Metagenome / Metatranscriptome Family F055806

Overview

Basic Information

• Family ID: F055806
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 138
• Average Sequence Length: 40 residues
• Representative Sequence: ELSEYAVAAALVALAAVAAFQLLGTNIGTKINELAGKIK
• Number of Associated Samples: 119
• Number of Associated Scaffolds: 138

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 4.35 %
• % of genes near scaffold ends (potentially truncated): 95.65 %
• % of genes from short scaffolds (< 2000 bps): 95.65 %
• Associated GOLD sequencing projects: 113
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (88.406 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.696 % of family members)
• Environment Ontology (ENVO): Unclassified (44.203 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (56.522 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 55.22%
  β-sheet: 0.00%
  Coil/Unstructured: 44.78%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 138 Family Scaffolds
PF01478	Peptidase_A24	54.35
PF04964	Flp_Fap	12.32
PF16976	RcpC	5.07
PF08666	SAF	4.35
PF13629	T2SS-T3SS_pil_N	1.45
PF01656	CbiA	0.72
PF07992	Pyr_redox_2	0.72
PF02310	B12-binding	0.72
PF13144	ChapFlgA	0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 138 Family Scaffolds
COG3847	Flp pilus assembly protein, pilin Flp	Extracellular structures [W]	12.32

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	88.41 %
Unclassified	root	N/A	11.59 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	88.41 %
Unclassified	root	N/A	11.59 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	88.41 %
Unclassified	root	N/A	11.59 %

Level 4

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	39.13 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	21.01 %
Unclassified	root	N/A	11.59 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.72 %

Level 5

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	19.57 %
Unclassified	root	N/A	11.59 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	10.87 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.72 %

Level 6

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	19.57 %
Unclassified	root	N/A	11.59 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	10.14 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.72 %

Level 7

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	19.57 %
Unclassified	root	N/A	11.59 %
Marinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae	8.70 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	1.45 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.72 %

Level 8

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	19.57 %
Unclassified	root	N/A	11.59 %
Marinobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter	8.70 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	1.45 %
Mycobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	0.72 %

