Metagenome / Metatranscriptome Family F055810

Basic Information
Family ID	F055810
Family Type	Metagenome / Metatranscriptome
Number of Sequences	138
Average Sequence Length	42 residues
Representative Sequence	DGLQQVIDTNKRIAELSVRVADEAARAIQAQGNANQGRRAA
Number of Associated Samples	84
Number of Associated Scaffolds	138

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	5.51 %
% of genes near scaffold ends (potentially truncated)	85.51 %
% of genes from short scaffolds (< 2000 bps)	86.23 %
Associated GOLD sequencing projects	77
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.57

Most Common Taxonomy
Group	Unclassified (56.522 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (21.014 % of family members)
Environment Ontology (ENVO)	Unclassified (43.478 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (57.971 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 138 Family Scaffolds
PF09361	Phasin_2	5.80
PF08388	GIIM	5.07
PF00078	RVT_1	2.90
PF00313	CSD	2.17
PF13340	DUF4096	1.45
PF00561	Abhydrolase_1	0.72
PF13628	DUF4142	0.72
PF13610	DDE_Tnp_IS240	0.72
PF00872	Transposase_mut	0.72
PF02371	Transposase_20	0.72
PF07311	Dodecin	0.72
PF01165	Ribosomal_S21	0.72
PF00873	ACR_tran	0.72
PF03729	DUF308	0.72
PF13586	DDE_Tnp_1_2	0.72
PF00805	Pentapeptide	0.72
PF13551	HTH_29	0.72

COG ID	Name	Functional Category	% Frequency in 138 Family Scaffolds
COG0828	Ribosomal protein S21	Translation, ribosomal structure and biogenesis [J]	0.72
COG1357	Uncharacterized conserved protein YjbI, contains pentapeptide repeats	Function unknown [S]	0.72
COG3247	Acid resistance membrane protein HdeD, DUF308 family	General function prediction only [R]	0.72
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	0.72
COG3360	Flavin-binding protein dodecin	General function prediction only [R]	0.72
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.72

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
All Organisms	root	All Organisms	43.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
cellular organisms	root	All Organisms → cellular organisms	43.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	42.75 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	39.86 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	29.71 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.72 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.72 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	24.64 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.72 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.72 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	0.72 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	15.94 %
Lichenibacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae	1.45 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	0.72 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.72 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.72 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	0.72 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	10.87 %
Lichenibacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium	1.45 %
Paraburkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.72 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.72 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	4.35 %
unclassified Lichenibacterium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium	1.45 %
Pseudomonas aeruginosa group	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group	0.72 %
Microvirga lotononidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	0.72 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.72 %
Roseomonas wenyumeiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	0.72 %
unclassified Paraburkholderia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia	0.72 %
unclassified Microvirga	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	4.35 %
Lichenibacterium sp. 6Y81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	1.45 %
Microvirga sp. BSC39	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39	0.72 %
Paraburkholderia sp. BL23I1N1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1	0.72 %
Pseudomonas aeruginosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	0.72 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	0.72 %
Microvirga lotononidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	0.72 %
Roseomonas wenyumeiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	4.35 %
Lichenibacterium sp. 6Y81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	1.45 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	0.72 %
Microvirga sp. BSC39	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39	0.72 %
Paraburkholderia sp. BL23I1N1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1	0.72 %
Pseudomonas aeruginosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	0.72 %
Microvirga lotononidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	0.72 %
Roseomonas wenyumeiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	4.35 %
Lichenibacterium sp. 6Y81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	1.45 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.72 %
