| Basic Information | |
|---|---|
| Family ID | F055809 |
| Family Type | Metagenome |
| Number of Sequences | 138 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MAKFKAAGSRKAPAARSNAAAIPCLLLILTGAALLSLLFYELLKSS |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 71.74 % |
| % of genes near scaffold ends (potentially truncated) | 31.16 % |
| % of genes from short scaffolds (< 2000 bps) | 86.23 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.638 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere (10.870 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.826 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.522 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.84% β-sheet: 0.00% Coil/Unstructured: 62.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF01138 | RNase_PH | 47.83 |
| PF11992 | TgpA_N | 17.39 |
| PF03725 | RNase_PH_C | 13.04 |
| PF01725 | Ham1p_like | 3.62 |
| PF13701 | DDE_Tnp_1_4 | 1.45 |
| PF14791 | DNA_pol_B_thumb | 1.45 |
| PF13559 | DUF4129 | 0.72 |
| PF00474 | SSF | 0.72 |
| PF00293 | NUDIX | 0.72 |
| PF11700 | ATG22 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 60.87 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 60.87 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 60.87 |
| COG0127 | Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family | Nucleotide transport and metabolism [F] | 3.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.64 % |
| Unclassified | root | N/A | 25.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105656025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1870 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100050213 | Not Available | 609 | Open in IMG/M |
| 3300001849|RCM26_1269815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300004092|Ga0062389_100795674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
| 3300004635|Ga0062388_100345377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1266 | Open in IMG/M |
| 3300005327|Ga0070658_10021656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5152 | Open in IMG/M |
| 3300005327|Ga0070658_10470804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1084 | Open in IMG/M |
| 3300005328|Ga0070676_10186919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1350 | Open in IMG/M |
| 3300005329|Ga0070683_100435639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1251 | Open in IMG/M |
| 3300005330|Ga0070690_100241777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1273 | Open in IMG/M |
| 3300005335|Ga0070666_10676366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 756 | Open in IMG/M |
| 3300005337|Ga0070682_101969410 | Not Available | 513 | Open in IMG/M |
| 3300005338|Ga0068868_101741164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300005339|Ga0070660_101383073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300005344|Ga0070661_101767806 | Not Available | 524 | Open in IMG/M |
| 3300005355|Ga0070671_100897543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 774 | Open in IMG/M |
| 3300005458|Ga0070681_10004023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 13869 | Open in IMG/M |
| 3300005458|Ga0070681_10084952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3117 | Open in IMG/M |
| 3300005459|Ga0068867_100927159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 785 | Open in IMG/M |
| 3300005471|Ga0070698_102142191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300005533|Ga0070734_10670242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300005534|Ga0070735_10127773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1585 | Open in IMG/M |