Level 9

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	19.57 %
Unclassified	root	N/A	11.59 %
Marinobacter lipolyticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	7.25 %
Marinobacter pelagius	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter pelagius	1.45 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	1.45 %
Mycobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	0.72 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2162886011|MRS1b_contig_3343649	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	803
3300000559|F14TC_100869865	All Organisms → cellular organisms → Bacteria	1169
3300000787|JGI11643J11755_11616757	Not Available	556
3300003324|soilH2_10012145	All Organisms → cellular organisms → Bacteria	1281
3300004114|Ga0062593_102615291	All Organisms → cellular organisms → Bacteria → Proteobacteria	573
3300004114|Ga0062593_102620571	All Organisms → cellular organisms → Bacteria → Proteobacteria	573
3300004156|Ga0062589_102685291	All Organisms → cellular organisms → Bacteria → Proteobacteria	518
3300004267|Ga0066396_10111306	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	516
3300004480|Ga0062592_101718103	All Organisms → cellular organisms → Bacteria	611
3300005093|Ga0062594_100878101	All Organisms → cellular organisms → Bacteria	843
3300005184|Ga0066671_10016234	All Organisms → cellular organisms → Bacteria → Proteobacteria	3174
3300005294|Ga0065705_10314374	All Organisms → cellular organisms → Bacteria → Proteobacteria	1024
3300005334|Ga0068869_100888047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	771
3300005340|Ga0070689_100621855	All Organisms → cellular organisms → Bacteria	937
3300005355|Ga0070671_100092260	All Organisms → cellular organisms → Bacteria → Proteobacteria	2537
3300005365|Ga0070688_101422334	All Organisms → cellular organisms → Bacteria → Proteobacteria	562
3300005444|Ga0070694_100113456	All Organisms → cellular organisms → Bacteria	1934
3300005444|Ga0070694_100711120	All Organisms → cellular organisms → Bacteria → Proteobacteria	818
3300005468|Ga0070707_101350487	All Organisms → cellular organisms → Bacteria	679
3300005536|Ga0070697_100824794	All Organisms → cellular organisms → Bacteria	821
3300005547|Ga0070693_101648316	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	505
3300005549|Ga0070704_100225304	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	1526
3300005549|Ga0070704_101201119	All Organisms → cellular organisms → Bacteria	692
3300005562|Ga0058697_10646267	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	557
3300005578|Ga0068854_101671417	All Organisms → cellular organisms → Bacteria → Proteobacteria	582
3300005617|Ga0068859_100301201	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	1696
3300005617|Ga0068859_100868825	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	987
3300005617|Ga0068859_101406391	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	769
3300005840|Ga0068870_11334442	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	524
3300005841|Ga0068863_100507888	All Organisms → cellular organisms → Bacteria → Proteobacteria	1187
3300005879|Ga0075295_1003898	All Organisms → cellular organisms → Bacteria → Proteobacteria	1297
3300005886|Ga0075286_1029866	All Organisms → cellular organisms → Bacteria → Proteobacteria	716
3300005887|Ga0075292_1056411	All Organisms → cellular organisms → Bacteria	576
3300006049|Ga0075417_10537947	All Organisms → cellular organisms → Bacteria	590
3300006237|Ga0097621_100848824	All Organisms → cellular organisms → Bacteria → Acidobacteria	848
3300006844|Ga0075428_101731581	All Organisms → cellular organisms → Bacteria	652
3300006845|Ga0075421_101468900	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	747
3300006854|Ga0075425_100910972	All Organisms → cellular organisms → Bacteria	1005
3300006954|Ga0079219_12084291	All Organisms → cellular organisms → Bacteria	542
3300009011|Ga0105251_10640493	All Organisms → cellular organisms → Bacteria	507
3300009038|Ga0099829_10978949	All Organisms → cellular organisms → Bacteria → Acidobacteria	702
3300009092|Ga0105250_10287765	Not Available	708
3300009093|Ga0105240_11357394	All Organisms → cellular organisms → Bacteria → Acidobacteria	748
3300009100|Ga0075418_11861903	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	655
3300009101|Ga0105247_10743389	All Organisms → cellular organisms → Bacteria	743
3300009101|Ga0105247_11097306	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	627
3300009148|Ga0105243_10607205	All Organisms → cellular organisms → Bacteria → Acidobacteria	1054
3300009156|Ga0111538_12720105	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	620
3300009174|Ga0105241_10244089	All Organisms → cellular organisms → Bacteria	1520
3300009174|Ga0105241_10687062	All Organisms → cellular organisms → Bacteria → Acidobacteria	933
3300009176|Ga0105242_10362076	All Organisms → cellular organisms → Bacteria → Acidobacteria	1343
3300009177|Ga0105248_10353977	All Organisms → cellular organisms → Bacteria	1653
3300009177|Ga0105248_10532462	All Organisms → cellular organisms → Bacteria	1325
3300009177|Ga0105248_13240065	All Organisms → cellular organisms → Bacteria → Acidobacteria	518
3300009551|Ga0105238_10015460	All Organisms → cellular organisms → Bacteria → Proteobacteria	7724
3300009553|Ga0105249_10318225	All Organisms → cellular organisms → Bacteria → Acidobacteria	1566
3300009840|Ga0126313_10833144	Not Available	751
3300010037|Ga0126304_10092561	All Organisms → cellular organisms → Bacteria → Acidobacteria	1901
3300010041|Ga0126312_11201450	Not Available	559
3300010044|Ga0126310_10441612	All Organisms → cellular organisms → Bacteria → Acidobacteria	937
3300010045|Ga0126311_11227297	Not Available	621
3300010146|Ga0126320_1148896	Not Available	592
3300010146|Ga0126320_1226454	All Organisms → cellular organisms → Bacteria → Acidobacteria	515
3300010303|Ga0134082_10414405	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	578
3300010375|Ga0105239_11553507	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	765
3300010396|Ga0134126_11201806	All Organisms → cellular organisms → Bacteria → Acidobacteria	842
3300010397|Ga0134124_10670861	All Organisms → cellular organisms → Bacteria → Acidobacteria	1023
3300010400|Ga0134122_11757566	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	650
3300010401|Ga0134121_11288542	Not Available	735
3300011119|Ga0105246_12271365	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	529
3300011333|Ga0127502_10015688	Not Available	502
3300011412|Ga0137424_1041805	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	807
3300012092|Ga0136621_1088894	All Organisms → cellular organisms → Bacteria → Proteobacteria	1258
3300012186|Ga0136620_10359784	All Organisms → cellular organisms → Bacteria	625
3300012207|Ga0137381_10334968	All Organisms → cellular organisms → Bacteria → Acidobacteria	1319
3300012212|Ga0150985_106345167	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	691
3300012212|Ga0150985_108251530	All Organisms → cellular organisms → Bacteria	1747
3300012469|Ga0150984_108903885	Not Available	624
3300012469|Ga0150984_116132494	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	540
3300012909|Ga0157290_10207205	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	670
3300012912|Ga0157306_10354484	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	558
3300012923|Ga0137359_10351469	All Organisms → cellular organisms → Bacteria → Acidobacteria	1310
3300012961|Ga0164302_11508919	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	554
3300013100|Ga0157373_11092345	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	598
3300013100|Ga0157373_11538806	All Organisms → cellular organisms → Bacteria → Acidobacteria	508
3300013102|Ga0157371_11564536	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	515
3300013297|Ga0157378_12102444	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	615
3300013308|Ga0157375_10807280	All Organisms → cellular organisms → Bacteria	1087
3300014325|Ga0163163_10537209	All Organisms → cellular organisms → Bacteria → Acidobacteria	1231
3300014968|Ga0157379_11025710	All Organisms → cellular organisms → Bacteria → Acidobacteria	787
3300014968|Ga0157379_11138767	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	748
3300015161|Ga0167623_1000072	All Organisms → cellular organisms → Bacteria	49104
3300015241|Ga0137418_10696569	All Organisms → cellular organisms → Bacteria → Acidobacteria	780
3300015374|Ga0132255_106112437	Not Available	509
3300017789|Ga0136617_10459582	All Organisms → cellular organisms → Bacteria	1018
3300018429|Ga0190272_12103771	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	602
3300018466|Ga0190268_11511254	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	584
3300018920|Ga0190273_11063590	All Organisms → cellular organisms → Bacteria → Acidobacteria	674
3300019142|Ga0193597_1019061	All Organisms → cellular organisms → Bacteria	2456
3300019767|Ga0190267_10653182	All Organisms → cellular organisms → Bacteria → Acidobacteria	665
3300025900|Ga0207710_10120262	All Organisms → cellular organisms → Bacteria	1254
3300025904|Ga0207647_10162894	All Organisms → cellular organisms → Bacteria	1300
3300025935|Ga0207709_11699339	All Organisms → cellular organisms → Bacteria → Acidobacteria	525
3300025936|Ga0207670_10667697	All Organisms → cellular organisms → Bacteria → Acidobacteria	858
3300025936|Ga0207670_11545833	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	564
3300025940|Ga0207691_10355844	All Organisms → cellular organisms → Bacteria → Acidobacteria	1252
3300025940|Ga0207691_10525476	All Organisms → cellular organisms → Bacteria	1004
3300025981|Ga0207640_10955312	Not Available	751
3300025981|Ga0207640_11487543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus	608
3300026020|Ga0208531_1026840	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	528
3300026023|Ga0207677_10450690	All Organisms → cellular organisms → Bacteria	1102
3300026035|Ga0207703_10027243	All Organisms → cellular organisms → Bacteria	4500
3300026089|Ga0207648_11268773	Not Available	692
3300026095|Ga0207676_10175567	All Organisms → cellular organisms → Bacteria	1871
3300027846|Ga0209180_10514118	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	669
3300028379|Ga0268266_12216151	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	521
3300028802|Ga0307503_10711915	All Organisms → cellular organisms → Bacteria → Acidobacteria	565
3300030990|Ga0308178_1015207	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1148
3300031093|Ga0308197_10440787	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter pelagius	520
3300031424|Ga0308179_1028428	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	651
3300031716|Ga0310813_11524917	Not Available	623
3300031854|Ga0310904_10132741	All Organisms → cellular organisms → Bacteria	1422
3300031911|Ga0307412_10274486	All Organisms → cellular organisms → Bacteria	1321
3300032004|Ga0307414_11514407	All Organisms → cellular organisms → Bacteria → Acidobacteria	624
3300032075|Ga0310890_10707753	Not Available	790
3300032174|Ga0307470_11930942	Not Available	503
3300032180|Ga0307471_102550337	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	647
3300034027|Ga0334949_039698	All Organisms → cellular organisms → Bacteria	1343
3300034135|Ga0334929_055421	All Organisms → cellular organisms → Bacteria	819
3300034151|Ga0364935_0115554	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	833
3300034661|Ga0314782_068787	All Organisms → cellular organisms → Bacteria	745
3300034665|Ga0314787_080667	All Organisms → cellular organisms → Bacteria	579
3300034666|Ga0314788_081769	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter pelagius	697
3300034667|Ga0314792_229325	All Organisms → cellular organisms → Bacteria	534
3300034673|Ga0314798_101110	All Organisms → cellular organisms → Bacteria → Acidobacteria	610
3300034673|Ga0314798_137332	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	549
3300034673|Ga0314798_151728	Not Available	530
3300034678|Ga0314803_017980	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1023