Microvirga sp. BSC39	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39	0.72 %
Paraburkholderia sp. BL23I1N1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1	0.72 %
Pseudomonas aeruginosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	0.72 %
Microvirga lotononidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	0.72 %
Roseomonas wenyumeiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	4.35 %
Lichenibacterium sp. 6Y81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	1.45 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.72 %
Microvirga sp. BSC39	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39	0.72 %
Paraburkholderia sp. BL23I1N1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1	0.72 %
Pseudomonas aeruginosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	0.72 %
Microvirga lotononidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	0.72 %
Roseomonas wenyumeiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	4.35 %
Lichenibacterium sp. 6Y81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	1.45 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	0.72 %
Microvirga sp. BSC39	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39	0.72 %
Paraburkholderia sp. BL23I1N1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1	0.72 %
Pseudomonas aeruginosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	0.72 %
Microvirga lotononidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	0.72 %
Roseomonas wenyumeiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	4.35 %
Lichenibacterium sp. 6Y81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	1.45 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	0.72 %
Microvirga sp. BSC39	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39	0.72 %
Paraburkholderia sp. BL23I1N1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1	0.72 %
Pseudomonas aeruginosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	0.72 %
Microvirga lotononidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	0.72 %
Roseomonas wenyumeiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	4.35 %
Lichenibacterium sp. 6Y81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	1.45 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	0.72 %
Microvirga sp. BSC39	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39	0.72 %
Paraburkholderia sp. BL23I1N1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1	0.72 %
Pseudomonas aeruginosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	0.72 %
Microvirga lotononidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	0.72 %
Roseomonas wenyumeiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	4.35 %
Lichenibacterium sp. 6Y81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	1.45 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	0.72 %
Microvirga sp. BSC39	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39	0.72 %
Paraburkholderia sp. BL23I1N1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1	0.72 %
Pseudomonas aeruginosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	0.72 %
Microvirga lotononidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	0.72 %
Roseomonas wenyumeiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	4.35 %
Lichenibacterium sp. 6Y81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	1.45 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	0.72 %
Microvirga sp. BSC39	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39	0.72 %
Paraburkholderia sp. BL23I1N1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1	0.72 %
Pseudomonas aeruginosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	0.72 %
Microvirga lotononidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	0.72 %
Roseomonas wenyumeiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	4.35 %
Lichenibacterium sp. 6Y81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	1.45 %
Paraneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera	0.72 %
Microvirga sp. BSC39	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39	0.72 %
Paraburkholderia sp. BL23I1N1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1	0.72 %
Pseudomonas aeruginosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	0.72 %
Microvirga lotononidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	0.72 %
Roseomonas wenyumeiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	4.35 %
Lichenibacterium sp. 6Y81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	1.45 %
Hemiptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera	0.72 %
Microvirga sp. BSC39	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39	0.72 %
Paraburkholderia sp. BL23I1N1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1	0.72 %
Pseudomonas aeruginosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	0.72 %
Microvirga lotononidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	0.72 %
Roseomonas wenyumeiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	4.35 %
Lichenibacterium sp. 6Y81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	1.45 %
Sternorrhyncha	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha	0.72 %
Microvirga sp. BSC39	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39	0.72 %
Paraburkholderia sp. BL23I1N1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1	0.72 %
Pseudomonas aeruginosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	0.72 %
Microvirga lotononidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	0.72 %
Roseomonas wenyumeiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	4.35 %
Lichenibacterium sp. 6Y81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	1.45 %
Coccoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea	0.72 %
Microvirga sp. BSC39	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39	0.72 %
Paraburkholderia sp. BL23I1N1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1	0.72 %
Pseudomonas aeruginosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	0.72 %
Microvirga lotononidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	0.72 %
Roseomonas wenyumeiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	4.35 %
Lichenibacterium sp. 6Y81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	1.45 %
Pseudococcidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Pseudococcidae	0.72 %
Microvirga sp. BSC39	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39	0.72 %
Paraburkholderia sp. BL23I1N1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1	0.72 %
Pseudomonas aeruginosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	0.72 %
Microvirga lotononidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	0.72 %
Roseomonas wenyumeiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.52 %
Microvirga lupini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	4.35 %
Lichenibacterium sp. 6Y81	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	1.45 %
Paracoccus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Pseudococcidae → Paracoccus	0.72 %
Microvirga sp. BSC39	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39	0.72 %
Paraburkholderia sp. BL23I1N1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1	0.72 %
Pseudomonas aeruginosa	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	0.72 %
Microvirga lotononidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	0.72 %
Roseomonas wenyumeiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	0.72 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.72 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.72 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002568\|C688J35102_117715361	Not Available	501	Open in IMG/M
3300002568\|C688J35102_118155742	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	534	Open in IMG/M
3300002568\|C688J35102_118572662	Not Available	573	Open in IMG/M
3300002568\|C688J35102_118755415	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	593	Open in IMG/M
3300002568\|C688J35102_119599366	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	728	Open in IMG/M
3300002568\|C688J35102_119800130	All Organisms → cellular organisms → Bacteria → Proteobacteria	778	Open in IMG/M
3300004016\|Ga0058689_10112690	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	589	Open in IMG/M
3300005327\|Ga0070658_11545177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	575	Open in IMG/M
3300005334\|Ga0068869_101337454	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	633	Open in IMG/M
3300005337\|Ga0070682_100011759	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	5006	Open in IMG/M
3300005338\|Ga0068868_101880240	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	567	Open in IMG/M
3300005339\|Ga0070660_101083541	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	678	Open in IMG/M
3300005347\|Ga0070668_100415701	All Organisms → cellular organisms → Bacteria	1151	Open in IMG/M
3300005347\|Ga0070668_100637144	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini	935	Open in IMG/M
3300005367\|Ga0070667_100150059	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2047	Open in IMG/M
3300005441\|Ga0070700_101975356	Not Available	506	Open in IMG/M
3300005548\|Ga0070665_101165562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	782	Open in IMG/M
3300005548\|Ga0070665_102651588	Not Available	502	Open in IMG/M
3300005578\|Ga0068854_100277598	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis	1348	Open in IMG/M
3300005578\|Ga0068854_101469992	Not Available	618	Open in IMG/M
3300005616\|Ga0068852_101222311	Not Available	773	Open in IMG/M
3300005616\|Ga0068852_102546105	Not Available	532	Open in IMG/M
3300005617\|Ga0068859_101202993	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	835	Open in IMG/M
3300005618\|Ga0068864_100777320	Not Available	940	Open in IMG/M
3300005719\|Ga0068861_102372556	Not Available	533	Open in IMG/M
3300005840\|Ga0068870_10587340	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	755	Open in IMG/M
3300005841\|Ga0068863_101425048	Not Available	701	Open in IMG/M
3300006804\|Ga0079221_11706801	Not Available	513	Open in IMG/M
3300009098\|Ga0105245_12391232	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	582	Open in IMG/M
3300009101\|Ga0105247_10950992	Not Available	667	Open in IMG/M
3300009101\|Ga0105247_11593679	Not Available	536	Open in IMG/M
3300009148\|Ga0105243_11347419	Not Available	732	Open in IMG/M
