFFQRRPTR* |
Ga0182012_101782442 | 3300014499 | Bog | MLIADIAGVQALTFAIPLGTLFVVLLWGYFQRRSNP* |
Ga0182024_1000154849 | 3300014501 | Permafrost | MVLFSDVASTQALTFAIPIGTLVVVLLWGFFQRRPTR* |
Ga0182024_1000393637 | 3300014501 | Permafrost | VLASIATTQALTFAIPLGFFIFVLILGFFQRRPTR* |
Ga0182024_102480113 | 3300014501 | Permafrost | MLASDVAATQALTLAIPLGTLFVVLLWGFFQRRSTR* |
Ga0182024_103978733 | 3300014501 | Permafrost | VITADVAATQALTFAIPIGVLCVVILWGFFQRRPTR* |
Ga0182024_104165762 | 3300014501 | Permafrost | MLLADIAGVQALTFAIPLGTLCVVLLWGFFQHRSTR* |
Ga0182024_119452022 | 3300014501 | Permafrost | MVTADIASTQALTFAIPIGVLFVVSMFLFFQRRPSKRRQTPR* |
Ga0181519_105679201 | 3300014658 | Bog | MLIADIAGVQALTFAIPLGTFLVVLFVAFFQRRSTR* |
Ga0182030_100551717 | 3300014838 | Bog | MLLADIAGAQALTFAIPLGTFAVVLLWGFFQRRSTR* |
Ga0182030_100653143 | 3300014838 | Bog | MPLLSDIASTQALTIAIPLGTLFVVLLWGFFQRRSTR* |
Ga0182030_109830612 | 3300014838 | Bog | MLADIASTQALTFAIPLGVLCVVLLWGFFQRRPTR* |
Ga0182030_114323171 | 3300014838 | Bog | MLLADIAGVQALTFAIPLGTFAVVLLWGFFQRRSTR* |
Ga0182030_115161251 | 3300014838 | Bog | MITADVAATQALTFAIPIGVLCIVILWGFFQRRPTR* |
Ga0167644_11592402 | 3300015206 | Glacier Forefield Soil | MLLADIAGVQALTFSIPLGTLFVVMLWGFFQRRSTR* |
Ga0181515_14824674 | 3300016730 | Peatland | MSHSLVGAQVLTFAIPLGTFCVALLLGFFVRQRRL |
Ga0187812_10448572 | 3300017821 | Freshwater Sediment | VITASDVAGTQALTFAIPLGVLCVVLLWGFFQRRPIE |
Ga0187814_102213372 | 3300017932 | Freshwater Sediment | VITADVAGTQALTFAIPLGVLFVVLLWGFFQRRPIE |
Ga0187814_103326782 | 3300017932 | Freshwater Sediment | MIADVAATQALTFAIPLGTFCVMLLWGFFQRRPTR |
Ga0187801_104279692 | 3300017933 | Freshwater Sediment | SEQEGAVVITADVAGTQALTFAIPLGVLGLVLLWGFFQRRPNQ |
Ga0187879_104297772 | 3300017946 | Peatland | MLLADIAGVQALTFAIPLGTLFVVLFWGFFQRRSTR |
Ga0187779_110404472 | 3300017959 | Tropical Peatland | VITASDIAGTQALTFAIPLGVLAVVILWGFFQRRP |
Ga0187780_103452381 | 3300017973 | Tropical Peatland | HVILASSAAATQALTFAIPLGTFCVGLLWGFFQRRPTR |
Ga0187805_105843962 | 3300018007 | Freshwater Sediment | MIASDVAATQALTFAIPLGTLCVMLLWGFFQRRPTR |
Ga0187880_11017432 | 3300018016 | Peatland | MLLADIAGVQALTFAIPLGAFCVVLLWGFFQHRSTR |
Ga0187863_106393782 | 3300018034 | Peatland | MLLADIAGVQALTFAIPLGTLFVVLLWGYFQRRSTR |
Ga0187883_103713711 | 3300018037 | Peatland | VITADIASTQALTFAIPLGVLAVVLLWGFFQRRPTQ |
Ga0187862_104416182 | 3300018040 | Peatland | MLLADIAGIQALTFAIPLGTFCVVLLWGFFQRRSTR |
Ga0187859_108635152 | 3300018047 | Peatland | MLLADLAGVQALTFAIPLGTFCVVLLWGFFQRRSTR |
Ga0187772_106600272 | 3300018085 | Tropical Peatland | MLISDIASTQALTFAIPLGVLCLGLLWGFFQRRPVK |
Ga0210403_101791601 | 3300020580 | Soil | RRDEPVITASDLAATQALTFAIPIGTLTAVCLWGFFVRRPTKRRSSQ |
Ga0210399_100085329 | 3300020581 | Soil | MTIADLAGTQALTFAIPIGTLTAVCLWGFFVRRPTKRRSSQ |
Ga0210395_107221762 | 3300020582 | Soil | MTIVADVAGTQALTFAIPIGTLFVVSLWGFFVRRPNKRRQTR |
Ga0210401_100971273 | 3300020583 | Soil | MTIADLAGTQALTFAIPIGTLAVVCLWGFFVRRPTKRRSSQ |
Ga0210400_106508441 | 3300021170 | Soil | MTIVADVAGTQALTFAIPIGTLFVVSLWGFFVRRPTKRRQTR |
Ga0210397_106768472 | 3300021403 | Soil | MMAASDIAATQALTFAIPLGFFAVVLLWGFFQRRAAR |
Ga0213879_102725212 | 3300021439 | Bulk Soil | MSTVVADVAATQALTFAIPLGVFAVVCLWGFFQRRPTKERRQSQ |
Ga0210390_1000212413 | 3300021474 | Soil | MIVADLAGTQALTFAIPIGTLTVVCLWGFFVRRPTKRRSSQ |
Ga0210402_106053672 | 3300021478 | Soil | VITADVASTQALTFAIPLGVLAVVLLWGFFQRRPTQ |
Ga0242669_10956411 | 3300022528 | Soil | MTIVADVAGTQALTFAIPIGTLLVVSLWGFFVRRPNKRRQTR |
Ga0224558_10349174 | 3300023090 | Soil | MLASDIAAAQALTFAIPLGTLFVVLLWGFFQHRSTR |
Ga0208219_10014022 | 3300025625 | Arctic Peat Soil | MMAASDIAATQALTFAIPLGFFAVVLLWGFFQRRSTR |
Ga0208480_11321482 | 3300025633 | Arctic Peat Soil | MMASDIAATQALTFAIPVGTLALVLLWSFFQRRRPTR |
Ga0207933_10059212 | 3300025679 | Arctic Peat Soil | MPLLSDIASTQALTFAIPLGTLFVVLLWGFFQRRSTR |
Ga0207779_10045973 | 3300026928 | Tropical Forest Soil | MIADLAGTQALTFAIPVGTLAVVCIWGFFVRRPTRRRSTR |
Ga0208827_11885972 | 3300027641 | Peatlands Soil | VITADLAGTQALTLAIPLGVFVVFLLWAFFQRRSTR |
Ga0208696_11078412 | 3300027696 | Peatlands Soil | MASDVAATQALTFAIPLGVFCVVLLWGFFQRRPTR |
Ga0209448_101160272 | 3300027783 | Bog Forest Soil | VITADVAGTQALTFAIPLGVLFVVLLWGFFQRRPVE |
Ga0209656_100621121 | 3300027812 | Bog Forest Soil | VLASVAGTQALTFAIPLGFFVFVLIWGFFQRRPTR |
Ga0209656_101059041 | 3300027812 | Bog Forest Soil | VIADVAATQALTFAIPLGVLCVVLLWGFFQRRPTR |
Ga0209006_103314172 | 3300027908 | Forest Soil | MMAASDIAATQALTFAIPLGFFAVVLMWGFFQRRSTR |
Ga0209698_100388873 | 3300027911 | Watersheds | VTIASDMAATQALTFAIPLGTLCVVLLWGFFQRRPTR |
Ga0209698_103379981 | 3300027911 | Watersheds | VTIASDMAATQALTIAIPLGTLCVVLLWGFFQRRPT |
Ga0209698_103535212 | 3300027911 | Watersheds | MITADVAATQALTFAIPIGVLSVVILWGFFQRRPTR |
Ga0209698_114086012 | 3300027911 | Watersheds | MITADVATTQALTFAIPIGVLCVVILWGFFQRRPTR |
Ga0302267_100124493 | 3300028745 | Bog | MPLFSDIASTQALTFAIPLGTLFVVLLWGFFQRRSTR |
Ga0302267_102598142 | 3300028745 | Bog | MTADVASTQALTFAIPLGVLFVVLVWGFFQRRPTR |
Ga0302154_103594321 | 3300028882 | Bog | HIGLEVEPVMTADVASTQALTFAIPLGVLFVVLVWGFFQRRPTR |
Ga0308309_116170102 | 3300028906 | Soil | MIANVAATQALTFAIPLGTLFAVLLWGFFQRRPTR |
Ga0311362_105312992 | 3300029913 | Bog | MLASDIAGTQALTLAIPLGTLFVVLLWGFFQRRSTR |
Ga0311331_107651162 | 3300029954 | Bog | MLASDIAGTQALTFAIPLGTFVIVLLWGFFQRRSTQ |
Ga0311339_100985565 | 3300029999 | Palsa | VITVSDIAGTQALTFAIPLGVLGVVILWGFFQRRPTK |
Ga0310038_105010142 | 3300030707 | Peatlands Soil | RGERVITASDTAATQALTFAIPLGVFCVVLLWGFFQRRPTR |
Ga0302324_1004718913 | 3300031236 | Palsa | MLLADIAGVQALTFAIPLGTLFVVLLWGFFQHRSTR |
Ga0265328_103458532 | 3300031239 | Rhizosphere | MTADVAATQALTFAIPIGVLCVVMLWGFFQRRPTR |
Ga0265327_101192553 | 3300031251 | Rhizosphere | MLADIAGTQALTFAIPLGTLAVVLLWGFFERRSTR |
Ga0302320_110475952 | 3300031524 | Bog | MVLADIAGVQALTFAIPLGTFLVVLLWGYFQRRSNP |
Ga0318516_100636531 | 3300031543 | Soil | MIAGLASTQALTFAIPVGTLAVVCIWGFFVRRPTRRRSTR |
Ga0318516_101280102 | 3300031543 | Soil | MIADLASTQALTFAIPVGTLAVVCIWGFFVRRPTRRRSTR |
Ga0318516_104422682 | 3300031543 | Soil | MIADLASTQALTFAIPVGTLAVVCIWGFFVRRPTKRRSTR |
Ga0318555_101288133 | 3300031640 | Soil | RHPMIADLASTQALTFAIPVGTLAVVCIWGFFVRRPTRRRSTR |
Ga0318555_107847851 | 3300031640 | Soil | MIADLASTQALTFAIPVGTLAVVCIWGFFVRRPTR |
Ga0307374_1000174932 | 3300031670 | Soil | MMASDAAATQALTVAIPLGFFVLMLLWGFFQRRPTK |
Ga0307374_101337063 | 3300031670 | Soil | VITADVAATQALTFAIPIGVLCIVMLWGFFQRRPTR |
Ga0310686_1009627242 | 3300031708 | Soil | MVTADIASTQALTFAIPIGVLFVVSMFLFFQRRPSKRRQTPR |
Ga0310686_1056721891 | 3300031708 | Soil | PTMMAASDIAATQALTFAIPLGFFGVVLLWGFFQRRSTR |
Ga0310686_1198986632 | 3300031708 | Soil | MSTLADVAATQALTFAIPVGTLAVVCLWGFFQRRPTKSPPTQ |
Ga0307476_103059492 | 3300031715 | Hardwood Forest Soil | MTVVADVAGTQALTFAIPIGTLFVVSLWGFFVRRPTKRRQTR |
Ga0306917_114537342 | 3300031719 | Soil | MIADLASTQALTFAIPVGTLAVVCIWGFFVRRPARRRSTR |
Ga0318526_101400341 | 3300031769 | Soil | MIADLASTQALTFAIPVGTLAVVCIWGFFVRRPTK |
Ga0318546_100996531 | 3300031771 | Soil | MIAGLASTQALTVAVPIGTLAVVCIWGFFVRRPTRRRSTR |
Ga0318565_103000522 | 3300031799 | Soil | MIADLASTQALTFAIPVGTLAVVCIWGFFVRRPTKRRST |
Ga0307478_117013912 | 3300031823 | Hardwood Forest Soil | MTIVADVAGTQALTFAIPIGTLAVVSLWGFFVRRPTKRRQTR |
Ga0306923_111833271 | 3300031910 | Soil | LASTQALTFAIPVGTLAVVCIWGFFVRRPTKRRSTR |
Ga0311301_101547963 | 3300032160 | Peatlands Soil | MISDVASTQALTFAIPLGVFCVVLLWGFFQRRPTK |
Ga0311301_101878994 | 3300032160 | Peatlands Soil | MLASASVDGPQVLTFALPLGVFVLVVLWGFFQRRSAR |
Ga0311301_103218853 | 3300032160 | Peatlands Soil | MASDAAATQALTFAIPLGVFCVVLLWGFFQRRPTR |
Ga0311301_123178502 | 3300032160 | Peatlands Soil | VRVEGGEPVITASDIAGTQALTFAIPLGFFALVLFWGFFQRRSTR |
Ga0335076_113372952 | 3300032955 | Soil | MNTVLADVAATQALTFAIPLGVFAVVCLWGFFQRRPTKSRQSQ |
Ga0334792_089900_625_732 | 3300033888 | Soil | MLADIAGTQALTFAIPLGFFSLLLLWGFFQRRSTR |
Ga0334827_128314_153_266 | 3300034065 | Soil | MLATYDLFVTQALTFAIPIGAFFAILLWGFFQRRSNQ |
Ga0370515_0129693_735_845 | 3300034163 | Untreated Peat Soil | MLLADLAGVQALTFAIPLGTLFVVLLWGFFQHRSTR |
Ga0370492_0006866_740_850 | 3300034282 | Untreated Peat Soil | MLLADIAGVQALTFAIPLGTLFVVLLWGYFQRRSNP |
Ga0370492_0141882_620_730 | 3300034282 | Untreated Peat Soil | MLLADIAGVQALTFAIPLGTFAVVLLWGFFQRRSTR |
⦗Top⦘ |