| 3300005534|Ga0070735_10697334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300005541|Ga0070733_11044948 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005547|Ga0070693_100448445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 905 | Open in IMG/M |
| 3300005563|Ga0068855_100039593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5596 | Open in IMG/M |
| 3300005563|Ga0068855_100364599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1589 | Open in IMG/M |
| 3300005564|Ga0070664_101399380 | Not Available | 661 | Open in IMG/M |
| 3300005617|Ga0068859_100557607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1240 | Open in IMG/M |
| 3300005618|Ga0068864_100251012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1643 | Open in IMG/M |
| 3300005836|Ga0074470_10027126 | Not Available | 759 | Open in IMG/M |
| 3300005836|Ga0074470_10768813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 43944 | Open in IMG/M |
| 3300005836|Ga0074470_11152320 | Not Available | 713 | Open in IMG/M |
| 3300005842|Ga0068858_100051711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3801 | Open in IMG/M |
| 3300005842|Ga0068858_100236599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1732 | Open in IMG/M |
| 3300006028|Ga0070717_11205109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300006041|Ga0075023_100520075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 539 | Open in IMG/M |
| 3300006050|Ga0075028_100233395 | Not Available | 1004 | Open in IMG/M |
| 3300006052|Ga0075029_100106655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1687 | Open in IMG/M |
| 3300006052|Ga0075029_100430086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 862 | Open in IMG/M |
| 3300006059|Ga0075017_100198257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1451 | Open in IMG/M |
| 3300006237|Ga0097621_100615579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
| 3300006237|Ga0097621_100638624 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300006358|Ga0068871_100812001 | Not Available | 863 | Open in IMG/M |
| 3300006358|Ga0068871_100989193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 783 | Open in IMG/M |
| 3300006638|Ga0075522_10058321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 2205 | Open in IMG/M |
| 3300006638|Ga0075522_10184706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300006755|Ga0079222_10266493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1090 | Open in IMG/M |
| 3300006804|Ga0079221_10549654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 764 | Open in IMG/M |
| 3300007265|Ga0099794_10399765 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300009174|Ga0105241_10172046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1790 | Open in IMG/M |
| 3300009174|Ga0105241_10559516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1028 | Open in IMG/M |
| 3300009174|Ga0105241_12202965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300009176|Ga0105242_12482164 | Not Available | 566 | Open in IMG/M |
| 3300009545|Ga0105237_10590164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1118 | Open in IMG/M |
| 3300009545|Ga0105237_11641817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300009545|Ga0105237_12240686 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300010375|Ga0105239_11058017 | Not Available | 934 | Open in IMG/M |
| 3300010379|Ga0136449_102274473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 787 | Open in IMG/M |
| 3300010401|Ga0134121_11945320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 619 | Open in IMG/M |
| 3300012096|Ga0137389_10914423 | Not Available | 753 | Open in IMG/M |
| 3300012189|Ga0137388_11520628 | Not Available | 606 | Open in IMG/M |
| 3300012199|Ga0137383_10894173 | Not Available | 648 | Open in IMG/M |