3300009177\|Ga0105248_11512735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	760	Open in IMG/M
3300009177\|Ga0105248_12380600	Not Available	603	Open in IMG/M
3300009177\|Ga0105248_12960944	Not Available	541	Open in IMG/M
3300009553\|Ga0105249_11117278	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	858	Open in IMG/M
3300009789\|Ga0126307_10270806	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	1365	Open in IMG/M
3300009789\|Ga0126307_11706897	Not Available	512	Open in IMG/M
3300009840\|Ga0126313_10781967	Not Available	776	Open in IMG/M
3300009840\|Ga0126313_10856042	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	741	Open in IMG/M
3300010036\|Ga0126305_10674718	Not Available	698	Open in IMG/M
3300010036\|Ga0126305_10917615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	598	Open in IMG/M
3300010036\|Ga0126305_11277877	Not Available	507	Open in IMG/M
3300010036\|Ga0126305_11283095	Not Available	505	Open in IMG/M
3300010037\|Ga0126304_10822155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Lichenibacteriaceae → Lichenibacterium → unclassified Lichenibacterium → Lichenibacterium sp. 6Y81	630	Open in IMG/M
3300010038\|Ga0126315_10387642	All Organisms → cellular organisms → Bacteria	876	Open in IMG/M
3300010039\|Ga0126309_10237006	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1028	Open in IMG/M
3300010039\|Ga0126309_10364604	Not Available	855	Open in IMG/M
3300010039\|Ga0126309_10448819	Not Available	783	Open in IMG/M
3300010039\|Ga0126309_10721400	Not Available	642	Open in IMG/M
3300010039\|Ga0126309_10990190	Not Available	564	Open in IMG/M
3300010041\|Ga0126312_10520708	Not Available	852	Open in IMG/M
3300010041\|Ga0126312_11373728	Not Available	524	Open in IMG/M
3300010042\|Ga0126314_11166156	Not Available	575	Open in IMG/M
3300010044\|Ga0126310_10491455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	895	Open in IMG/M
3300010044\|Ga0126310_11493829	Not Available	554	Open in IMG/M
3300010045\|Ga0126311_10847181	Not Available	739	Open in IMG/M
3300010045\|Ga0126311_11196728	All Organisms → cellular organisms → Bacteria → Proteobacteria	628	Open in IMG/M
3300010071\|Ga0127477_141303	Not Available	595	Open in IMG/M
3300010083\|Ga0127478_1074202	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1	831	Open in IMG/M
3300010166\|Ga0126306_10414602	Not Available	1055	Open in IMG/M
3300010166\|Ga0126306_11447602	Not Available	569	Open in IMG/M
3300010166\|Ga0126306_11471954	Not Available	565	Open in IMG/M
3300010364\|Ga0134066_10123710	Not Available	781	Open in IMG/M
3300010371\|Ga0134125_10256684	All Organisms → cellular organisms → Bacteria → Proteobacteria	1941	Open in IMG/M
3300010373\|Ga0134128_10214653	All Organisms → cellular organisms → Bacteria → Proteobacteria	2163	Open in IMG/M
3300010373\|Ga0134128_13035998	Not Available	516	Open in IMG/M
3300010400\|Ga0134122_12476620	Not Available	568	Open in IMG/M
3300010401\|Ga0134121_10298354	All Organisms → cellular organisms → Bacteria → Proteobacteria	1426	Open in IMG/M
3300011119\|Ga0105246_10556272	Not Available	984	Open in IMG/M
3300012212\|Ga0150985_106445828	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. BSC39	776	Open in IMG/M
3300012212\|Ga0150985_111739106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	695	Open in IMG/M
3300012212\|Ga0150985_112688903	All Organisms → cellular organisms → Bacteria → Proteobacteria	803	Open in IMG/M
3300012212\|Ga0150985_121314867	Not Available	613	Open in IMG/M
3300012392\|Ga0134043_1318314	Not Available	634	Open in IMG/M
3300012469\|Ga0150984_100437620	All Organisms → cellular organisms → Bacteria	958	Open in IMG/M
3300012469\|Ga0150984_109463144	Not Available	577	Open in IMG/M
3300012469\|Ga0150984_109717846	Not Available	810	Open in IMG/M
3300012469\|Ga0150984_113101294	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	1033	Open in IMG/M
3300012469\|Ga0150984_119724200	Not Available	772	Open in IMG/M
3300012469\|Ga0150984_122969872	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	672	Open in IMG/M
3300012469\|Ga0150984_123037779	Not Available	537	Open in IMG/M
3300012986\|Ga0164304_11630070	Not Available	538	Open in IMG/M
3300012989\|Ga0164305_11524066	Not Available	594	Open in IMG/M
3300013296\|Ga0157374_12773167	Not Available	518	Open in IMG/M
3300013297\|Ga0157378_11127906	Not Available	822	Open in IMG/M
3300013306\|Ga0163162_10859754	All Organisms → cellular organisms → Bacteria → Proteobacteria	1022	Open in IMG/M
3300013306\|Ga0163162_11221366	Not Available	853	Open in IMG/M
3300013306\|Ga0163162_13092494	Not Available	534	Open in IMG/M
3300013306\|Ga0163162_13110220	Not Available	533	Open in IMG/M
3300013306\|Ga0163162_13310744	Not Available	516	Open in IMG/M
3300014325\|Ga0163163_10038060	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4684	Open in IMG/M
3300014326\|Ga0157380_10224623	All Organisms → cellular organisms → Bacteria	1682	Open in IMG/M
3300014487\|Ga0182000_10611262	Not Available	528	Open in IMG/M
3300014745\|Ga0157377_10452542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	887	Open in IMG/M
3300015265\|Ga0182005_1250143	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae	548	Open in IMG/M
3300015372\|Ga0132256_100745916	All Organisms → cellular organisms → Bacteria → Proteobacteria	1095	Open in IMG/M
3300015372\|Ga0132256_103405377	Not Available	535	Open in IMG/M
3300019269\|Ga0184644_1740961	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	505	Open in IMG/M
3300025900\|Ga0207710_10249709	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	887	Open in IMG/M
3300025901\|Ga0207688_10755483	Not Available	616	Open in IMG/M
3300025903\|Ga0207680_10056570	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2369	Open in IMG/M
3300025907\|Ga0207645_10682616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	698	Open in IMG/M
3300025918\|Ga0207662_10225980	Not Available	1221	Open in IMG/M
3300025924\|Ga0207694_11656493	Not Available	539	Open in IMG/M
3300025927\|Ga0207687_10989871	Not Available	721	Open in IMG/M
3300025931\|Ga0207644_10988313	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	706	Open in IMG/M
3300025933\|Ga0207706_10135264	All Organisms → cellular organisms → Bacteria → Proteobacteria	2168	Open in IMG/M
3300025933\|Ga0207706_11525366	Not Available	544	Open in IMG/M
3300025935\|Ga0207709_10681199	Not Available	821	Open in IMG/M
3300025941\|Ga0207711_11328769	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Pseudococcidae → Paracoccus	661	Open in IMG/M
3300025972\|Ga0207668_10109122	All Organisms → cellular organisms → Bacteria → Proteobacteria	2072	Open in IMG/M
3300025972\|Ga0207668_10776615	Not Available	847	Open in IMG/M
3300025972\|Ga0207668_11078153	Not Available	720	Open in IMG/M
3300026035\|Ga0207703_10279613	All Organisms → cellular organisms → Bacteria → Proteobacteria	1515	Open in IMG/M
3300026035\|Ga0207703_10939320	Not Available	829	Open in IMG/M
3300026035\|Ga0207703_11763486	Not Available	595	Open in IMG/M
3300026041\|Ga0207639_10597544	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1017	Open in IMG/M
3300026067\|Ga0207678_10950312	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa	760	Open in IMG/M
3300026088\|Ga0207641_12431076	Not Available	523	Open in IMG/M
3300026121\|Ga0207683_10783147	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	885	Open in IMG/M
3300026142\|Ga0207698_10662384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	1035	Open in IMG/M
3300026142\|Ga0207698_12540165	Not Available	522	Open in IMG/M
3300026750\|Ga0207483_100079	All Organisms → cellular organisms → Bacteria → Proteobacteria	3985	Open in IMG/M
3300031093\|Ga0308197_10474379	Not Available	507	Open in IMG/M
3300034669\|Ga0314794_142887	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	549	Open in IMG/M
3300034673\|Ga0314798_039808	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	846	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	56.52%
Environmental	Environmental	43.48%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	56.52%
Terrestrial	Environmental → Terrestrial	42.75%
Aquatic	Environmental → Aquatic	0.72%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	42.75%
Rhizosphere	Host-Associated → Plants → Rhizosphere	32.61%
Rhizoplane	Host-Associated → Plants → Rhizoplane	21.74%
Roots	Host-Associated → Plants → Roots	1.45%
Freshwater	Environmental → Aquatic → Freshwater	0.72%
Phyllosphere	Host-Associated → Plants → Phyllosphere	0.72%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	36.23%
Soil	Host-Associated → Plants → Rhizosphere → Soil	18.84%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	17.39%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.77%
Loam	Environmental → Terrestrial → Soil → Loam	6.52%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.62%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.45%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.72%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.72%
Phylloplane/Leaf Surface	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface	0.72%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	33.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	18.84%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	17.39%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.77%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	4.35%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.62%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.17%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.45%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.45%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.45%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.72%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.72%
Unclassified	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified	0.72%

Habitat	Taxonomy	Distribution
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	21.01%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	7.25%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.80%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	5.80%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	5.80%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	5.07%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.07%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	4.35%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.62%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	3.62%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.62%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.62%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	3.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.90%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.17%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.45%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.45%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.72%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.72%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.72%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.72%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.72%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.72%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.72%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.72%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.72%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.72%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.72%
Agave	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave	0.72%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300004016	Agave microbial communities from Guanajuato, Mexico - As.Ma.rz	Host-Associated	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental	Open in IMG/M
3300010071	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010083	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012373	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012392	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012409	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014487	Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300019269	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026750	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-B (SPAdes)	Environmental	Open in IMG/M
3300031091	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031093	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034669	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034673	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.57
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.57
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F055810

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
C688J35102_1177153612	3300002568	Soil	LQQVIDTNKRVAEVSVRIADEAARSIQQAQGGTNVNRPRAA*
C688J35102_1181557421	3300002568	Soil	GLQQVIDTNKRIAELSVRAADEAARAIQAQGNANQGRRAA*
C688J35102_1185726622	3300002568	Soil	MRSRLESDLARDTLQQVIDTNKRIAEVSLRTADEAARAIQQAQGNANQGRRAA*
C688J35102_1187554152	3300002568	Soil	DGLQQVIDTNKRIAELSVRVADEAARAIQSQGNANQGRRAA*
C688J35102_1195993661	3300002568	Soil	VQSDLARDGLQQVIDTNKRIAELSVRIADEAARAIQAQANQNAKQVRRVA*
C688J35102_1198001302	3300002568	Soil	LQQVIDTNKRVAEVSVRIADEAARSIQQAQSNPHQPRRAA*
Ga0058689_101126901	3300004016	Agave	GLQQVIDTNKRIAELSVRVADEAARAIQAQGSANQGRRAA*
Ga0070658_115451772	3300005327	Corn Rhizosphere	RDNLQQAIDTNKRVAEVSVRVAEEAARSIQAHGGTNVNRRAA*
Ga0068869_1013374541	3300005334	Miscanthus Rhizosphere	FVAVQSDLVRDGLSHVIDTNKRIAEVSVRIADEAARAIQAQGNANQGRRAA*
Ga0070682_1000117596	3300005337	Corn Rhizosphere	AVQSDLARDGLQQVIDTNKRIAELSVRVADEAARAIQAQGSANQGRRAA*
Ga0068868_1018802401	3300005338	Miscanthus Rhizosphere	QSDLARDGLSQVIDTNKRIAELSVRVAEEAARAIQAQGNANQGRRAA*
Ga0070660_1010835411	3300005339	Corn Rhizosphere	VRDGLQQAIDTNKRIAKLSVRIADEAARAIQAQGNAHQGRRAA*
Ga0070668_1004157012	3300005347	Switchgrass Rhizosphere	DGLQQVIDTNKRIAELSVRVADEAARAIQAQSNANQGRRAA*
Ga0070668_1006371441	3300005347	Switchgrass Rhizosphere	DGLSQVIDTNKRIAELSVRVADEAARAIQAQGSANQGRRAA*
Ga0070667_1001500592	3300005367	Switchgrass Rhizosphere	QSDLARDGLQQVIDTNKRIAEVSLRIANEAGQIVQAQADKNAKQVRRAA*
Ga0070700_1019753562	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	QVIDTNKRVAELSLRIADEAARTIQAQANQNANQARRAA*
Ga0070665_1011655622	3300005548	Switchgrass Rhizosphere	AVQSDLARDGLSQVIDTNKRIAEVSLRTADEAARAIQAEGNAHQGRRAA*
Ga0070665_1026515882	3300005548	Switchgrass Rhizosphere	QSDLVRDGLQQVIDTNKRIAELSVRVADEAARAIQAQDNAHQGRRAA*
Ga0068854_1002775981	3300005578	Corn Rhizosphere	NLQQAIDTNKRIAEVSVRVAEEAPRSIQAHGGTNVNRRAA*
Ga0068854_1014699922	3300005578	Corn Rhizosphere	RDGLQQVIDTNKRIAELSVRIADEAGRAIQTQGSANQGRRAA*
Ga0068852_1012223113	3300005616	Corn Rhizosphere	QSDLVRDTLQQVIDANKRIAELSVRVADEAARAIQTQGNANQGRHAA*
Ga0068852_1025461053	3300005616	Corn Rhizosphere	VQSDLVRDGLQQVIDTNKRIAELSVRVADEAARAIQAQGNANQGRRAA*
Ga0068859_1012029932	3300005617	Switchgrass Rhizosphere	RDGLQQVIDTNKRIAELSVRVAEEAARSIQTQGSQARRAA*
Ga0068864_1007773204	3300005618	Switchgrass Rhizosphere	QVIDTNKRIAELSVRVADEAARAIQAQGNANQGRRAA*
Ga0068861_1023725561	3300005719	Switchgrass Rhizosphere	VIDTNKRIAELSVWVADEAARAIQAQGNANQGRRAA*
Ga0068870_105873402	3300005840	Miscanthus Rhizosphere	QSDLARDNLQQMIDTNKRVAEVSVQVAEEAARSIQAHGGTNVNRRAA*
Ga0068863_1014250482	3300005841	Switchgrass Rhizosphere	QSDLARDGLSQVIDTNKRIAEVSLRTADEAARAIQAQGNAHQGRRAA*
Ga0097621_1005215382	3300006237	Miscanthus Rhizosphere	VIETNKRIAETSLRIAEEAARVIQAQAQANRRRAA*
Ga0079221_117068011	3300006804	Agricultural Soil	QVIETNKRIAEVSLRTADEAARAIQQAQGNANQDRRAA*
Ga0105245_123912322	3300009098	Miscanthus Rhizosphere	QSDLVRDGLQQVIDTNKRVAEVSVRIADEAARSIQQAQGTANQPRRAA*
Ga0105247_109509921	3300009101	Switchgrass Rhizosphere	VIDTNKRIAEVSLRTADEAARAIQAEGNAHQGRRAA*
Ga0105247_115936792	3300009101	Switchgrass Rhizosphere	DDLQQVIDTNKRIAELSVRIADEAARAIQTQGNANQGRRAA*
Ga0105243_113474192	3300009148	Miscanthus Rhizosphere	QQIIATNQRIAELSVRVADEAARIIQTQANSDANQARRAA*
Ga0105248_115127351	3300009177	Switchgrass Rhizosphere	AIDTNKRVAEVSVRVAEEAARSIQAHGGTNVNRHAA*
Ga0105248_123806002	3300009177	Switchgrass Rhizosphere	VIDTNKRIAELSVRVADEAARAIQTQGTAHQGRRAA*
Ga0105248_129609441	3300009177	Switchgrass Rhizosphere	QVIDTNKRIAELSVRVADEAAQAIQAQGSANQGRRAA*
Ga0105249_111172782	3300009553	Switchgrass Rhizosphere	MRDGLQQVIDTNKRIAELSVRVADAAARAIPAQGNANQGRRAA*
Ga0126307_102708063	3300009789	Serpentine Soil	AVQSDLVRDGLQQVIDTNKRVAEVSVRIADEAAQSIQQAQGNANQPRRAA*
Ga0126307_116285821	3300009789	Serpentine Soil	DNLQQVINTNRRVAEVSLRIADEASRIIQARANAHANQARRA*
Ga0126307_117068971	3300009789	Serpentine Soil	SDLVRDGLQQVIDTNKRVAEVSLRIADEAGRIIQDQANQNAKQVRRVA*
Ga0126313_107819672	3300009840	Serpentine Soil	LARDGLQQAIDTNKRIAELSVRVADEAARAIQAQGNANQGRRAA*
Ga0126313_108560421	3300009840	Serpentine Soil	QSDLVRDGLQQVIDTNKRIAELSVRVADEAARAIQAQAGQVRRAA*
Ga0126305_106747181	3300010036	Serpentine Soil	DLVRDTLQQVIDTNRRVAEVMVRIADEAGRIIQAQADKNAKQVRRAA*
Ga0126305_109176151	3300010036	Serpentine Soil	QQVIDTNKHVAEVSVRVADEASRSIRQAQGNAHQPRRAA*
Ga0126305_112778772	3300010036	Serpentine Soil	RDALQQVIDTNKRMAEVSLRTADEAARTIQVKGNAHQGRRAA*
Ga0126305_112830952	3300010036	Serpentine Soil	QHVIDTNKRIAELSVRVAEEAARAIQAQGNANQGRRAA*
Ga0126304_108221552	3300010037	Serpentine Soil	TNKRIAEVSLRTADEAARAIQQAQGNANQGRRAA*
Ga0126315_103876423	3300010038	Serpentine Soil	QSDLARDTLQQVIDTNKRIAELSVRVADEAARTIQARANENANQARHAA*
Ga0126315_112658921	3300010038	Serpentine Soil	TNKRIAEVSLRIAEEAARIIETQANQNAKQVRRAA*
Ga0126309_102370061	3300010039	Serpentine Soil	RDNLQQVIDTNKRIAELSVRVADEAARSIQVQADKNANQARRAA*
Ga0126309_103646042	3300010039	Serpentine Soil	RDNLQQVIDTNKRVAEVSVRVAEEAARSIQQAQGNPHQGRRAA*
Ga0126309_104488192	3300010039	Serpentine Soil	IDTNKRVAEVSVRVAEEAARTIQTQADKNANQARRAA*
Ga0126309_107214001	3300010039	Serpentine Soil	VQSDLARDTLWQVIATNKRIAEVSLRIADEAGRIIQDQASQNAKQVRRLA*
Ga0126309_109901901	3300010039	Serpentine Soil	GLQQVIDTNKRVAEMSVRVADEAARSIQAQGNANQARRAA*
Ga0126312_105207081	3300010041	Serpentine Soil	LQQAIDTNKRIAELSVRVADEAARAIQAQGNANQGRRAA*
Ga0126312_113737282	3300010041	Serpentine Soil	VRDGLQQVIDTSKRVAELSVRVADEAARAIQAQAIQARRAA*
Ga0126312_114540621	3300010041	Serpentine Soil	VIDTNRRVAEVSLRIANEAGQIIQAQADKNAKQVRRVA*
Ga0126314_111661562	3300010042	Serpentine Soil	RDTLWQVIETNKRLAKVSVRATDEAAQAIQGQANQARRAA*
Ga0126310_104914553	3300010044	Serpentine Soil	QSDLVRDGLQQVIDTNKRVAEVSVRIADEAARSIQQAQGNPNQPRRAA*
Ga0126310_114938292	3300010044	Serpentine Soil	QSELVRDGLQQVIDTNKRIAEVSLRTADEASRAIQAQGKANQTRRAA*
Ga0126311_108471812	3300010045	Serpentine Soil	VIDTNKRIAELSVRVADEAARTIQAQGNANQGRRAA*
Ga0126311_111967281	3300010045	Serpentine Soil	TNKRVAEVSVRVADEAARSIQQAQGNPHQPRRAA*
Ga0126311_115288841	3300010045	Serpentine Soil	NKRVAEVSLRIADEAARTIQAQANQNAHQTRRAA*
Ga0127477_1413031	3300010071	Grasslands Soil	VIETNKRIAEVSLRTADEAARAIQQAQGNANQDRRAA*
Ga0127478_10742021	3300010083	Grasslands Soil	SDLARDTLQQVIETNRRIAEVSLRIANEAGQIIQAQADKNAKQARRAA*
Ga0126306_104146021	3300010166	Serpentine Soil	ARDGLQQVIDTNKRIAEVSLRTADEAARAIQAPGNTNQGRRAA*
Ga0126306_114476021	3300010166	Serpentine Soil	VIDTNKRIAEVSLRTADEAARAIQARADKTAKQVRRVA*
Ga0126306_114719541	3300010166	Serpentine Soil	RDGLQQVIDTNKRVAEVSVRIADEAARSIQQAQGNAHQPRRAA*
Ga0134066_101237101	3300010364	Grasslands Soil	DTNKRIAELSVRVAEEAARAIQAQGNANQGRRAA*
Ga0134125_102566841	3300010371	Terrestrial Soil	DGLQQVIDTNKRIAELSVRVADEAARAIQAQGNANQGRRAA*
Ga0134128_102146531	3300010373	Terrestrial Soil	DGLSQVIDTNKRIAELSVRVAEEAARAIQTQGSANQGRRAA*
Ga0134128_130359981	3300010373	Terrestrial Soil	NLQQVIDTNKRVAEVSVRIADEAARSIQQAQGGTNVNRPRAA*
Ga0134122_124766201	3300010400	Terrestrial Soil	QVIDTNKRIAELSVRVADEAARAIQAQDNAHQGRRAA*
Ga0134121_102983542	3300010401	Terrestrial Soil	VQSDLVRDGLQQVIDTNKRVAEVSVRIADEAARSIQQAQGTANQPRRAA*
Ga0105246_105562721	3300011119	Miscanthus Rhizosphere	GLSQVIDTNKRIAELSVRVADEAARAIQAQDNAHQGRRAA*
Ga0150985_1064458282	3300012212	Avena Fatua Rhizosphere	VIDINKRVAEVSVRVAEEAARSIQQAQGSPNQARRAA*
Ga0150985_1117391063	3300012212	Avena Fatua Rhizosphere	DTNKRIAELSVRVAHEAARAIQAQGNANPGRRAA*
Ga0150985_1126889031	3300012212	Avena Fatua Rhizosphere	DTNKRIAELSVRVADEAARAIQAQGNAANQGRRAA*
Ga0150985_1136175301	3300012212	Avena Fatua Rhizosphere	QVIETNKRIAEVSLRIAEEAARIIETQANQNAKQVRRAA*
Ga0150985_1213148671	3300012212	Avena Fatua Rhizosphere	MSGWRRVAELSVRVADEAARIIQTQANSDANQARRAA*
Ga0134042_10647302	3300012373	Grasslands Soil	ARDNLQQIIDTNRRIAERSLRAADEAARIIQVQVEAGAERARRAA*
Ga0134043_13183142	3300012392	Grasslands Soil	LQQVIDTNKRVAELSVRVADEAARAIQAQATQARRAA*
Ga0134043_13262272	3300012392	Grasslands Soil	LQEVIETNRRAAEVSLRIAEEAGRVIQAQADKNARQVRRVA*
Ga0134045_14942541	3300012409	Grasslands Soil	LQEVIETNRRIAEVSLRIANEASQIIQAQADKNAKQVRRVA*
Ga0150984_1004376201	3300012469	Avena Fatua Rhizosphere	NLQQLIDTNKRVAELSVRVADEAAQAIQAQGKANQARRAA*
Ga0150984_1094631441	3300012469	Avena Fatua Rhizosphere	VIDTNKRIAEVSVRLAEEAARAIQAQGNANQGRRAA*
Ga0150984_1097178461	3300012469	Avena Fatua Rhizosphere	LMRDTLSQVIDTNKRIAELSVRTADEAARIIETQASQNAKQVRRAA*
Ga0150984_1131012941	3300012469	Avena Fatua Rhizosphere	IDTNKRVAEVSVRIADEAARSIQAQGNANQPRRAA*
Ga0150984_1177830691	3300012469	Avena Fatua Rhizosphere	NKRIAEVSLRIAEEAARIIETQANQNAKQVRRAA*
Ga0150984_1197242002	3300012469	Avena Fatua Rhizosphere	QQVIDTNKRIAEVSVRIADEAARAIQAQGSANQGRRAA*
Ga0150984_1229698721	3300012469	Avena Fatua Rhizosphere	DGIWQVIEINKRIAEVSLRIAEEAARIIETQANQNAKQVRRAA*
Ga0150984_1230377792	3300012469	Avena Fatua Rhizosphere	QQVIDTHKRIAELSVRVADEAARAIQAQGNANQSRRAAQP*
Ga0164304_116300702	3300012986	Soil	VQSDLARDNLEQVIETNKRIAETSLRIAEEAARVIQAQAQANRRHAA*
Ga0164305_115240662	3300012989	Soil	VAVQSDLARDTLRQVIETNKRIAEVSLRIADEAAGIIQARANQNAQQVRRVA*
Ga0157374_127731671	3300013296	Miscanthus Rhizosphere	DGLSQVIDTNKRIAELSVRVAEEAARAIQTQGNANQGRRAA*
Ga0157378_111279062	3300013297	Miscanthus Rhizosphere	DDLQQVIETNKRIAEVSLRTADEAARAIQAEGNAHQGRRAA*
Ga0163162_108597543	3300013306	Switchgrass Rhizosphere	AVQSDLARDHLEQVIEVNKRIAETSLRIAEEASRVIQAQANRRLRAA*
Ga0163162_112213661	3300013306	Switchgrass Rhizosphere	SDLARDGLQQVIDTNKRIAELSVWVADEAARAIQAQGNANQGRRAA*
Ga0163162_130924941	3300013306	Switchgrass Rhizosphere	DLARDTLQEVIETNRRAAEVSLRIAEEAGRVIQAQADKNARQVRRVA*
Ga0163162_131102202	3300013306	Switchgrass Rhizosphere	MQGAMRSRLESDLARDTLQQVIDTNKRIAEVSLRTADEAARAIQQAQGNANQGRRAA*
Ga0163162_133107442	3300013306	Switchgrass Rhizosphere	AVQSDLARDTLQQVIETNKRIAEVSLRIADEASRIIQARANQNAQQARRVA*
Ga0163163_100380604	3300014325	Switchgrass Rhizosphere	QQVIDTNKRIAELSVRAADEAARAIQTQGNANQGRRAA*
Ga0157380_102246231	3300014326	Switchgrass Rhizosphere	QVIDTNKRVAEVSLRIADEAARTIQAQGSANQGRRAA*
Ga0182000_106112621	3300014487	Soil	RDTLEQAISTSRRVAELSVRVADEAARRVRAQGARRSA*
Ga0157377_104525421	3300014745	Miscanthus Rhizosphere	LQQAIDTNKRVAEVSVRVAEEAARSIQAHGGTNVNRRAA*
Ga0182005_12501433	3300015265	Rhizosphere	VQDFVAVQSDLVRDGLQQVIDTNKRIAEVSLRIADEGARAIRAQGNANQGR
Ga0132256_1007459161	3300015372	Arabidopsis Rhizosphere	DFVAVQSDLVRDTLQQVIDTNKRIGEVSVRVADEAARAIQAQGSANQGRRVA*
Ga0132256_1034053771	3300015372	Arabidopsis Rhizosphere	DGLQQVIDTNKRIAELSVRAADEAARAIQTQGTANQGRRAA*
Ga0184644_17409611	3300019269	Groundwater Sediment	TNKRIAEVSLRTADEAARAIQAQADKNAKQVRRVA
Ga0207710_102497092	3300025900	Switchgrass Rhizosphere	FVATQSDLMRDGLQQVIDTNKRIAELSVRVAEEAARSIQTQGSQARRAA
Ga0207688_107554831	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	AVQSDLARDGLSQVIDTNKRIAELSVRVAEEAARAIQAQGSGANQGRRAA
Ga0207680_100565703	3300025903	Switchgrass Rhizosphere	LQQVIDTNKRIAELSVRVADEAARAIQAQGNANQGRRAA
Ga0207645_106826162	3300025907	Miscanthus Rhizosphere	QSDLARDDLQQIIATNQRIAELSVRVADEAARIIQTQANSDANQARRAA
Ga0207662_102259801	3300025918	Switchgrass Rhizosphere	IDTNKRIAELSVRVADEAARAIQAQGNANQGRRAA
Ga0207694_116564932	3300025924	Corn Rhizosphere	QSDLERDGLQQVIDTNKRIAELSVRVADEAARAIQAQGNANQSRRAA
Ga0207687_109898711	3300025927	Miscanthus Rhizosphere	VIDTNKRIAELSVRVADEAARAIQAQDNAHQGRRAA
Ga0207644_109883133	3300025931	Switchgrass Rhizosphere	QVIDTNKRIAEVSVRVADEAALSIQAQGDSNANRARAA
Ga0207706_101352643	3300025933	Corn Rhizosphere	DGLQQVIDTNKRIAELSVRVADEAARAIQAQGNANQGRRAA
Ga0207706_115253661	3300025933	Corn Rhizosphere	QSDLVRDGLQQVIDTNRRVAEVSVRIADEAARSIQQAQGNPNQGRRAA
Ga0207709_106811991	3300025935	Miscanthus Rhizosphere	QQIIATNQRIAELSVRVADEAARIIQTQANSDANQARRAA
Ga0207711_113287693	3300025941	Switchgrass Rhizosphere	AIDTNKRVAEVSVRVAEEAARSIQAHGGTNVNRRAA
Ga0207668_101091222	3300025972	Switchgrass Rhizosphere	DGLQQVIDTNKRIAELSVRVADEAARAIQAQGSANQGRRAA
Ga0207668_107766151	3300025972	Switchgrass Rhizosphere	IDTNKRIAELSVRVADEAARAIQTQGNANQGRHAA
Ga0207668_110781532	3300025972	Switchgrass Rhizosphere	DLARDGLSQVIDTNKRIAELSVRVADEAARAIQAQGNANQGRRAA
Ga0207703_102796131	3300026035	Switchgrass Rhizosphere	SQVIDTNKRIAELSVRVAEEAARAIQAQGNANQGRRAA
Ga0207703_109393201	3300026035	Switchgrass Rhizosphere	ARDGLSQVIDTNKRIAELSVRVADEAARAVQAQGSANQGRRAA
Ga0207703_117634861	3300026035	Switchgrass Rhizosphere	VQSDLARDGLQQVIDTNKRIAELSVRVAEEAARAIQAQANQNANQARRAA
Ga0207639_105975443	3300026041	Corn Rhizosphere	VRDGLQQVIDTSKRIAEVSLRIANEASQIIQAQADKN
Ga0207678_109503122	3300026067	Corn Rhizosphere	IETNKRIAEVSLRTADEAARAIQQAQGNANQGRRAA
Ga0207641_124310761	3300026088	Switchgrass Rhizosphere	QLIDTNRRIAELSVRVADEAARAIQAQGNANQDRRAA
Ga0207683_107831473	3300026121	Miscanthus Rhizosphere	QAIDTNKRVAEVSVRVAEEAAHSIQAHGGTNVNRRAA
Ga0207698_106623841	3300026142	Corn Rhizosphere	VRDNLQQVIDTNKRVAEVSVRIADEAARSIQQAQGGTNVNRRAA
Ga0207698_125401651	3300026142	Corn Rhizosphere	QVIDTNKRIAELSVRVADEAARAIQAQDNAHQGRRAA
Ga0207483_1000791	3300026750	Soil	RDDLQQVIDTNKRVAELSVRVADEAAQIIQTQANSDANQARRAA
Ga0308201_103990692	3300031091	Soil	DGIWQVIEINKRIAEVSLRIAEEAARIIETQANQNAKQVRRAA
Ga0308197_104743791	3300031093	Soil	TNKRIAEVSLRTANEAARAIQAQVDQNAKQVRRVA
Ga0314794_142887_3_128	3300034669	Soil	LQQVIETNKRIAEVSIRIADEASRIIQARANQNAQQARRVA
Ga0314798_039808_699_845	3300034673	Soil	SDLVRDGLQQVIDTNKRVAEVSLRIADEAGRIIQAQADKNAKQVRRVA

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign