Metagenome / Metatranscriptome Family F055844

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F055844
Family Type	Metagenome / Metatranscriptome
Number of Sequences	138
Average Sequence Length	39 residues
Representative Sequence	VYLLSVAGLIACKDANLFEAFSCSWTPSSTFYKLL
Number of Associated Samples	105
Number of Associated Scaffolds	137

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	36.76 %
% of genes near scaffold ends (potentially truncated)	90.58 %
% of genes from short scaffolds (< 2000 bps)	88.41 %
Associated GOLD sequencing projects	99
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (55.797 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.290 % of family members)
Environment Ontology (ENVO)	Unclassified (23.913 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (47.101 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 36.51% β-sheet: 0.00% Coil/Unstructured: 63.49%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.24
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 137 Family Scaffolds
PF02775	TPP_enzyme_C	2.19
PF02826	2-Hacid_dh_C	1.46
PF01471	PG_binding_1	1.46
PF07592	DDE_Tnp_ISAZ013	1.46
PF00296	Bac_luciferase	1.46
PF12681	Glyoxalase_2	1.46
PF00690	Cation_ATPase_N	1.46
PF06056	Terminase_5	1.46
PF12762	DDE_Tnp_IS1595	0.73
PF05199	GMC_oxred_C	0.73
PF13546	DDE_5	0.73
PF13613	HTH_Tnp_4	0.73
PF01381	HTH_3	0.73
PF13414	TPR_11	0.73
PF12204	DUF3598	0.73
PF06925	MGDG_synth	0.73
PF00271	Helicase_C	0.73
PF01814	Hemerythrin	0.73
PF13649	Methyltransf_25	0.73
PF12760	Zn_Tnp_IS1595	0.73
PF02518	HATPase_c	0.73
PF00465	Fe-ADH	0.73
PF01139	RtcB	0.73
PF07690	MFS_1	0.73
PF02416	TatA_B_E	0.73
PF13193	AMP-binding_C	0.73
PF13625	Helicase_C_3	0.73
PF00085	Thioredoxin	0.73
PF00127	Copper-bind	0.73
PF00072	Response_reg	0.73
PF00501	AMP-binding	0.73
PF13561	adh_short_C2	0.73
PF00496	SBP_bac_5	0.73
PF00196	GerE	0.73
PF13847	Methyltransf_31	0.73
PF01979	Amidohydro_1	0.73
PF04075	F420H2_quin_red	0.73
PF00856	SET	0.73
PF01609	DDE_Tnp_1	0.73
PF00903	Glyoxalase	0.73
PF01738	DLH	0.73
PF01522	Polysacc_deac_1	0.73
PF01593	Amino_oxidase	0.73
PF13586	DDE_Tnp_1_2	0.73
PF01656	CbiA	0.73
PF12151	MVL	0.73
PF13565	HTH_32	0.73
PF01751	Toprim	0.73

COG ID	Name	Functional Category	% Frequency in 137 Family Scaffolds
COG0474	Magnesium-transporting ATPase (P-type)	Inorganic ion transport and metabolism [P]	1.46
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	1.46
COG1979	Alcohol dehydrogenase YqhD, Fe-dependent ADH family	Energy production and conversion [C]	0.73
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.73
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.73
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.73
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.73
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.73
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.73
COG2303	Choline dehydrogenase or related flavoprotein	Lipid transport and metabolism [I]	0.73
COG0337	3-dehydroquinate synthetase	Amino acid transport and metabolism [E]	0.73
COG1826	Twin-arginine protein secretion pathway components TatA and TatB	Intracellular trafficking, secretion, and vesicular transport [U]	0.73
COG1690	RNA-splicing ligase RtcB, repairs tRNA damage	Translation, ribosomal structure and biogenesis [J]	0.73
COG1454	Alcohol dehydrogenase, class IV	Energy production and conversion [C]	0.73
COG0726	Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family	Cell wall/membrane/envelope biogenesis [M]	0.73
COG0707	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase	Cell wall/membrane/envelope biogenesis [M]	0.73
COG0371	Glycerol dehydrogenase or related enzyme, iron-containing ADH family	Energy production and conversion [C]	0.73

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
All Organisms	root	All Organisms	44.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
cellular organisms	root	All Organisms → cellular organisms	44.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	43.48 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	7.97 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	3.62 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.90 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	2.90 %
Nitrospinae/Tectomicrobia group	clade	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group	1.45 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	1.45 %