| 3300012202|Ga0137363_11434140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300012917|Ga0137395_10675149 | Not Available | 747 | Open in IMG/M |
| 3300012923|Ga0137359_10635937 | Not Available | 934 | Open in IMG/M |
| 3300012923|Ga0137359_11642237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300012931|Ga0153915_12747890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 575 | Open in IMG/M |
| 3300013100|Ga0157373_10095898 | Not Available | 2088 | Open in IMG/M |
| 3300013100|Ga0157373_11487386 | Not Available | 517 | Open in IMG/M |
| 3300013297|Ga0157378_10238272 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300014158|Ga0181521_10177177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1193 | Open in IMG/M |
| 3300014167|Ga0181528_10285352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300014495|Ga0182015_10175734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1443 | Open in IMG/M |
| 3300014501|Ga0182024_10604051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1373 | Open in IMG/M |
| 3300014501|Ga0182024_11981085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300014838|Ga0182030_10343284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1603 | Open in IMG/M |
| 3300014838|Ga0182030_10456390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1299 | Open in IMG/M |
| 3300014968|Ga0157379_12068932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300014969|Ga0157376_12284312 | Not Available | 580 | Open in IMG/M |
| 3300015195|Ga0167658_1015310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2238 | Open in IMG/M |
| 3300015195|Ga0167658_1097223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
| 3300020214|Ga0194132_10499531 | Not Available | 601 | Open in IMG/M |
| 3300021432|Ga0210384_10133724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2226 | Open in IMG/M |
| 3300021445|Ga0182009_10549480 | Not Available | 613 | Open in IMG/M |
| 3300025862|Ga0209483_1122885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300025862|Ga0209483_1123142 | Not Available | 1107 | Open in IMG/M |
| 3300025862|Ga0209483_1253088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 679 | Open in IMG/M |
| 3300025899|Ga0207642_10214414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agaridevorans | 1072 | Open in IMG/M |
| 3300025899|Ga0207642_10645111 | Not Available | 663 | Open in IMG/M |
| 3300025900|Ga0207710_10671631 | Not Available | 543 | Open in IMG/M |
| 3300025903|Ga0207680_10016140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3913 | Open in IMG/M |
| 3300025909|Ga0207705_10169113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1645 | Open in IMG/M |
| 3300025909|Ga0207705_10620775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300025911|Ga0207654_10023399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3309 | Open in IMG/M |
| 3300025911|Ga0207654_10284186 | Not Available | 1120 | Open in IMG/M |
| 3300025911|Ga0207654_10513545 | Not Available | 847 | Open in IMG/M |
| 3300025912|Ga0207707_10012079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7510 | Open in IMG/M |
| 3300025912|Ga0207707_10176724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1865 | Open in IMG/M |
| 3300025913|Ga0207695_10091400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3058 | Open in IMG/M |
| 3300025913|Ga0207695_10107865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2770 | Open in IMG/M |
| 3300025913|Ga0207695_10994517 | Not Available | 718 | Open in IMG/M |
| 3300025916|Ga0207663_11649548 | Not Available | 516 | Open in IMG/M |
| 3300025917|Ga0207660_10296869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1286 | Open in IMG/M |
| 3300025924|Ga0207694_10031153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4073 | Open in IMG/M |
| 3300025924|Ga0207694_11043886 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300025927|Ga0207687_10119124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1971 | Open in IMG/M |
| 3300025934|Ga0207686_10082686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2100 | Open in IMG/M |
| 3300025934|Ga0207686_10177737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1507 | Open in IMG/M |
| 3300025934|Ga0207686_11380779 | Not Available | 579 | Open in IMG/M |
| 3300025939|Ga0207665_11008557 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300025944|Ga0207661_11152195 | Not Available | 714 | Open in IMG/M |
| 3300025945|Ga0207679_11203950 | Not Available | 695 | Open in IMG/M |
| 3300026095|Ga0207676_10014679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5642 | Open in IMG/M |
| 3300027894|Ga0209068_10009184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4668 | Open in IMG/M |
| 3300027894|Ga0209068_10897384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300027910|Ga0209583_10724069 | Not Available | 521 | Open in IMG/M |
| 3300027911|Ga0209698_10168809 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300027986|Ga0209168_10382856 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300028379|Ga0268266_11601426 | Not Available | 627 | Open in IMG/M |
| 3300028800|Ga0265338_10290773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1191 | Open in IMG/M |
| 3300030007|Ga0311338_11858190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300031234|Ga0302325_12629557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 596 | Open in IMG/M |
| 3300031236|Ga0302324_100540259 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300031240|Ga0265320_10569784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300031241|Ga0265325_10527740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 511 | Open in IMG/M |
| 3300031708|Ga0310686_110239391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300031720|Ga0307469_10757317 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300031823|Ga0307478_11288360 | Not Available | 608 | Open in IMG/M |
| 3300031962|Ga0307479_10713728 | Not Available | 981 | Open in IMG/M |
| 3300031962|Ga0307479_11879776 | Not Available | 549 | Open in IMG/M |
| 3300032160|Ga0311301_12082846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 658 | Open in IMG/M |
| 3300032163|Ga0315281_10523931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
| 3300032180|Ga0307471_102349525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300032421|Ga0310812_10579971 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300033433|Ga0326726_10562053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300033433|Ga0326726_11509446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300033480|Ga0316620_10260804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1491 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 10.87% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.80% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.62% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.90% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.17% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.17% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.17% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.45% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.45% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.45% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.45% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.45% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.45% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.72% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.72% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.72% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.72% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1056560252 | 3300000364 | Soil | MAKFKAAGSRKAPAARSNAVAIPCLLLILTGAVLLSLLFYELLKSS* |
| JGIcombinedJ13530_1000502132 | 3300001213 | Wetland | MAKFKAAGSRKSPGARSNLAVVPCLLLVLTAAAILSFLFYELLKQST* |
| RCM26_12698152 | 3300001849 | Marine Plankton | MAKFKPAGSRKATNTRSNAAAIPCLFLILTGSAIIAYLFYQVLKSAN* |
| Ga0062389_1007956743 | 3300004092 | Bog Forest Soil | MAKFKAAGSRKAPSARSNAAAIPCLLLILVGAALISLLFYELLKSSG* |
| Ga0062388_1003453773 | 3300004635 | Bog Forest Soil | AGSRKAPSARSNAAAIPCLLLILVGAALISLLFYELLKSSG* |
| Ga0070658_100216565 | 3300005327 | Corn Rhizosphere | MAKFKAAGSRKAPTARSNAAAIPCLLLIVAGVALLSLLFYELLKSS* |
| Ga0070658_104708042 | 3300005327 | Corn Rhizosphere | MAKFKAAGSRKAPAARTNAAAIPCLLLIVLGTALVSLLFYEILKSGS* |
| Ga0070676_101869192 | 3300005328 | Miscanthus Rhizosphere | MAKFKAAGSRKAPTARTNAAAIPCLLLILLGAALISLLFYELLKSGS* |
| Ga0070683_1004356393 | 3300005329 | Corn Rhizosphere | FKAAGSRKAPAARTNAAAIPCLLLIVLGTALVSLLFYEILKSGS* |
| Ga0070690_1002417772 | 3300005330 | Switchgrass Rhizosphere | MAKFKAAGSRKGPAARTNAAAIPCLLLILLGAALISLLFYELLKSGS* |
| Ga0070666_106763662 | 3300005335 | Switchgrass Rhizosphere | MAKFKAAGSRKAPTARSNAAAIPCLLLILGGAALLSLLFYELLKSSN* |
| Ga0070682_1019694101 | 3300005337 | Corn Rhizosphere | LMAKFKAAGSRKAPATRTNAAAIPCLLLIVLGTALVSLLFYEILKSGS* |
| Ga0068868_1017411642 | 3300005338 | Miscanthus Rhizosphere | MAKFKAAGSRKAPAARSNAAAIPCLLLILTGAALLSFLFYELLKSS* |
| Ga0070660_1013830732 | 3300005339 | Corn Rhizosphere | MAKFKAAGSRKAPAARTNAAAIPCLLLIILGTALISLLFYEILKSGS* |
| Ga0070661_1017678062 | 3300005344 | Corn Rhizosphere | KFKAAGSRKAPTARSNAAAIPCLLLILGGAALLSLLFYELLKSSN* |
| Ga0070671_1008975432 | 3300005355 | Switchgrass Rhizosphere | MEVTLPMAKFKAAGSRKAPAARSNAVAIPCLLLILTGAALISLLFYELLKSGS* |
| Ga0070681_100040234 | 3300005458 | Corn Rhizosphere | MAKFKAAGSRKAPTARTNAAAIPCLLLILLGAALISFLFYELLKSGS* |
| Ga0070681_100849522 | 3300005458 | Corn Rhizosphere | MAKFKAAGSRKAPTARSNAAAIPCLLLIVVGVALLSLLFYELLKSS* |
| Ga0068867_1009271592 | 3300005459 | Miscanthus Rhizosphere | MAKFKAAGSRKTTGARSNAAAIPCLLLILTGTAIVVFLFYEVLKSSN* |
| Ga0070698_1021421911 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKFKAAGSRKGPAARTNAAAIPCLLLILLGAALISLLFY |
| Ga0070734_106702421 | 3300005533 | Surface Soil | MAKFKAAGSRKGPAARTNAAAIPCLLLILLGAALVSLLFYELLKSGS* |
| Ga0070735_101277732 | 3300005534 | Surface Soil | MAKFKAVGSRKAAAARSNAAAIPCLLLILAGAALISLLFYELLKSGSS* |
| Ga0070735_106973341 | 3300005534 | Surface Soil | MAKFKAAGSRKAPAARSNAAAIPCLLLILFGAALISLLFYELLKSGS* |
| Ga0070733_110449481 | 3300005541 | Surface Soil | GSRKAPSVRSNAAAIPCLLLILAGAALISLLFYELLKSSG* |
| Ga0070693_1004484452 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKFKAAGSRKAPAARSNAVAIPCLLLILTGAALISLLFYELLKSAS* |
| Ga0068855_1000395936 | 3300005563 | Corn Rhizosphere | MAKFKAAGSRKSPPARSNAAAIPCLLLILVGAALISLLFYEILKSSS* |
| Ga0068855_1003645991 | 3300005563 | Corn Rhizosphere | VLHLEVTVLMAKFKAAGSRKAPTARSNAAAIPCLLLIVAGVALLSLLFYELLKSS* |
| Ga0070664_1013993801 | 3300005564 | Corn Rhizosphere | PTARSNAAAIPCLLLILGGAALLSLLFYELLKSSN* |
| Ga0068859_1005576072 | 3300005617 | Switchgrass Rhizosphere | VLHLGVTVLMAKFKAAGSRKGPAARTNAAAIPCLLLILLGAALISLLFYELLKSGS* |
| Ga0068864_1002510124 | 3300005618 | Switchgrass Rhizosphere | CVTPRSYLLMAKFKAAGSRKAPAARSNAAAIPCLLLILTGAALLSFLFYELLKSS* |
| Ga0074470_100271262 | 3300005836 | Sediment (Intertidal) | MAKFKPAGSRKASSARSNAAAIPCLILILTGSAIIAYLFYQVLKSGS* |
| Ga0074470_1076881315 | 3300005836 | Sediment (Intertidal) | MGKYKPAGARKAEVKKSNARAIPCLILIVVVIALVSLLFYGSLKTQ* |
| Ga0074470_111523202 | 3300005836 | Sediment (Intertidal) | MAKFKAAGSRKAPAARSNAAAIPCLLLILMGAALLSLLFYAVLKSS* |
| Ga0068858_1000517112 | 3300005842 | Switchgrass Rhizosphere | MAKFKAAGSRKAPAARSNAVAIPCLLLILTGAALISLLFYELLKSGS* |
| Ga0068858_1002365992 | 3300005842 | Switchgrass Rhizosphere | MAKFKAAGSRKAPAARSNAVAIPCLLLILAGVALVCLLFYELLKSSS* |
| Ga0070717_112051092 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKFKAAGSRKAPAARSNAAAIPCLLIILVGAALLSLLFYELLKSS* |
| Ga0075023_1005200751 | 3300006041 | Watersheds | MAKFKAAGSRKAPAARSNAVAIPCLLLILAGAALLSLMFYELLKSS* |
| Ga0075028_1002333952 | 3300006050 | Watersheds | MGKYKPAGSRKVEVKKSNARAIPCLILILVGIALVSLLFYELLKSGS* |
| Ga0075029_1001066552 | 3300006052 | Watersheds | MGKYKPAGSRKAEVKKSDARAIPCLIIIIVGIALVSLLFYELLKSGN* |
| Ga0075029_1004300862 | 3300006052 | Watersheds | MHSSIVLHVGVTHPMAKFKAAGSRKSPGARSNLAVVPCALLVLTAAAILSFLFYEILKGS |
| Ga0075017_1001982573 | 3300006059 | Watersheds | MAKFKAAGSRKAPAARSNAVAIPCLLLILAGAAVISFLFYELLKSGN* |
| Ga0097621_1006155792 | 3300006237 | Miscanthus Rhizosphere | MGVTLSMAKFKAAGSRKAPAARSNAAAIPCLLLILTGAALLSLLFYELLKSS* |
| Ga0097621_1006386242 | 3300006237 | Miscanthus Rhizosphere | MAKFKAAGSRKAPAARSNAAAIPCLLLILTGAALISLLFYELLKSGS* |
| Ga0068871_1008120011 | 3300006358 | Miscanthus Rhizosphere | APTARSNAAAIPCLLLILGGAALLSLLFYELLKSSN* |
| Ga0068871_1009891932 | 3300006358 | Miscanthus Rhizosphere | MAKFKAAGSRKAPAARSNAAAIPCLLLILTGAALL |
| Ga0075522_100583212 | 3300006638 | Arctic Peat Soil | MAKFKAAGSRKATPVRTNAAAIPCLLLIVLGTALISLLFYEILKSGS* |
| Ga0075522_101847062 | 3300006638 | Arctic Peat Soil | MAKFKAAGSRKALPARSNAVAIPCLLLILAGVAIVSLLFYELLKSS* |
| Ga0079222_102664932 | 3300006755 | Agricultural Soil | MAKFKAAGSRKAPAARSNAAAIPCLLLILLGAALLSLLFYELLKSS* |
| Ga0079221_105496542 | 3300006804 | Agricultural Soil | MAKFKAAGSRKAPAARSNAAAIPCLLLILLGAALLSLLFYE |
| Ga0099794_103997652 | 3300007265 | Vadose Zone Soil | MAKFKAAGSRKTGSGKTGSSRGKDARSNLAAVPCLLLILTGAAIISFLFYELLKQSS* |
| Ga0105241_101720463 | 3300009174 | Corn Rhizosphere | MARFKAAGSRKAPTARSNAAAIPCLLLIVAGVVLISLMFYELLKSS* |
| Ga0105241_105595162 | 3300009174 | Corn Rhizosphere | MAKFKAAGSRKAPAARSNAAAIPCLLLILTGAALLSLLFYELLKSS* |
| Ga0105241_122029651 | 3300009174 | Corn Rhizosphere | MAKFKAAGSRKAPAARTNAAAIPCLLLIVLGTALVSL |
| Ga0105242_124821641 | 3300009176 | Miscanthus Rhizosphere | SPMAKFKAAGSRKAPAARSNAVAIPCLLLILAGVALVCLLFYELLKSSS* |
| Ga0105237_105901642 | 3300009545 | Corn Rhizosphere | MAKFKAAGSRKGPAARTNAAAIPCLLLILVGAALISLLSYELLKSGS* |
| Ga0105237_116418171 | 3300009545 | Corn Rhizosphere | MARFKAAGSRKAPTARSNAAAIPCLLLIVAGVVLISLMF |
| Ga0105237_122406861 | 3300009545 | Corn Rhizosphere | APAARSNAVAIPCLLLILAGVALVCLLFYELLKSSS* |
| Ga0105239_110580172 | 3300010375 | Corn Rhizosphere | MAKFKAAGSRKPPTARSNAAAIPCLLLILLGAALLSLMFYELLKSS* |
| Ga0136449_1022744732 | 3300010379 | Peatlands Soil | MAKFKSAGSRKSSGARSNLAVVPCALLVLTAAAILSFLFYEILKGS* |
| Ga0134121_119453202 | 3300010401 | Terrestrial Soil | GSRKAPAARSNAAAIPCLLLILAGAALISLLFYELLKSGS* |
| Ga0137389_109144232 | 3300012096 | Vadose Zone Soil | MAKFKAAGSRKAGSGKTGSSRGKDARSNLAAVPCLLLILTGAAIISFLFYELLKQSS* |
| Ga0137388_115206282 | 3300012189 | Vadose Zone Soil | MAKFKAAGSRKAGSGKTGSSKGKDARSNLAAVPCLLLILTGAAIISFLFYELLKQSS* |
| Ga0137383_108941732 | 3300012199 | Vadose Zone Soil | MAKFKAAGSRKTGSGKTGSSRGKDALSNLAAVPCLLLILTGAAIISFLFYELLKQSS* |
| Ga0137363_114341401 | 3300012202 | Vadose Zone Soil | MAKFKAAGSRKPGSGKTGSSRGKDARSNLAAVPCLLLILTGAAIISFLFYELLK |
| Ga0137395_106751492 | 3300012917 | Vadose Zone Soil | MAKFKAAGSRKAPAARTNAAAIPCLLIILAGAALLSLLFYELLKSS* |
| Ga0137359_106359372 | 3300012923 | Vadose Zone Soil | MAKFKAAGSRKAPAARSNAVAIPCLLLILGGAALISLLFYELLKSGS* |
| Ga0137359_116422372 | 3300012923 | Vadose Zone Soil | MAKFKAAGSRKAAGARSNAAAIPCLLLILTGTAIVVFLFYEVLKSSN* |
| Ga0153915_127478901 | 3300012931 | Freshwater Wetlands | MAKFKPAGSRKSSSARSNAAAIPCLILILTGSAIIAYLFYQV |
| Ga0157373_100958982 | 3300013100 | Corn Rhizosphere | MAKFKAAGSRKAPTARSNAAAIPCLLLIVVGVALLSLLFYELLKFS* |
| Ga0157373_114873861 | 3300013100 | Corn Rhizosphere | FKAAGSRKAPATRTNAAAIPCLLLIVLGTALVSLLFYEILKSGS* |
| Ga0157378_102382721 | 3300013297 | Miscanthus Rhizosphere | MAKFKAAGSRKAPAARSNAAAIPCLLLILLGAALLSLL |
| Ga0181521_101771772 | 3300014158 | Bog | MAKFKAAGSRKSSGARSNLAVVPCALLVLTAAAILSFLFYEILKGS* |
| Ga0181528_102853522 | 3300014167 | Bog | MAKFKAAGSRKAPAARSNAAAIPCLLIILIGAALLSLLFYELLKSSG* |
| Ga0182015_101757342 | 3300014495 | Palsa | MAKFKAAGSRKAPGARSNLAVVPCALLVLTAAAILTFLFYEILKQGS* |
| Ga0182024_106040511 | 3300014501 | Permafrost | MAKFKAAGSRKAPAARSNAVAIPCLLLILAGAALLSLLFYELLKSGN* |
| Ga0182024_119810852 | 3300014501 | Permafrost | MAKFKAAGSRKAPAARSNAVAIPCLLLVLAGAALLSLLFYELLKSS* |
| Ga0182030_103432842 | 3300014838 | Bog | MAKFKAAGSRKAPAARSNAAAIPCLLIVLVGAALLSLLFYELLK |
| Ga0182030_104563902 | 3300014838 | Bog | MAKFKAAGSRKAPGARSNLAVVPCALLVLTAASILTFLFYEILKQGS* |
| Ga0157379_120689321 | 3300014968 | Switchgrass Rhizosphere | MAKFKAAGSRKAPAARSNAAAIPCLLLILTGAALLSL |
| Ga0157376_122843121 | 3300014969 | Miscanthus Rhizosphere | TVLMAKFKAAGSRKAPAARSNAAAIPCLLLILTGAALISLLFYELLKSGS* |
| Ga0167658_10153102 | 3300015195 | Glacier Forefield Soil | MAKIKAAGSRKIPATRTNAAAIPCLLLILVGAALISLLFYELLKSSS* |
| Ga0167658_10972231 | 3300015195 | Glacier Forefield Soil | KAPVARSNAAAIPCLLLILLGAALLSLMFYELLKSS* |
| Ga0194132_104995311 | 3300020214 | Freshwater Lake | MAKFKAAGKRKSGTERSNRSAIPCLILILGGIALISLLFYEILKSGS |
| Ga0210384_101337244 | 3300021432 | Soil | MAKFKAAGSRKAPAARSNAVAIPCLLLILFGAALLSLLFYELLKSSS |
| Ga0182009_105494802 | 3300021445 | Soil | AAREKFRCVTPRSYLLMAKFKAAGSRKAPAARSNAAAIPCLLLILLGAALLSLLFYELLKSS |
| Ga0209483_11228852 | 3300025862 | Arctic Peat Soil | MAKFKAAGSRKALPARSNAVAIPCLLLILAGVAIVSLLFYELLKSS |
| Ga0209483_11231423 | 3300025862 | Arctic Peat Soil | MAKFKAAGSRKAPAKRSNAAAIPCLLLILVGAALISLLFYELLKSGS |
| Ga0209483_12530881 | 3300025862 | Arctic Peat Soil | MAKFKAAGSRKAIPARTNAAAIPCLLLIVLGTALISL |
| Ga0207642_102144142 | 3300025899 | Miscanthus Rhizosphere | HLGVTHLMAKFKAAGSRKAPTARTNAAAIPCLLLILLGAALISLLFYELLKSGS |
| Ga0207642_106451111 | 3300025899 | Miscanthus Rhizosphere | KAAGSRKGPAARTNAAAIPCLLLILLGAALISLLFYELLKSGS |
| Ga0207710_106716312 | 3300025900 | Switchgrass Rhizosphere | MAKFKAAGSRKAPAARSNAAAIPCLLLILTGAALLSFLFYELLKSS |
| Ga0207680_100161405 | 3300025903 | Switchgrass Rhizosphere | MAKFKAAGSRKGPAARTNAAAIPCLLLILLGAALISLLFYELLKSGS |
| Ga0207705_101691132 | 3300025909 | Corn Rhizosphere | MAKFKAAGSRKAPTARSNAAAIPCLLLIVAGVALLSLLFYELLKSS |
| Ga0207705_106207752 | 3300025909 | Corn Rhizosphere | MAKFKAAGSRKAPAARTNAAAIPCLLLIVLGTALVSLLFYEILKSGS |
| Ga0207654_100233994 | 3300025911 | Corn Rhizosphere | MAKFKAAGSRKAPAARSNAAAIPCLLLILLGAALLSLLFYELLKSS |
| Ga0207654_102841862 | 3300025911 | Corn Rhizosphere | MARFKAAGSRKAPTARSNAAAIPCLLLIVAGVVLISLMFYELLKSS |
| Ga0207654_105135452 | 3300025911 | Corn Rhizosphere | MAKFKAAGSRKAPAARSNAAAIPCLLLILTGAALLSLLFYELLKSS |
| Ga0207707_100120795 | 3300025912 | Corn Rhizosphere | MAKFKAAGSRKAPTARTNAAAIPCLLLILLGAALISFLFYELLKSGS |
| Ga0207707_101767242 | 3300025912 | Corn Rhizosphere | MAKFKAAGSRKAPTARSNAAAIPCLLLIVVGVALLSLLFYELLKSS |
| Ga0207695_100914002 | 3300025913 | Corn Rhizosphere | MAKFKAAGSRKAPAARTNAAAIPCLLLIILGTALISLLFYEILKSGS |
| Ga0207695_101078652 | 3300025913 | Corn Rhizosphere | MAKFKAAGSRKSPPARSNAAAIPCLLLILVGAALISLLFYEILKSSS |
| Ga0207695_109945172 | 3300025913 | Corn Rhizosphere | AREKFRCVTPRSYLLMAKFKAAGSRKAPAARSNAAAIPCLLLILLGAALLSLLFYELLKS |
| Ga0207663_116495481 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | KAPAARSNAAAIPCLLLILFGAALLSLLFYELLKSS |
| Ga0207660_102968691 | 3300025917 | Corn Rhizosphere | MAKFKAAGSRKAPTARTNAAAIPCLLLILLGAALISLLFYELLK |
| Ga0207694_100311533 | 3300025924 | Corn Rhizosphere | MAKFKAAGSRKAPTARSNAAAIPCLLLILGGAALLSLLFYELLKSSN |
| Ga0207694_110438862 | 3300025924 | Corn Rhizosphere | IVLHLGVTHLMAKFKAAGSRKAPTARTNAAAIPCLLLILLGAALISFLFYELLKSGS |
| Ga0207687_101191242 | 3300025927 | Miscanthus Rhizosphere | MAKFKAAGSRKAPAARSNAVAIPCLLLILTGAALISLLFYELLKSGS |
| Ga0207686_100826863 | 3300025934 | Miscanthus Rhizosphere | MAKFKAAGSRKAPAARSNAVAIPCLLLILTGAALISLLFYELLKSGN |
| Ga0207686_101777372 | 3300025934 | Miscanthus Rhizosphere | MAKFKAAGSRKTTGARSNAAAIPCLLLILTGTAIVVFLFYEVLKSSN |
| Ga0207686_113807791 | 3300025934 | Miscanthus Rhizosphere | AKFKAAGSRKAPAARSNAVAIPCLLLILAGVALVCLLFYELLKSSS |
| Ga0207665_110085571 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | KFKAAGSRKAPAARTNAAAIPCLLIILAGAALLSLLFYELLKSS |
| Ga0207661_111521951 | 3300025944 | Corn Rhizosphere | FKAAGSRKAPAARTNAAAIPCLLLIVLGTALVSLLFYEILKSGS |
| Ga0207679_112039502 | 3300025945 | Corn Rhizosphere | FRCVTPRSYLLMAKFKAAGSRKAPAARSNAAAIPCLLLILLGAALLSLLFYELLKSS |
| Ga0207676_100146791 | 3300026095 | Switchgrass Rhizosphere | VYTAGLYPCVTPRSYLLMAKFKAAGSRKAPAARSNAAAIPCLLLILTGAALLSFLFYELLKSS |
| Ga0209068_100091845 | 3300027894 | Watersheds | MAKFKAAGSRKAPAARTNAAAIPCLLIILVGAALLSLLFYELLKSS |
| Ga0209068_108973842 | 3300027894 | Watersheds | MAKFKAAGSRKAPAARSNAVAIPCLLLILAGAALLSLMFYELLKSS |
| Ga0209583_107240692 | 3300027910 | Watersheds | MGKYKPAGSRKTTAKQSNARAIPCLILIAGGIALISILFYALLKSGT |
| Ga0209698_101688093 | 3300027911 | Watersheds | MAKFKAAGSRKAPAARSNAVAIPCLLLILAGAAVISFLFYELLKSGN |
| Ga0209168_103828561 | 3300027986 | Surface Soil | LRVTVLMAKFKAVGSRKAAAARSNAAAIPCLLLILAGAALISLLFYELLKSGSS |
| Ga0268266_116014261 | 3300028379 | Switchgrass Rhizosphere | VLMSKFKAAGSRKAPTARTNAAAIPCLLLILLGAALISFLFYELLKSGS |
| Ga0265338_102907732 | 3300028800 | Rhizosphere | MAKFKAAGSRKAPATRTNAAAIPCGLLILLGAALLSLLFYELLKSGS |
| Ga0311338_118581902 | 3300030007 | Palsa | MAKFKAAGSRKAPSARSNAAAIPCLLLILAGAALISFLFYELLKSTG |
| Ga0302325_126295571 | 3300031234 | Palsa | MAKFKAAGSRKAPAARSNAAAIPCLLIVLVGAALLSL |
| Ga0302324_1005402593 | 3300031236 | Palsa | MAKFKAAGSRKAPAARSNAAAIPCLLIVLVGAALLSLLFYELLKSSG |
| Ga0265320_105697842 | 3300031240 | Rhizosphere | MAKFKAAGSRKPASARSNLAVVPCLLLVLTAAAILSFLFYELLRQSN |
| Ga0265325_105277402 | 3300031241 | Rhizosphere | MAKFKAAGSRKAPAARSNAAAIPCLLLIILGAALISLLFYELLKSGS |
| Ga0310686_1102393912 | 3300031708 | Soil | MAKFKAAGSRKPSAARSNAAAIPCFVIILVGTALIAFLFYEMLKSS |
| Ga0307469_107573172 | 3300031720 | Hardwood Forest Soil | MGVTLLMAKFKAAGSRKAPAARSNAAAIPCLLLILTGAALLSLLFYELLKSS |
| Ga0307478_112883602 | 3300031823 | Hardwood Forest Soil | MAKFKAAGSRKAPAARSNAAAIPCLLLILFGAALISLLFYELLKSGS |
| Ga0307479_107137282 | 3300031962 | Hardwood Forest Soil | MAKFKAAGSRKAPTARTNAAAIPCLLIILVGAALLSLLFYELLKSS |
| Ga0307479_118797762 | 3300031962 | Hardwood Forest Soil | VCYTYGSYPSMAKFKAAGSRKAPAARSNAVAIPCLLLILAGAALLSLLFYELLKSS |
| Ga0311301_120828462 | 3300032160 | Peatlands Soil | MAKFKSAGSRKSSGARSNLAVVPCALLVLTAAAILSFLFYEILKGS |
| Ga0315281_105239312 | 3300032163 | Sediment | MAKFKAAGSRKAAGARSNAAVIPCALLILAGAAILGFLFYEVLKSGN |
| Ga0307471_1023495252 | 3300032180 | Hardwood Forest Soil | MAKFKAAGSRKAPAARSNLAAIPCLLLILAGAALISLLFYELLKSGS |
| Ga0310812_105799712 | 3300032421 | Soil | LLMAKFKAAGSRKAPAARSNAAAIPCLLLILLGAALLSLLFYELLKSS |
| Ga0326726_105620532 | 3300033433 | Peat Soil | MAKFKAAGSRKSSSARSNLAVVPCLLVVLTAAAILSFLFYELLKQS |
| Ga0326726_115094462 | 3300033433 | Peat Soil | MAKFKAAGSRKAPAARSNAAAIPCLLLILTGVGLLSLLFYELLKSS |
| Ga0316620_102608042 | 3300033480 | Soil | MAKFKAAGSRKSPGARSNLAVVPCLLLVLTAAAILSFLFYELLKQST |
| ⦗Top⦘ |