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	56.52%
Host-Associated	Host-Associated	43.48%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	51.45%
Plants	Host-Associated → Plants	43.48%
Aquatic	Environmental → Aquatic	5.07%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	50.72%
Rhizosphere	Host-Associated → Plants → Rhizosphere	28.26%
Rhizoplane	Host-Associated → Plants → Rhizoplane	13.04%
Freshwater	Environmental → Aquatic → Freshwater	4.35%
Roots	Host-Associated → Plants → Roots	1.45%
Sediment	Environmental → Aquatic → Sediment	0.72%
Floodplain	Environmental → Terrestrial → Floodplain	0.72%
Phylloplane	Host-Associated → Plants → Phylloplane	0.72%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	36.23%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	23.91%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	10.14%
Loam	Environmental → Terrestrial → Soil → Loam	9.42%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.35%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.90%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.90%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	2.17%
Ice	Environmental → Aquatic → Freshwater → Ice	2.17%
Soil Crust	Environmental → Terrestrial → Soil → Soil Crust	1.45%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.45%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.72%
Sand	Environmental → Terrestrial → Soil → Sand	0.72%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.72%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	0.72%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	23.91%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	21.01%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	10.14%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	7.25%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	7.97%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	5.07%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.35%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.90%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.90%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	2.17%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	2.17%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.45%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.45%
Unclassified	Environmental → Terrestrial → Soil → Soil Crust → Unclassified	1.45%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.45%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.72%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.72%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.72%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.72%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.72%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	0.72%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	8.70%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	7.25%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	6.52%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.07%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.35%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.35%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.62%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	3.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	3.62%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.62%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.90%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	2.90%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	2.90%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.90%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.90%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.90%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	2.17%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	2.17%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.45%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.45%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.45%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.45%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.45%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.45%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.45%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.45%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	1.45%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.72%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.72%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.72%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.72%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.72%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.72%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.72%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.72%
Biocrust	Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust	0.72%
Hypolithic Biocrust	Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust	0.72%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.72%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.72%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.72%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.72%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.72%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	0.72%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2162886011	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental
3300000787	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental
3300003324	Sugarcane bulk soil Sample H2	Environmental
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental
3300004267	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio	Environmental
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental
3300005562	Agave microbial communities from Guanajuato, Mexico - As.Ma.e	Host-Associated
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005879	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301	Environmental
3300005886	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205	Environmental
3300005887	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403	Environmental
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Host-Associated
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental
3300010146	Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)	Environmental
3300010303	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015	Environmental
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated
3300011333	Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)	Environmental
3300011412	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2	Environmental
3300012092	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06)	Environmental
3300012186	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06)	Environmental
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated
3300012909	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1	Environmental
3300012912	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2	Environmental
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300015161	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin)	Environmental
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental
3300015374	Col-0 rhizosphere combined assembly	Host-Associated
3300017789	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)	Environmental
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental
3300019142	Soil crust microbial communities from Colorado Plateau, Utah, USA - mid late stage, 3 min after wetting v1	Environmental
3300019767	Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T	Environmental
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated
3300026020	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 (SPAdes)	Environmental
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental
3300030990	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)	Environmental
3300031093	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)	Environmental
3300031424	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome)	Environmental
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated
3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Host-Associated
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental
3300034027	Biocrust microbial communities from Mojave Desert, California, United States - 45SNC	Environmental
3300034135	Biocrust microbial communities from Mojave Desert, California, United States - 25HNC	Environmental
3300034151	Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17	Environmental
3300034661	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)	Environmental
3300034665	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome)	Environmental
3300034666	Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome)	Environmental
3300034667	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome)	Environmental
3300034673	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome)	Environmental
3300034678	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome)	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
MRS1b_0515.00001930	2162886011	Miscanthus Rhizosphere	TGLELSEYAVAAALIALATVAAFQLLGTNIAGKITGLANTVK
F14TC_1008698651	3300000559	Soil	ETGLELSEYAVAAALVAIAVVAAFTLLGTNIGIRINQLANTINPSS*
JGI11643J11755_116167573	3300000787	Soil	YAVAAALVALACVAAFQLLGTNIGIKINELAGKIQ*
soilH2_100121451	3300003324	Sugarcane Root And Bulk Soil	AAALVALACVAAFQLLGSSIGTKINGLANTINTGSTTTP*
Ga0062593_1026152911	3300004114	Soil	GLELSEYAVAAALIAMACALAFTTLGGAIGNKINTLASTISG*
Ga0062593_1026205711	3300004114	Soil	GLELSEYAVAAALVAMAAVVAFRTLGTNIAAKITELATTITGQ*
Ga0062589_1026852911	3300004156	Soil	VAAALVALACVAAFQLLGSSIGTKINSLAGTINSGSTTP*
Ga0066396_101113061	3300004267	Tropical Forest Soil	MIRKFLSDESGMELAEYAAAAALVTLATVAAFQLLGTNIMGRITDLASIVK*
Ga0062592_1017181031	3300004480	Soil	EYAVAAALVALACVAAFQLLGSSIGTKINSLAGTINSGSTTP*
Ga0062594_1008781012	3300005093	Soil	LELSEYAVAAALVALATVAAFTVLSSKIATRITTLGNYIP*
Ga0066671_100162341	3300005184	Soil	LSEYAVAAALIALAVITAFTALGTNIGTKITSLANTVNG*
Ga0065705_103143743	3300005294	Switchgrass Rhizosphere	ETGLELSEYAVAAALVALACVVAYQTLGTNIGARIETLAGYIQF*
Ga0068869_1008880474	3300005334	Miscanthus Rhizosphere	ELSEYAVAAALIALACVAAFQLLGTNIGTKINDLAGKIK*
Ga0070689_1006218553	3300005340	Switchgrass Rhizosphere	ETGLELSEYAVAAALIALATVAAFQLLGTNIAGKITGLANTVK*
Ga0070671_1000922601	3300005355	Switchgrass Rhizosphere	GLELSEYAVAAALIALATVAAFQLLGTNIAGKITGLANTVK*
Ga0070688_1014223341	3300005365	Switchgrass Rhizosphere	YAVAAALVALACVAAFQLLGSSIGTKINSLAGTINSGSTTP*
Ga0070694_1001134561	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	EYAVAAALVALACVAAFQLLGSSIGTKINSLAGTINTGSTTP*
Ga0070694_1007111201	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	GLELSEYAVAAALIALACVLAFTALGTNIGARIQSLADTIGQ*
Ga0070707_1013504872	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	GLELSEYAVAAALIALATVTAFQLLGTSITSKITDLANNVK*
Ga0070697_1008247941	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	ELSEYAVAAALVALAAVLAFQALGTNIGAKIQSLADTIGQ*
Ga0070693_1016483163	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	TGLELSEYAVAAALVALACVAAFQLLGTNIGIKINELAGKIQ*
Ga0070704_1002253041	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	ELSEYAVAAALIALACVAAFQLLGTNIGIKINDLAGKIK*
Ga0070704_1012011191	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	ETGLELSEYAVAAALIALACVVAFQTLGTNIGTKINELAGKIQ*
Ga0058697_106462671	3300005562	Agave	VAAALVALAAVAAFQLLGTNIGLKITSLADTIKP*
Ga0068854_1016714173	3300005578	Corn Rhizosphere	SEYAVAAALVALAAVAAFQLLGTNIGTKINELAGKIK*
Ga0068859_1003012015	3300005617	Switchgrass Rhizosphere	GLELSEYAVAAALVALACVVAFQTLGTNIGTKINELAGKIK*
Ga0068859_1008688254	3300005617	Switchgrass Rhizosphere	GLELSEYAVAAALIALACVAAFQLLGTNIGLKINDLAGKIK*
Ga0068859_1014063914	3300005617	Switchgrass Rhizosphere	ELSEYAVAAALVALACVAAFQLLGTNIATAISNLAGKIK*
Ga0068870_113344421	3300005840	Miscanthus Rhizosphere	AVAAALVALAAVVAFQTLGTQIGARIDTLAGFIK*
Ga0068863_1005078881	3300005841	Switchgrass Rhizosphere	YAVAAALVALACVVAFQTLGTNIGTKINELAGKIK*
Ga0075295_10038981	3300005879	Rice Paddy Soil	AVAAALVALAAVAAFQLLGTNIGTKINELAGKIQ*
Ga0075286_10298662	3300005886	Rice Paddy Soil	GLELSEYAVAAALVAIAAVAAFQLLGTNIGSRINTLAGYIK*
Ga0075292_10564112	3300005887	Rice Paddy Soil	LELSEYAVAAALIALATVGAFQLLGTNITSKITDLANNVK*
Ga0075417_105379471	3300006049	Populus Rhizosphere	ELSEYAVAAALIALATVAAFQLLGTSITSKITDLANNVK*
Ga0097621_1008488242	3300006237	Miscanthus Rhizosphere	YAVAAALVALAAVAAFQLLGTQIGAKINTLAGYIQ*
Ga0075428_1017315811	3300006844	Populus Rhizosphere	EYAVAAALVALAAVLAFTALGSNIGVRIQALADTIGSN*
Ga0075421_1014689003	3300006845	Populus Rhizosphere	YAVAAALVALAAVVAFQTLGTNISTKITDLAGKIK*
Ga0075425_1009109721	3300006854	Populus Rhizosphere	GLELSEYAVAAALVALACVAAFQLLGTNIAAKITSLANIIQ*
Ga0079219_120842911	3300006954	Agricultural Soil	TGLELSEYAVAAALVALACVAAFQLLGTNIAARINTLAGYIQ*
Ga0105251_106404932	3300009011	Switchgrass Rhizosphere	GLELSEYAVAAALIALACVVAFQTLGTNIGTKINELAGKIK*
Ga0099829_109789491	3300009038	Vadose Zone Soil	LSEYAVAAALIAIACVVAFTTLGTAISSKINTLAATISG*
Ga0105250_102877654	3300009092	Switchgrass Rhizosphere	EYAVAAALVALAAVAAFQLLGTNIGTKINELAGKIK*
Ga0105240_113573942	3300009093	Corn Rhizosphere	AVAAALVAMAAVVAFRTLGTNIATKITELANTITQ*
Ga0075418_118619032	3300009100	Populus Rhizosphere	EYAVAAALVALACVAAFQLLGSSIGTKINSLAGTINTGATTP*
Ga0105247_107433893	3300009101	Switchgrass Rhizosphere	EYAVAAALIALAAVAAFQLLGTNIGTKINELAGKIQ*
Ga0105247_110973061	3300009101	Switchgrass Rhizosphere	AVAAALVAVATVAAFQLLGTNIGSRINALAGWIK*
Ga0105243_106072053	3300009148	Miscanthus Rhizosphere	YAVAAALVALAAVAAFTALGGKISGAIENLGSKIQ*
Ga0111538_127201051	3300009156	Populus Rhizosphere	LSEYAVAAALVALATVAAFSMLSSKIASRISTLGNYIP*
Ga0105241_102440894	3300009174	Corn Rhizosphere	EYAVAAALIALACVAAFTLLGENIGARINALANTIGSN*
Ga0105241_106870623	3300009174	Corn Rhizosphere	LELSEYAVAAALVAIAAVAAFQLLGTNIGSRINTLAGYIK*
Ga0105242_103620761	3300009176	Miscanthus Rhizosphere	TGLELSEYAVAAALVALACVVAFQTLGTNIGTKINELAGKIK*
Ga0105248_103539771	3300009177	Switchgrass Rhizosphere	AVAAALVAVATIAAFQLVGTNIGLRISTLAGYIK*
Ga0105248_105324621	3300009177	Switchgrass Rhizosphere	ALVALACVAAFQLLGENIGAKINTLAETIGSGAAQ*
Ga0105248_132400652	3300009177	Switchgrass Rhizosphere	AVAAALVAMAAVIAFRTLGTNIATKITELANTIVQ*
Ga0105238_100154601	3300009551	Corn Rhizosphere	ETGLELSEYAVAAALVALACVVAFQTLGTNIGTKINELAGKIK*
Ga0105249_103182253	3300009553	Switchgrass Rhizosphere	SEYAVAAALVALATVAAFSMLSSKIATRITTLGNYIP*
Ga0126313_108331443	3300009840	Serpentine Soil	LELSEYAVAAALVALAAVAAFQLLGTNIGLKINELAGKIK*
Ga0126304_100925611	3300010037	Serpentine Soil	ETGLELSEYAVAAALIAVACVLAFTTLGTTIKNAINNLSSKIPVNP*
Ga0126312_112014501	3300010041	Serpentine Soil	YAVAAALVALAAVAAFQLLGTNIGIKITDLANKIK*
Ga0126310_104416121	3300010044	Serpentine Soil	LELSEYAVAAALVAVATVAAFQLLGTNIGSRINTLAGFIK*
Ga0126311_112272972	3300010045	Serpentine Soil	LELSEYAVAAALVALAAVAAFQLLGTNIGLKINKLADTIKP*
Ga0126320_11488961	3300010146	Soil	ETGLELSEYAVAAALIALATVAAFGGLGTKIKDAITNLSGKIPTTG*
Ga0126320_12264542	3300010146	Soil	GLELSEYAVAAALVALAAVVAFQALGTNIGTKIQALADTIGQ*
Ga0134082_104144052	3300010303	Grasslands Soil	GLELSEYAVAAALIAIACVVAFRSLGTAIGSRIDTLAATING*
Ga0105239_115535071	3300010375	Corn Rhizosphere	LELSEYAVAAALIALACVAAFQLLGTNIGLKINELAGKIQ*
Ga0134126_112018063	3300010396	Terrestrial Soil	KDETGLELSEYAVAAALVALAAVVAFQTLGTQIGARINTLAGYIK*
Ga0134124_106708613	3300010397	Terrestrial Soil	EQGLELSEYAVAAALVALATVAAFSVLSSKIATRITTLGNYIP*
Ga0134122_117575662	3300010400	Terrestrial Soil	LELSEYAVAAALVALAAVLAFQTLGGNISSKINELAGKIQ*
Ga0134121_112885424	3300010401	Terrestrial Soil	YAVAAALVALACVAAFQLLGTNIATAISNLAGKIK*
Ga0105246_122713651	3300011119	Miscanthus Rhizosphere	SEYAVAAALVALAAVAAFQLLGTNIATRINTLAGYIQ*
Ga0127502_100156882	3300011333	Soil	SEYAVAAALVALAAVAAFQLLGANIGTKINELAGKIQ*
Ga0137424_10418051	3300011412	Soil	AVAAALIALATVGAFQLLGTNITTKITDVANTVK*
Ga0136621_10888943	3300012092	Polar Desert Sand	YAVAAALVALAVITAFSTLGTNIGTKIGNLATEVGK*
Ga0136620_103597843	3300012186	Polar Desert Sand	ETGLELSEYAVAAALVALAVITAFSTLGTNIGTKINNLATEVGK*
Ga0137381_103349681	3300012207	Vadose Zone Soil	YAVAAALVALAAIVAFTALGTNIGTKIQGLADKIK*
Ga0150985_1063451671	3300012212	Avena Fatua Rhizosphere	TGLELSEYAVAAALVALAAVVAFQTLGTNISTKITDLAGKIK*
Ga0150985_1082515301	3300012212	Avena Fatua Rhizosphere	LSEYAVAAALVAIAAVAAFQLLGTNIGSRINTLAGYIK*
Ga0150984_1089038851	3300012469	Avena Fatua Rhizosphere	LELSEYAVAAALIALAVVGAFQLLGTNISGKINNLANTVK*
Ga0150984_1161324941	3300012469	Avena Fatua Rhizosphere	TGLELSEYAVAAALVALAVITAFTTLGTNIGSKINNLAGKVGP*
Ga0157290_102072053	3300012909	Soil	EYAVAAALVALAAVAAFQLLGGNIAAKINELAGKLQ*
Ga0157306_103544841	3300012912	Soil	EYAVAAALIALACVAAFQLLGTNIGLKINELAGKIQ*
Ga0137359_103514694	3300012923	Vadose Zone Soil	EYAVAAALVALAAIVAFTALGTNIGTKIQGLADKIK*
Ga0164302_115089191	3300012961	Soil	TGLELSEYAVAAALVAIAAVAAFQLLGTNIGSRINTLAGYIK*
Ga0157373_110923453	3300013100	Corn Rhizosphere	LELSEYAVAAALIALACVVAFQTLGTNIGTKINELAGKLQ*
Ga0157373_115388062	3300013100	Corn Rhizosphere	ETGLELSEYAVAAALVALAAVVAFQALGSNIGTKIQSLADTIGK*
Ga0157371_115645361	3300013102	Corn Rhizosphere	GLELSEYAVAAALVAVATVAAFQLLGTNIGSRINALAGWIK*
Ga0157378_121024442	3300013297	Miscanthus Rhizosphere	MIIKFLRDDTGLELSVYAVAAAHEAMATIMAFQLVGANIGARISTLAGYIQ*
Ga0157375_108072801	3300013308	Miscanthus Rhizosphere	LSEYAVAAALVALATVAAFTMLSSKIATRITTLGNYIP*
Ga0163163_105372094	3300014325	Switchgrass Rhizosphere	LELSEYAVAAALVALACVVAFQTLGTNIGTKINELAGKIK*
Ga0157379_110257102	3300014968	Switchgrass Rhizosphere	GLELSEYAVAAALVAVATIAAFQLVGTNIGLRISTLAGYIK*
Ga0157379_111387673	3300014968	Switchgrass Rhizosphere	LSEYAVAAALVALAAVLAFQTLGGNISSKINDLAGKMK*
Ga0167623_100007218	3300015161	Glacier Forefield Soil	LSEYAVAAALVALAAVAAFQLLGGNIGAKINELAIKITG*
Ga0137418_106965691	3300015241	Vadose Zone Soil	EYAVAAALVALAVVTAFTTLGGKINSAISNLASKIN*
Ga0132255_1061124373	3300015374	Arabidopsis Rhizosphere	ELSEYAVAAALVALAAVLAFQTLGGNISSKINDLAGKIK*
Ga0136617_104595821	3300017789	Polar Desert Sand	EYAVAAALVAITVVGAFQLLGGNINTKIRELAGYVSGNVTP
Ga0190272_121037711	3300018429	Soil	TGLELSEYAVAAALVALAAVAAFQLLGTNIGARINTLAGYIQ
Ga0190268_115112542	3300018466	Soil	SEYAVGAALVAIAAVLAFQTLGNQIGARISSLAGFIQ
Ga0190273_110635901	3300018920	Soil	MIKILLQDDTGLELSEYAVAAALVALAVVGVFNTLGDAIKLKIDLLSSKL
Ga0193597_10190614	3300019142	Soil	ELSEYAVAAALVALAVITAFSTLGKNIGIKIGDLATEITKTP
Ga0190267_106531822	3300019767	Soil	ELSEYAVAAALVALAAVAAFQLLGTNIGTKITELANTVAK
Ga0207710_101202621	3300025900	Switchgrass Rhizosphere	GLELSEYAVAAALVALACVVAFQTLGTQIGARIDTLAGFIK
Ga0207647_101628941	3300025904	Corn Rhizosphere	EYAVAAALIALACVAAFQLLGTNIGLKINDLAGKIK
Ga0207709_116993391	3300025935	Miscanthus Rhizosphere	ELSEYAVAAALVAVATVAAFQLLGTNIGSRINALAGSIK
Ga0207670_106676971	3300025936	Switchgrass Rhizosphere	TGLELSEYAVAAALVALACVAAFQLLGSSIGTKINSLAGTINTGSTTP
Ga0207670_115458331	3300025936	Switchgrass Rhizosphere	ETGLELSEYAVAAALVAVATVAAFQLLGTNIGSRINALAGWIK
Ga0207691_103558441	3300025940	Miscanthus Rhizosphere	SGLELSEYAVAAALIALACVVAFQTLGTNIGTKINELAGKLQ
Ga0207691_105254761	3300025940	Miscanthus Rhizosphere	YAVAAALIALACVAAFQLLGTNIGTKINELAGKIQ
Ga0207640_109553121	3300025981	Corn Rhizosphere	TGLELSEYAVAAALVALAAVLAFQALGSNIGTKIQSLADTIGK
Ga0207640_114875431	3300025981	Corn Rhizosphere	YAVAAALVALAAVAAFQLLGTNIGTKINELAGKIK
Ga0208531_10268401	3300026020	Rice Paddy Soil	LELSEYAVAAALIALATVGAFQLLGTNITSKITDLANNVK
Ga0207677_104506903	3300026023	Miscanthus Rhizosphere	LSEYAVAAALIALACVAAFQLLGTNIGLKINELAGKIQ
Ga0207703_100272435	3300026035	Switchgrass Rhizosphere	ELSEYAVAAALVALAAVAAFQLLGTQIGAKINTLAGYIQ
Ga0207648_112687731	3300026089	Miscanthus Rhizosphere	EYAVAAALIALACVAAFQLLGGNIGLKINELAGKIQYTFRF
Ga0207676_101755673	3300026095	Switchgrass Rhizosphere	ETGLELSEYAVAAALVAMAAVVAFRTLGTNIAAKITELATTITGQ
Ga0209180_105141182	3300027846	Vadose Zone Soil	LSEYAVAAALIAIACVVAFTTLGTAISSKINTLAATISG
Ga0268266_122161512	3300028379	Switchgrass Rhizosphere	EYAVAAALVALAAVAAFQLLGTQIGAKINTLAGYIQ
Ga0307503_107119151	3300028802	Soil	ELSEYAVAAALVALAVITAFTTLGTNIGAKIGNLATAISSTP
Ga0308178_10152073	3300030990	Soil	MELSEYATAAALVTLAAITAFQLLGGNIGAKISELATKITG
Ga0308197_104407873	3300031093	Soil	LELSEYAVAAALVALAAVAAFQLLGTNIGTKITALANTVK
Ga0308179_10284281	3300031424	Soil	GLELSEYAVAAALIALATVAAFQLLGTNITGKITSLANTVK
Ga0310813_115249171	3300031716	Soil	ELSEYAVAAALVALAAVAAFQLLGTNIGTKINELAGKIK
Ga0310904_101327413	3300031854	Soil	GLELSEYAVAAALVAVATIAAFQLLGTNIGSRINALAGTIK
Ga0307412_102744861	3300031911	Rhizosphere	LELSEYAVAAALVALAAVLAFQTLGTNIGLKINELADKIKP
Ga0307414_115144072	3300032004	Rhizosphere	YAVAAALVALAAVAAFQLLGGNIGSKINELATKIQ
Ga0310890_107077534	3300032075	Soil	YAVAAALIALACVAAFQLLGTNIGLKINDLAGKIK
Ga0307470_119309421	3300032174	Hardwood Forest Soil	LELSEYAVAAALVAIAVVAAFTLLGGAISARITSLAGTISG
Ga0307471_1025503372	3300032180	Hardwood Forest Soil	YAVAAALIAVATVAAFQLLGTSITSRITTLANNVK
Ga0334949_039698_1218_1343	3300034027	Biocrust	LSEYAVAAALVALAVITAFTTLGTNISGRIDSLATKIGVTP
Ga0334929_055421_1_135	3300034135	Hypolithic Biocrust	GLELSEYAVAAALIALATVTAFSGLGTTIKNAITNLSGKIPTTG
Ga0364935_0115554_711_833	3300034151	Sediment	LELSEYAVAAALIALATVGAFQLLGTNITTKITDVANTVK
Ga0314782_068787_2_130	3300034661	Soil	TGLELSEYAVAAALVALACVVAFQTLGTNIGTKINELAGKIK
Ga0314787_080667_459_578	3300034665	Soil	ELSEYAVAAALVALAAVVAFQTLGANISTKITDLAGKIK
Ga0314788_081769_584_697	3300034666	Soil	SEYAVAAALIALACVAAFQLLGTNIGLKINDLAGKIK
Ga0314792_229325_411_533	3300034667	Soil	ELSEYAVAAALVALAAVAAFQLLGENIGAKINTLAETIAQ
Ga0314798_101110_500_610	3300034673	Soil	EYAVAAALVALACVVAFQTLGTNIGTKINELASKIQ
Ga0314798_137332_424_549	3300034673	Soil	GLELSEYAVAAALVAIAAVAAFQLLGTNIGSRINTLAGYIK
Ga0314798_151728_1_114	3300034673	Soil	EYAVAAALIALACVAAFTLLGENIGAKINSLANTIAQ
Ga0314803_017980_2_115	3300034678	Soil	AVAAALVALAAVAAFQLLGTNIGTKINELAGKIKYYF