DPANN group	clade	All Organisms → cellular organisms → Archaea → DPANN group	0.72 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4.35 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	2.17 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	2.90 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	2.90 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.45 %
Candidatus Tectomicrobia	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia	1.45 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.45 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.72 %
Candidatus Aenigmarchaeota	phylum	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota	0.72 %
bacterium SCN 62-11	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium SCN 62-11	0.72 %
unclassified Nitrospirae	no rank	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	3.62 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.17 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	2.90 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	2.90 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.45 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	1.45 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.45 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	0.72 %
unclassified Aenigmarchaeota	no rank	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota	0.72 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.72 %
bacterium SCN 62-11	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium SCN 62-11	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.62 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.17 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	2.90 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	1.45 %
Candidatus Aenigmarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon	0.72 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.72 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.72 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	0.72 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	0.72 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.72 %
bacterium SCN 62-11	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium SCN 62-11	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.80 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3.62 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.17 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2.90 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.45 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.72 %
Candidatus Aenigmarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon	0.72 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.72 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	0.72 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	0.72 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.72 %
bacterium SCN 62-11	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium SCN 62-11	0.72 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000559\|F14TC_100310519	Not Available	1570	Open in IMG/M
3300000559\|F14TC_100449525	Not Available	898	Open in IMG/M
3300000955\|JGI1027J12803_104285114	Not Available	580	Open in IMG/M
3300004633\|Ga0066395_10678950	Not Available	610	Open in IMG/M
3300005176\|Ga0066679_10259888	Not Available	1120	Open in IMG/M
3300005181\|Ga0066678_10685788	All Organisms → cellular organisms → Bacteria → Acidobacteria	683	Open in IMG/M
3300005295\|Ga0065707_10329566	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	952	Open in IMG/M
3300005295\|Ga0065707_10688130	Not Available	645	Open in IMG/M
3300005438\|Ga0070701_10392130	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	878	Open in IMG/M
3300005471\|Ga0070698_100568548	Not Available	1073	Open in IMG/M
3300005540\|Ga0066697_10710332	Not Available	550	Open in IMG/M
3300005540\|Ga0066697_10795143	Not Available	514	Open in IMG/M
3300005554\|Ga0066661_10915251	Not Available	513	Open in IMG/M
3300005557\|Ga0066704_10799852	Not Available	586	Open in IMG/M
3300005559\|Ga0066700_10518319	All Organisms → cellular organisms → Bacteria	831	Open in IMG/M
3300005764\|Ga0066903_100228572	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2833	Open in IMG/M
3300005764\|Ga0066903_102496307	All Organisms → cellular organisms → Bacteria	1001	Open in IMG/M
3300005764\|Ga0066903_102563281	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	988	Open in IMG/M
3300005764\|Ga0066903_106303288	All Organisms → cellular organisms → Bacteria	619	Open in IMG/M
3300005764\|Ga0066903_106733082	Not Available	597	Open in IMG/M
3300005764\|Ga0066903_109059260	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300005937\|Ga0081455_10002615	All Organisms → cellular organisms → Bacteria	21337	Open in IMG/M
3300005937\|Ga0081455_10006211	All Organisms → cellular organisms → Bacteria	12878	Open in IMG/M
3300005937\|Ga0081455_10038570	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	4229	Open in IMG/M
3300005981\|Ga0081538_10021306	All Organisms → cellular organisms → Bacteria → Proteobacteria	4736	Open in IMG/M
3300005983\|Ga0081540_1049534	All Organisms → cellular organisms → Bacteria	2095	Open in IMG/M
3300006058\|Ga0075432_10351800	Not Available	624	Open in IMG/M
3300006196\|Ga0075422_10104816	Not Available	1089	Open in IMG/M
3300006797\|Ga0066659_10182715	All Organisms → cellular organisms → Bacteria	1520	Open in IMG/M
3300006797\|Ga0066659_11817515	Not Available	516	Open in IMG/M
3300006806\|Ga0079220_10247877	All Organisms → cellular organisms → Bacteria	1064	Open in IMG/M
3300006845\|Ga0075421_100233005	All Organisms → cellular organisms → Bacteria	2264	Open in IMG/M
3300006845\|Ga0075421_101012462	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	940	Open in IMG/M
3300006845\|Ga0075421_101125611	Not Available	880	Open in IMG/M
3300006847\|Ga0075431_101523256	Not Available	627	Open in IMG/M
3300006854\|Ga0075425_102351076	Not Available	592	Open in IMG/M
3300006880\|Ga0075429_101051178	All Organisms → cellular organisms → Bacteria	711	Open in IMG/M
3300006969\|Ga0075419_10041917	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2864	Open in IMG/M
3300006969\|Ga0075419_10349259	All Organisms → cellular organisms → Bacteria	1005	Open in IMG/M
3300007255\|Ga0099791_10546500	Not Available	564	Open in IMG/M
3300007255\|Ga0099791_10601562	Not Available	538	Open in IMG/M
3300007258\|Ga0099793_10152768	All Organisms → cellular organisms → Bacteria	1094	Open in IMG/M
3300007258\|Ga0099793_10688799	Not Available	515	Open in IMG/M
3300009012\|Ga0066710_100077875	All Organisms → cellular organisms → Bacteria	4302	Open in IMG/M
3300009012\|Ga0066710_103547588	All Organisms → cellular organisms → Bacteria	589	Open in IMG/M
3300009038\|Ga0099829_10110483	Not Available	2151	Open in IMG/M
3300009089\|Ga0099828_10679348	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	925	Open in IMG/M
3300009090\|Ga0099827_10776390	Not Available	829	Open in IMG/M
3300009094\|Ga0111539_11125603	Not Available	912	Open in IMG/M
3300009094\|Ga0111539_11981169	Not Available	675	Open in IMG/M
3300009100\|Ga0075418_12304254	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	587	Open in IMG/M
3300009137\|Ga0066709_102331977	Not Available	732	Open in IMG/M
3300009143\|Ga0099792_10647630	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	678	Open in IMG/M
3300009147\|Ga0114129_10679936	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1325	Open in IMG/M
3300009147\|Ga0114129_10826718	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1179	Open in IMG/M
3300009162\|Ga0075423_12575972	Not Available	556	Open in IMG/M
3300009553\|Ga0105249_10797585	Not Available	1008	Open in IMG/M
3300010043\|Ga0126380_10109500	Not Available	1679	Open in IMG/M
3300010046\|Ga0126384_10791477	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	848	Open in IMG/M
3300010046\|Ga0126384_11512902	Not Available	629	Open in IMG/M
3300010047\|Ga0126382_10436362	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1033	Open in IMG/M
3300010047\|Ga0126382_10464984	All Organisms → cellular organisms → Bacteria	1007	Open in IMG/M
3300010092\|Ga0127468_1032144	Not Available	557	Open in IMG/M
3300010102\|Ga0127453_1025323	Not Available	622	Open in IMG/M
3300010114\|Ga0127460_1006375	Not Available	552	Open in IMG/M
3300010124\|Ga0127498_1040479	Not Available	540	Open in IMG/M
3300010358\|Ga0126370_10141347	All Organisms → cellular organisms → Bacteria	1740	Open in IMG/M
3300010358\|Ga0126370_11361024	Not Available	668	Open in IMG/M
3300010359\|Ga0126376_10486203	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon	1138	Open in IMG/M
3300010360\|Ga0126372_12248209	Not Available	595	Open in IMG/M
3300010360\|Ga0126372_12267468	All Organisms → cellular organisms → Bacteria	593	Open in IMG/M
3300010360\|Ga0126372_13155332	Not Available	512	Open in IMG/M
3300010362\|Ga0126377_12395202	Not Available	604	Open in IMG/M
3300010366\|Ga0126379_12240429	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	647	Open in IMG/M
3300010366\|Ga0126379_13770892	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300010399\|Ga0134127_12710427	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	575	Open in IMG/M
3300011269\|Ga0137392_11164618	Not Available	629	Open in IMG/M
3300012189\|Ga0137388_10864401	Not Available	837	Open in IMG/M
3300012206\|Ga0137380_11338446	Not Available	601	Open in IMG/M
3300012210\|Ga0137378_10377643	All Organisms → cellular organisms → Bacteria	1316	Open in IMG/M
3300012349\|Ga0137387_11042645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	585	Open in IMG/M
3300012350\|Ga0137372_10719043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	722	Open in IMG/M
3300012351\|Ga0137386_11048774	Not Available	578	Open in IMG/M
3300012356\|Ga0137371_10073584	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	2647	Open in IMG/M
3300012359\|Ga0137385_10249368	All Organisms → cellular organisms → Bacteria	1538	Open in IMG/M
3300012361\|Ga0137360_10894222	Not Available	765	Open in IMG/M
3300012361\|Ga0137360_11100815	Not Available	686	Open in IMG/M
3300012363\|Ga0137390_10037318	All Organisms → cellular organisms → Bacteria	4670	Open in IMG/M
3300012363\|Ga0137390_11245550	Not Available	690	Open in IMG/M
3300012371\|Ga0134022_1110271	Not Available	500	Open in IMG/M
3300012373\|Ga0134042_1030272	Not Available	507	Open in IMG/M
3300012375\|Ga0134034_1178466	Not Available	537	Open in IMG/M
3300012387\|Ga0134030_1082463	Not Available	598	Open in IMG/M
3300012513\|Ga0157326_1095653	Not Available	506	Open in IMG/M
3300012917\|Ga0137395_10253314	Not Available	1237	Open in IMG/M
3300012917\|Ga0137395_10253314	Not Available	1237	Open in IMG/M
3300012918\|Ga0137396_11194410	Not Available	537	Open in IMG/M
3300012923\|Ga0137359_10217726	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	1706	Open in IMG/M
3300012930\|Ga0137407_10262860	All Organisms → cellular organisms → Bacteria → Acidobacteria	1567	Open in IMG/M
3300012930\|Ga0137407_10925219	All Organisms → cellular organisms → Bacteria	825	Open in IMG/M
3300012948\|Ga0126375_10279173	All Organisms → cellular organisms → Bacteria	1148	Open in IMG/M
3300012971\|Ga0126369_12736001	Not Available	577	Open in IMG/M
3300012989\|Ga0164305_10776903	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	792	Open in IMG/M
3300014968\|Ga0157379_11725367	All Organisms → cellular organisms → Bacteria	614	Open in IMG/M
3300015264\|Ga0137403_10611177	All Organisms → cellular organisms → Bacteria	955	Open in IMG/M
3300015371\|Ga0132258_10294605	All Organisms → cellular organisms → Bacteria	3988	Open in IMG/M
3300015371\|Ga0132258_12710955	Not Available	1236	Open in IMG/M
3300016319\|Ga0182033_10311277	Not Available	1303	Open in IMG/M
3300016319\|Ga0182033_11212444	Not Available	676	Open in IMG/M
3300017997\|Ga0184610_1257925	All Organisms → cellular organisms → Bacteria	579	Open in IMG/M
3300018468\|Ga0066662_12600695	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	535	Open in IMG/M
3300019259\|Ga0184646_1600641	Not Available	542	Open in IMG/M
3300025918\|Ga0207662_11256947	All Organisms → cellular organisms → Bacteria	526	Open in IMG/M
3300025922\|Ga0207646_10565009	All Organisms → cellular organisms → Bacteria	1022	Open in IMG/M
3300025961\|Ga0207712_11077006	Not Available	715	Open in IMG/M
3300026088\|Ga0207641_10345204	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1417	Open in IMG/M
3300026296\|Ga0209235_1169039	Not Available	829	Open in IMG/M
3300026318\|Ga0209471_1336423	Not Available	500	Open in IMG/M
3300026550\|Ga0209474_10609902	Not Available	559	Open in IMG/M
3300027577\|Ga0209874_1060586	All Organisms → cellular organisms → Bacteria	961	Open in IMG/M
3300027874\|Ga0209465_10392665	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	694	Open in IMG/M
3300027880\|Ga0209481_10219541	Not Available	952	Open in IMG/M
3300027909\|Ga0209382_10224688	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium SCN 62-11	2141	Open in IMG/M
3300028608\|Ga0247819_10667068	Not Available	632	Open in IMG/M
3300030829\|Ga0308203_1096288	Not Available	503	Open in IMG/M
3300030902\|Ga0308202_1093243	Not Available	613	Open in IMG/M
3300030989\|Ga0308196_1030589	Not Available	675	Open in IMG/M
3300031091\|Ga0308201_10236463	Not Available	622	Open in IMG/M
3300031093\|Ga0308197_10355326	Not Available	559	Open in IMG/M
3300031740\|Ga0307468_100828942	Not Available	793	Open in IMG/M
3300031890\|Ga0306925_11072778	Not Available	816	Open in IMG/M
3300031908\|Ga0310900_11877392	Not Available	511	Open in IMG/M
3300031947\|Ga0310909_10631002	Not Available	894	Open in IMG/M
3300032075\|Ga0310890_10395646	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	1024	Open in IMG/M
3300033551\|Ga0247830_10750152	Not Available	776	Open in IMG/M
3300034644\|Ga0370548_142182	Not Available	514	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	77.54%
Host-Associated	Host-Associated	22.46%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	76.09%
Plants	Host-Associated → Plants	22.46%
Aquatic	Environmental → Aquatic	1.45%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	76.09%
Rhizosphere	Host-Associated → Plants → Rhizosphere	15.22%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.52%
Freshwater	Environmental → Aquatic → Freshwater	0.72%
Sediment	Environmental → Aquatic → Sediment	0.72%
Roots	Host-Associated → Plants → Roots	0.72%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	65.22%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	15.22%
Loam	Environmental → Terrestrial → Soil → Loam	10.14%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.07%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.45%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.72%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.72%
Sand	Environmental → Terrestrial → Soil → Sand	0.72%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.72%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	45.65%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	15.22%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	12.32%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.80%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.07%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.62%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.90%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.90%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.45%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.45%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.72%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.72%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.72%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.72%
Unclassified	Host-Associated → Plants → Roots → Rhizosphere → Unclassified	0.72%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	20.29%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	13.04%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	12.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	8.70%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	5.80%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	5.80%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.07%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.62%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	3.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.90%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.17%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.17%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	1.45%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.45%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.45%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.45%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.72%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.72%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.72%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.72%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.72%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.72%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.72%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.72%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.72%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Host-Associated	Open in IMG/M
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010092	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010102	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010114	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010124	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012371	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012373	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012375	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012387	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Host-Associated	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300017997	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300019259	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026296	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026318	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300027577	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028608	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6	Environmental	Open in IMG/M
3300030829	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030902	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030989	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031091	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031093	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M
3300034644	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F14TC_1003105194	3300000559	Soil	GGAVYLLSAAERIACKDASLFEAFSCPWTPPLTFYKLR*
F14TC_1004495252	3300000559	Soil	LSGAGLITCKDVGPFEAFSCPWPPSPTFYKLREIERGLFTKLATS*
JGI1027J12803_1042851141	3300000955	Soil	MCLLSMVGFIACKDASFCHAFLCSWTPPSMFYKLLEIE
Ga0066395_106789501	3300004633	Tropical Forest Soil	VSVLSGAWLIACKDVGLFEAFSCPWTPPATFYTLLYIERL*
Ga0066679_102598881	3300005176	Soil	DHLLSISEPIACKDANLFEDFSCPWPPSWTFYKLLEIERVG*
Ga0066678_106857882	3300005181	Soil	KHGKLLAVAGLIACKDASLFEALVPLDPTFDTLREMERAQ*
Ga0065707_103295663	3300005295	Switchgrass Rhizosphere	VYCLSRAGLIVCKDAGLFEASSCPWPLSPTFYKLLEIERIM
Ga0065707_106881303	3300005295	Switchgrass Rhizosphere	DHLLSISEPIACKDAHLFEAFSCLWTPPSTFYILLEIECLG*
Ga0070701_103921302	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	VYLLSVAELIACKDANLFEAFSCSWTPSSTFYKLREIERQL*
Ga0070698_1005685481	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	RIKSGGGAVYCLAVAGRSACKDVSRFDAFSCPLTPSSTFYKLL*
Ga0066697_107103322	3300005540	Soil	YFLSGAGLIACTDVGLCEAFSGPWPPSPTFDTLAG*
Ga0066697_107951431	3300005540	Soil	VYFLSIAGFIACKDASPFEAFSCPSTLSSTFYKLLEIER
Ga0066661_109152512	3300005554	Soil	VKSGGGAAYLLAVAGLIACKDASLFDAFSCSWIPSSTFYKLL*
Ga0066704_107998521	3300005557	Soil	VYFLSIAGFIACKDASPFEAFSCPSTLSSTFYKRLEIERPAFAPFHI
Ga0066700_105183191	3300005559	Soil	AVYLLAVAGLIACKDASLFEAFSGPWTPSSTFYKLL*
Ga0066903_1002285721	3300005764	Tropical Forest Soil	ADHLLSIAEPIACKDANPFEGFSCPWPPFSTFYKLL*
Ga0066903_1024963071	3300005764	Tropical Forest Soil	YFLSGAGHIACKDVGVFEATSCLWPLCPAFYKLLEIERHDLETATV*
Ga0066903_1025632811	3300005764	Tropical Forest Soil	VVSLLAVGGLIACKDISLFDAFSYPWPPSSTFYKLL
Ga0066903_1063032881	3300005764	Tropical Forest Soil	AGYFLSGAGLIACKDVSLFEVFSCLWTPSSAFYKLL*
Ga0066903_1067330821	3300005764	Tropical Forest Soil	AAYYLTVTGLIACKDVRLFEASSCLLTLPSTFYKLLEIERLK*
Ga0066903_1090592602	3300005764	Tropical Forest Soil	VYLLSVAGLIACKDVSLFEAFSCPWTPSSSFYKLREIERPK*
Ga0081455_100026153	3300005937	Tabebuia Heterophylla Rhizosphere	VYLLAAAGLIACKDVSLFETFSRPWPPSSTFYKLLEIER*
Ga0081455_100062119	3300005937	Tabebuia Heterophylla Rhizosphere	RVKSGGGAVYFFSSTGLIAYKDVGIFEAFSCPLPSSPTFYKPL*
Ga0081455_100385701	3300005937	Tabebuia Heterophylla Rhizosphere	DSVNLLSVAGLIACKDVSLFEAFSCPWTLPLTFYKLLEIERTV*
Ga0081455_102835373	3300005937	Tabebuia Heterophylla Rhizosphere	GGVASLRAVTGLIACTAVRLFDTSSCPWTPPSTFAKLL*
Ga0081538_100213061	3300005981	Tabebuia Heterophylla Rhizosphere	VVYLLSVAGLIACKDASLFEAFAGLWPPSSPFYKLR*
Ga0081540_10495345	3300005983	Tabebuia Heterophylla Rhizosphere	GGAVYLLIVAGLIACNDASLFDAFSCLWTPPATFYKLL*
Ga0075432_103518002	3300006058	Populus Rhizosphere	VYFFSSAGLIACKDVGFFEAFSCPWTPSPTFYKLL*
Ga0075422_101048161	3300006196	Populus Rhizosphere	VYLLSVAGPIACKDVSLFDTFSCSWTPPSTFYKLAG*
Ga0066659_101827151	3300006797	Soil	VYFLSVAGLIACKDASRSEAFSCLWTPPLTFYKLL
Ga0066659_118175151	3300006797	Soil	GAASLLAVAGRIACKDARLFEVFSYPWRPSSTFYKLL*
Ga0079220_102478774	3300006806	Agricultural Soil	MAGLIACKDVSLFHGFLCSWRLSSMFYKLPEIKRYPL
Ga0075421_1002330054	3300006845	Populus Rhizosphere	VYLLTVAGLIACKDARLFEAFSYPWPPSPTFYKLL*
Ga0075421_1010124621	3300006845	Populus Rhizosphere	HLLSISEPIACKDANLFEAFSCSWTPSATFYKLL*
Ga0075421_1011256111	3300006845	Populus Rhizosphere	VYFFSSAGRIVCKDVGLFEGFSCPWSPSPTFYKLAG*
Ga0075431_1015232562	3300006847	Populus Rhizosphere	ADHLLSISEPIACKDVNLFEAFSCPWTPPSTFYKLLEIERPY*
Ga0075425_1023510763	3300006854	Populus Rhizosphere	YLLAGAGRIACKDARFFKAFSWLWPQSSTFYKLL*
Ga0075429_1010511782	3300006880	Populus Rhizosphere	VYLLSVAGLIACKDANLFEAFSCSWTPSSTFYKLL*
Ga0075419_100419175	3300006969	Populus Rhizosphere	VYLLSVAGLIACKDANLFEAFSCSWTLSATFDKLLEIERWDLGFRVLIPPLRRF
Ga0075419_103492592	3300006969	Populus Rhizosphere	VYLLTVTGLIACKDTHLFDASSYPLTPPSTFYKLLEIERSGSAL
Ga0099791_105465001	3300007255	Vadose Zone Soil	SGGGAASLLAVAGLIACNDVSLVDGFSCSYTPLSIFYKLL*
Ga0099791_106015621	3300007255	Vadose Zone Soil	SRVKSGGGAVYLLSGAGLIACKDVRLLAALSCPCPPPSTFYKLL*
Ga0099793_101527681	3300007258	Vadose Zone Soil	GGAVYFLSGAGLIACKDVGLCEAFACPWPPSPTFYKLL*
Ga0099793_106887991	3300007258	Vadose Zone Soil	GAVYLLAVAGLIACKDASLFEAFSGPWTPSSTFYKLL*
Ga0066710_1000778751	3300009012	Grasslands Soil	GAAYLLAVAGLIACKDASLFKTFSCPWPPSSIFYKLL
Ga0066710_1035475881	3300009012	Grasslands Soil	KSGEGVASLLSMAGRIACKDASLFDAFSCPWTPLSTFDKLL
Ga0099829_101104831	3300009038	Vadose Zone Soil	YLLSVAGLIACKDASLFEAFLCPWTPPSTCYKLL*
Ga0099828_106793481	3300009089	Vadose Zone Soil	GAAYLFSVAGRIACKDASLFDAFSGPWTSSSTFYKLL*
Ga0099827_107763901	3300009090	Vadose Zone Soil	AASLLAVAGLIACNDVSLVDGFSCSYTPLSIFYNLL*
Ga0111539_111256031	3300009094	Populus Rhizosphere	GAVYWFSSAGLIACKAVGLFETFSCPWSPSPTFYKLL*
Ga0111539_119811691	3300009094	Populus Rhizosphere	VYLLSVAGLIACKDANLFEAFSCSWTLSATFDKLLEIERWDLGFRVL
Ga0075418_123042542	3300009100	Populus Rhizosphere	AVYLLAAAGLIACKDASLFDAFSGSWAPSSTFYKLL*
Ga0066709_1023319772	3300009137	Grasslands Soil	GGAAYLLAVAELSVYKDASLFEAFSCLWPAPSTFYKQL*
Ga0099792_106476303	3300009143	Vadose Zone Soil	FGGGAAYLLAVAGLSACKDTSLFEAFSCLWTLSSIFYKLL*
Ga0114129_106799361	3300009147	Populus Rhizosphere	GAAYLLSVVGLIACQNASLFEALWCPWTSSSTFYKLR*
Ga0114129_108267181	3300009147	Populus Rhizosphere	HLLSISEPIACKDANLFEAFSCSWPPSSAFYNLL*
Ga0075423_125759722	3300009162	Populus Rhizosphere	LLSISEPIACKDVNLFEAFSCPWTPPSTFYKLLEIERPY*
Ga0105249_107975851	3300009553	Switchgrass Rhizosphere	LLSIAGLIACNGASLFEAFSCSWTPSLTFYKLAG*
Ga0126380_101095002	3300010043	Tropical Forest Soil	GGGAGYFLSVAGFIACKDVSLFEAFSYLWTPSSTFYKLL*
Ga0126384_107914772	3300010046	Tropical Forest Soil	MVYFLSMAGFIACQDASPFEAFSCPSTPSSTFYKLL
Ga0126384_115129022	3300010046	Tropical Forest Soil	LSISEPIACKDVNPFKAFSCPWLPFSSFYKLVEIERTKLHT*
Ga0126382_104363622	3300010047	Tropical Forest Soil	AVYLHAVVELIACNDASLFDAFSCLWTPPSTFYKLR*
Ga0126382_104649842	3300010047	Tropical Forest Soil	SLLAIAERITCKDASLFEAFSCPWPPSATFDPLLEIER*
Ga0127468_10321441	3300010092	Grasslands Soil	VYFFSSAGLIACKDVGLFEAFSCPWTPSPTFYKLLEIERPRL
Ga0127453_10253231	3300010102	Grasslands Soil	VYFFSSAGLIACKDVGLFEAFSCPWTPSPTFYKLLEIERP
Ga0127460_10063751	3300010114	Grasslands Soil	VYFFSSAGLIACKDVGLFEAFSCPWTPSPTFYKLLEIERHR
Ga0127498_10404792	3300010124	Grasslands Soil	VYFFSSAGLIVCKDVGFFEAFSCPWTPSPTCYKLLEIERP
Ga0126370_101413475	3300010358	Tropical Forest Soil	GAGYFLSGAGLIACKDVSLFEVFSCLWTPSSAFYKLL*
Ga0126370_113610241	3300010358	Tropical Forest Soil	VYFFSSAGRIACKDVGLVEAFSGPWRLSPTCYKLREIERMG
Ga0126376_104862032	3300010359	Tropical Forest Soil	VISVVGLVACKDARLFKVFSCSEPPSATFYKLLEIERYI*
Ga0126372_122482091	3300010360	Tropical Forest Soil	KSGAGAVYLHAVVELIACNDASLFDAFSCLWTPPSTFYKLR*
Ga0126372_122674681	3300010360	Tropical Forest Soil	VFCLSGAGLIACKDVDLFEAFSCPWPPSSTFYKLR
Ga0126372_128910402	3300010360	Tropical Forest Soil	VYLLTGAGRIACKDARLFKAFSWLWPHSSTFYKLIYIDRLCSME
Ga0126372_131553322	3300010360	Tropical Forest Soil	VNLLSVVGLIACKDANLFEAFSCSWTRPATFYKLLG
Ga0126377_123952021	3300010362	Tropical Forest Soil	GAAYLLAVAGLIACKDVGLFDAFSCSWTPSSTFYKCREIERALFGA*
Ga0126379_122404291	3300010366	Tropical Forest Soil	VASLLSMAGLIACKDASLFHTFLCSRPPPSMFYKLLEIERS
Ga0126379_137708921	3300010366	Tropical Forest Soil	LSVVGLIAYKDANLFEAFSCSWTRSATFYKLLEIEREPFGSTRY*
Ga0134127_127104272	3300010399	Terrestrial Soil	YLLSVAELIACKDANLFEAFSCSWTPSSTFYKLREIERQL*
Ga0137392_111646181	3300011269	Vadose Zone Soil	AYLLSVAGRIASKDASLFEALSCPWTPPATFYKLL*
Ga0137388_108644011	3300012189	Vadose Zone Soil	GTAYLLSVAGLIACKDASLFEAFLCPWTPPSTCYKLL*
Ga0137380_113384461	3300012206	Vadose Zone Soil	YLLSVAGLIACKDASLFEAFSCPWTPPLTFYKLL*
Ga0137378_103776431	3300012210	Vadose Zone Soil	AYLLAVAGLSACKDTSLFEAFSCLWTLSSIFYKLL*
Ga0137387_110426452	3300012349	Vadose Zone Soil	DGGAAYLLAVAGLIGCKDASLFDAFSCPWTPPLTFYKLL*
Ga0137372_107190431	3300012350	Vadose Zone Soil	SGGGAAYLLSDTEPIACKDVRLLDAFSYLCTPLSTFYKLAG*
Ga0137386_110487741	3300012351	Vadose Zone Soil	VYLLSAAERIACTDASLFGAFSCPWAPLSTFYKLLYIERCSLPML
Ga0137371_100735841	3300012356	Vadose Zone Soil	GAVYLLSVAGLIACKDANLFEAFSCSWTPSSTFYKLL*
Ga0137385_102493681	3300012359	Vadose Zone Soil	KSGGGAVYFLAGAGLIACTDVGLCEAFACLWPPSPTFYKLL*
Ga0137360_108942221	3300012361	Vadose Zone Soil	AAYLLAVIGLIACKDARLFDASSRPWTPPSPFYKLL*
Ga0137360_111008152	3300012361	Vadose Zone Soil	VKPGEGAASLLAVTGLIACKDASFVEAFSCSWTPPSTFYTLL*
Ga0137390_100373181	3300012363	Vadose Zone Soil	AYFLSVAGLIACKDASLFDAFSCPWPPPSTFYKLR*
Ga0137390_112455501	3300012363	Vadose Zone Soil	KSGGGAAYLFSVAGRIACKDASLFDAFSGPWTSSSTFYKL*
Ga0134022_11102712	3300012371	Grasslands Soil	VYFFSSAGLIACKDVGLFEAFSCPWTPSPTFYKLLEI
Ga0134042_10302721	3300012373	Grasslands Soil	VYFFSSAGLIACKDVGFFEAFSCPWTPSPTCYKLLEIERP
Ga0134034_11784661	3300012375	Grasslands Soil	VYFFSSAGLIACKDVGLFEAFSCPWTPSPTFYKLL
Ga0134030_10824633	3300012387	Grasslands Soil	AYLLAVAGLIACKDVGLFDAFSCPWTPLSTFYKLL*
Ga0157326_10956532	3300012513	Arabidopsis Rhizosphere	RVKSGGGAVYLLSVAGLIAYKDANLFEAFSCSWTLSATFYKLL*
Ga0137395_102533141	3300012917	Vadose Zone Soil	RVQSGGGAASLLAVAGLIACNDVSLVDGFSCSYTPLSIFYNLL*
Ga0137395_102533143	3300012917	Vadose Zone Soil	GGGAASLLAVAGLIACNDVSLVDAFSCSYTPLSIFYNLL*
Ga0137396_111944101	3300012918	Vadose Zone Soil	AYLLSVAGRIASKDASLFEALSCPWTPPATFDKLL*
Ga0137359_102177261	3300012923	Vadose Zone Soil	GAAYLFSVAGRIACKDASLFDAFSGPWTSSSTFYTLL*
Ga0137407_102628602	3300012930	Vadose Zone Soil	AVYLFSVAVRIAGKDASLFDAFSGPWTSSSTFDTLL*
Ga0137407_109252191	3300012930	Vadose Zone Soil	SGGAAYLLSVTGLIACKDARLFEASSCPLTPPSTFYKLL*
Ga0126375_102791731	3300012948	Tropical Forest Soil	VYYLSGTGLIVCKDAGVIEAFSCPWSPSSTFYKLLEIE
Ga0126369_127360011	3300012971	Tropical Forest Soil	KSGGGAACILSVARLIACKDASLFNAFSCPWTPPSTFYNG*
Ga0164305_107769032	3300012989	Soil	AVYLLSVAGLIACKDANLFEAFSCSWTPSSTFYKLL*
Ga0157379_117253671	3300014968	Switchgrass Rhizosphere	YLLSVARLIACKDANLFEAFSCSWTPSSIFYKLR*
Ga0137403_106111771	3300015264	Vadose Zone Soil	SGGAAYLLTITGLIACKDAHLFDASSCPLTSPSTFYKLL*
Ga0132258_102946054	3300015371	Arabidopsis Rhizosphere	MCPFSVAGLIACKDARLFNAFTCPWTSPSTFYKLLEIERS*
Ga0132258_127109551	3300015371	Arabidopsis Rhizosphere	RVKSGGGAVYLLSVAGLIACKDANLFEAFSCSWTPSSTFYKLL*
Ga0182033_103112771	3300016319	Soil	SLLAVAGLIAYKDASLFEAFSCLWPPSATLYTLREIERGEFGV
Ga0182033_112124442	3300016319	Soil	VYYLSGAGLIVCKDVGVIEAFSCPWSPSSTFYKLLEIDR
Ga0184610_12579252	3300017997	Groundwater Sediment	AYLLSVAGLIACKDASLFEAFSCPWTPPLTFYKLL
Ga0066662_126006951	3300018468	Grasslands Soil	GGGAVYLLSVAGRIACKDANIFEAFSYSWTPSSTFYKLREIERQL
Ga0184646_16006411	3300019259	Groundwater Sediment	VYFFSNAGLIACKDVGFCEAFSCPWTPSPTFYKLLKIERPRLA
Ga0207662_112569471	3300025918	Switchgrass Rhizosphere	VKSGGGTVYLLSVAGLIAYKDTNLFEVFSCLWTLSSAFYKLR
Ga0207646_105650092	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	GGAVYLLSVAGLIACKDASLFDAFSCPWTSSSTFYKLL
Ga0207712_110770061	3300025961	Switchgrass Rhizosphere	GAVYLLSVAGLIACKDANLFEAFSCSWTLSATFYKLL
Ga0207641_103452041	3300026088	Switchgrass Rhizosphere	VYLLSVAELIACKDANLFEAFSCSWTPSSTFYKLREI
Ga0209235_11690392	3300026296	Grasslands Soil	GGAVYFLSGAGLIACKDVGLCEAFACLWPPSPTFYKLL
Ga0209471_13364231	3300026318	Soil	GGGAACLLSVARLTACKDASRFEALSCPWILPSPFYKLL
Ga0209474_106099021	3300026550	Soil	VYLLAVAGLIACKDASLFEAFSCPWTPSSTFYKLLEIERLL
Ga0209874_10605862	3300027577	Groundwater Sand	VYLLSVAGLIACKDANLFEAFSCSWTPSSTFYKLL
Ga0209465_103926652	3300027874	Tropical Forest Soil	VASLLSMAGLIACKDASLFHTFLCSRPPPSMFYKLLEIERRCFLV
Ga0209481_102195411	3300027880	Populus Rhizosphere	VYLLSVAGLIACKDANLFEAFSCSWTLSATFDKLL
Ga0209382_102246881	3300027909	Populus Rhizosphere	VYFFSSAGRIVCKDVGLFEGFSCPWSPSPTFYKLAG
Ga0247819_106670681	3300028608	Soil	VSLLAVARLIACKDASLCEAFSCPWIPPSTFYKLLYIERPE
Ga0308203_10962881	3300030829	Soil	VYFFSSAGLIACKDVGFCEAFSCPWTPSPTFYKLLKIERP
Ga0308202_10932431	3300030902	Soil	VYFFSSAGLIACKDVGFCEAFSCPWTPSPTFYKLLKIE
Ga0308196_10305891	3300030989	Soil	VYFFSSAGLIACKDVGFCEAFSCPWTPSPTFYKLLKIERPR
Ga0308201_102364631	3300031091	Soil	VYFFSSAGLIACKDVGFCEAFSCPWTPSPTFYKLLKIERPRL
Ga0308197_103553261	3300031093	Soil	VYFFSSAGLIACKDVGFCEAFSCPWTPSPTFYKLLKIERPRLA
Ga0307468_1008289421	3300031740	Hardwood Forest Soil	MYLLAVVGLLACKDAHLFEAFSCSWTRSATFYKLLEIERTTQALALF
Ga0306925_110727782	3300031890	Soil	SGEGAASLLAVAGFIACKDASLFEAFSCLWLPSVTF
Ga0310900_118773922	3300031908	Soil	VYLLAVAGLIACKDANLFEAFSCSWTPSPTFYKLLEIERAFF
Ga0310909_106310021	3300031947	Soil	VYYLSGAGLIVCKDVGVIEAFSCPWSPSSTFYKLLEIDRLHLSLSRLS
Ga0310890_103956461	3300032075	Soil	RGAVYLLSAAERIACKDASLFGACSWPWAPLSTFYKLL
Ga0247830_107501521	3300033551	Soil	VYLLSVAGLIACKDANLFEAFSCSWPPPSTFYKRLEIERPST
Ga0370548_142182_2_127	3300034644	Soil	MYFFSSAGLIACKDVGFCEAFSCPWTPSPTFYKLLKIERPRL

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F055844

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences