| Basic Information | |
|---|---|
| Family ID | F055806 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 40 residues |
| Representative Sequence | ELSEYAVAAALVALAAVAAFQLLGTNIGTKINELAGKIK |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.35 % |
| % of genes near scaffold ends (potentially truncated) | 95.65 % |
| % of genes from short scaffolds (< 2000 bps) | 95.65 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.406 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.696 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.203 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.522 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF01478 | Peptidase_A24 | 54.35 |
| PF04964 | Flp_Fap | 12.32 |
| PF16976 | RcpC | 5.07 |
| PF08666 | SAF | 4.35 |
| PF13629 | T2SS-T3SS_pil_N | 1.45 |
| PF01656 | CbiA | 0.72 |
| PF07992 | Pyr_redox_2 | 0.72 |
| PF02310 | B12-binding | 0.72 |
| PF13144 | ChapFlgA | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 12.32 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.41 % |
| Unclassified | root | N/A | 11.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886011|MRS1b_contig_3343649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 803 | Open in IMG/M |
| 3300000559|F14TC_100869865 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300000787|JGI11643J11755_11616757 | Not Available | 556 | Open in IMG/M |
| 3300003324|soilH2_10012145 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300004114|Ga0062593_102615291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300004114|Ga0062593_102620571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300004156|Ga0062589_102685291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300004267|Ga0066396_10111306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 516 | Open in IMG/M |
| 3300004480|Ga0062592_101718103 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300005093|Ga0062594_100878101 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300005184|Ga0066671_10016234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3174 | Open in IMG/M |
| 3300005294|Ga0065705_10314374 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1024 | Open in IMG/M |
| 3300005334|Ga0068869_100888047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 771 | Open in IMG/M |
| 3300005340|Ga0070689_100621855 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300005355|Ga0070671_100092260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2537 | Open in IMG/M |
| 3300005365|Ga0070688_101422334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300005444|Ga0070694_100113456 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
| 3300005444|Ga0070694_100711120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
| 3300005468|Ga0070707_101350487 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300005536|Ga0070697_100824794 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300005547|Ga0070693_101648316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 505 | Open in IMG/M |
| 3300005549|Ga0070704_100225304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 1526 | Open in IMG/M |
| 3300005549|Ga0070704_101201119 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300005562|Ga0058697_10646267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300005578|Ga0068854_101671417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300005617|Ga0068859_100301201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 1696 | Open in IMG/M |
| 3300005617|Ga0068859_100868825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 987 | Open in IMG/M |
| 3300005617|Ga0068859_101406391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 769 | Open in IMG/M |
| 3300005840|Ga0068870_11334442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300005841|Ga0068863_100507888 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1187 | Open in IMG/M |
| 3300005879|Ga0075295_1003898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1297 | Open in IMG/M |
| 3300005886|Ga0075286_1029866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
| 3300005887|Ga0075292_1056411 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300006049|Ga0075417_10537947 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300006237|Ga0097621_100848824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300006844|Ga0075428_101731581 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300006845|Ga0075421_101468900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 747 | Open in IMG/M |
| 3300006854|Ga0075425_100910972 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300006954|Ga0079219_12084291 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300009011|Ga0105251_10640493 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300009038|Ga0099829_10978949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300009092|Ga0105250_10287765 | Not Available | 708 | Open in IMG/M |
| 3300009093|Ga0105240_11357394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300009100|Ga0075418_11861903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300009101|Ga0105247_10743389 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300009101|Ga0105247_11097306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300009148|Ga0105243_10607205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300009156|Ga0111538_12720105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300009174|Ga0105241_10244089 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
| 3300009174|Ga0105241_10687062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300009176|Ga0105242_10362076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1343 | Open in IMG/M |
| 3300009177|Ga0105248_10353977 | All Organisms → cellular organisms → Bacteria | 1653 | Open in IMG/M |
| 3300009177|Ga0105248_10532462 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300009177|Ga0105248_13240065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300009551|Ga0105238_10015460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7724 | Open in IMG/M |
| 3300009553|Ga0105249_10318225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1566 | Open in IMG/M |
| 3300009840|Ga0126313_10833144 | Not Available | 751 | Open in IMG/M |
| 3300010037|Ga0126304_10092561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1901 | Open in IMG/M |
| 3300010041|Ga0126312_11201450 | Not Available | 559 | Open in IMG/M |
| 3300010044|Ga0126310_10441612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300010045|Ga0126311_11227297 | Not Available | 621 | Open in IMG/M |
| 3300010146|Ga0126320_1148896 | Not Available | 592 | Open in IMG/M |
| 3300010146|Ga0126320_1226454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300010303|Ga0134082_10414405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300010375|Ga0105239_11553507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300010396|Ga0134126_11201806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300010397|Ga0134124_10670861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1023 | Open in IMG/M |
| 3300010400|Ga0134122_11757566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 650 | Open in IMG/M |
| 3300010401|Ga0134121_11288542 | Not Available | 735 | Open in IMG/M |
| 3300011119|Ga0105246_12271365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300011333|Ga0127502_10015688 | Not Available | 502 | Open in IMG/M |
| 3300011412|Ga0137424_1041805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300012092|Ga0136621_1088894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1258 | Open in IMG/M |
| 3300012186|Ga0136620_10359784 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012207|Ga0137381_10334968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1319 | Open in IMG/M |
| 3300012212|Ga0150985_106345167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 691 | Open in IMG/M |
| 3300012212|Ga0150985_108251530 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
| 3300012469|Ga0150984_108903885 | Not Available | 624 | Open in IMG/M |
| 3300012469|Ga0150984_116132494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 540 | Open in IMG/M |
| 3300012909|Ga0157290_10207205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300012912|Ga0157306_10354484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300012923|Ga0137359_10351469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1310 | Open in IMG/M |
| 3300012961|Ga0164302_11508919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300013100|Ga0157373_11092345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300013100|Ga0157373_11538806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300013102|Ga0157371_11564536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300013297|Ga0157378_12102444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300013308|Ga0157375_10807280 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300014325|Ga0163163_10537209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1231 | Open in IMG/M |
| 3300014968|Ga0157379_11025710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300014968|Ga0157379_11138767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 748 | Open in IMG/M |
| 3300015161|Ga0167623_1000072 | All Organisms → cellular organisms → Bacteria | 49104 | Open in IMG/M |
| 3300015241|Ga0137418_10696569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300015374|Ga0132255_106112437 | Not Available | 509 | Open in IMG/M |
| 3300017789|Ga0136617_10459582 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300018429|Ga0190272_12103771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300018466|Ga0190268_11511254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300018920|Ga0190273_11063590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300019142|Ga0193597_1019061 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
| 3300019767|Ga0190267_10653182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300025900|Ga0207710_10120262 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300025904|Ga0207647_10162894 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300025935|Ga0207709_11699339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300025936|Ga0207670_10667697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300025936|Ga0207670_11545833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300025940|Ga0207691_10355844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1252 | Open in IMG/M |
| 3300025940|Ga0207691_10525476 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300025981|Ga0207640_10955312 | Not Available | 751 | Open in IMG/M |
| 3300025981|Ga0207640_11487543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 608 | Open in IMG/M |
| 3300026020|Ga0208531_1026840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300026023|Ga0207677_10450690 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300026035|Ga0207703_10027243 | All Organisms → cellular organisms → Bacteria | 4500 | Open in IMG/M |
| 3300026089|Ga0207648_11268773 | Not Available | 692 | Open in IMG/M |
| 3300026095|Ga0207676_10175567 | All Organisms → cellular organisms → Bacteria | 1871 | Open in IMG/M |
| 3300027846|Ga0209180_10514118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300028379|Ga0268266_12216151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300028802|Ga0307503_10711915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300030990|Ga0308178_1015207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1148 | Open in IMG/M |
| 3300031093|Ga0308197_10440787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter pelagius | 520 | Open in IMG/M |
| 3300031424|Ga0308179_1028428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300031716|Ga0310813_11524917 | Not Available | 623 | Open in IMG/M |
| 3300031854|Ga0310904_10132741 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300031911|Ga0307412_10274486 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300032004|Ga0307414_11514407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300032075|Ga0310890_10707753 | Not Available | 790 | Open in IMG/M |
| 3300032174|Ga0307470_11930942 | Not Available | 503 | Open in IMG/M |
| 3300032180|Ga0307471_102550337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300034027|Ga0334949_039698 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300034135|Ga0334929_055421 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300034151|Ga0364935_0115554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
| 3300034661|Ga0314782_068787 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300034665|Ga0314787_080667 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300034666|Ga0314788_081769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter pelagius | 697 | Open in IMG/M |
| 3300034667|Ga0314792_229325 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300034673|Ga0314798_101110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300034673|Ga0314798_137332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300034673|Ga0314798_151728 | Not Available | 530 | Open in IMG/M |
| 3300034678|Ga0314803_017980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.25% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 6.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.35% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.35% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.62% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.90% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.90% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.90% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.17% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.45% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.45% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.45% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.72% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.72% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.72% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.72% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.72% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
| 3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015161 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019142 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid late stage, 3 min after wetting v1 | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026020 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034027 | Biocrust microbial communities from Mojave Desert, California, United States - 45SNC | Environmental | Open in IMG/M |
| 3300034135 | Biocrust microbial communities from Mojave Desert, California, United States - 25HNC | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034665 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MRS1b_0515.00001930 | 2162886011 | Miscanthus Rhizosphere | TGLELSEYAVAAALIALATVAAFQLLGTNIAGKITGLANTVK |
| F14TC_1008698651 | 3300000559 | Soil | ETGLELSEYAVAAALVAIAVVAAFTLLGTNIGIRINQLANTINPSS* |
| JGI11643J11755_116167573 | 3300000787 | Soil | YAVAAALVALACVAAFQLLGTNIGIKINELAGKIQ* |
| soilH2_100121451 | 3300003324 | Sugarcane Root And Bulk Soil | AAALVALACVAAFQLLGSSIGTKINGLANTINTGSTTTP* |
| Ga0062593_1026152911 | 3300004114 | Soil | GLELSEYAVAAALIAMACALAFTTLGGAIGNKINTLASTISG* |
| Ga0062593_1026205711 | 3300004114 | Soil | GLELSEYAVAAALVAMAAVVAFRTLGTNIAAKITELATTITGQ* |
| Ga0062589_1026852911 | 3300004156 | Soil | VAAALVALACVAAFQLLGSSIGTKINSLAGTINSGSTTP* |
| Ga0066396_101113061 | 3300004267 | Tropical Forest Soil | MIRKFLSDESGMELAEYAAAAALVTLATVAAFQLLGTNIMGRITDLASIVK* |
| Ga0062592_1017181031 | 3300004480 | Soil | EYAVAAALVALACVAAFQLLGSSIGTKINSLAGTINSGSTTP* |
| Ga0062594_1008781012 | 3300005093 | Soil | LELSEYAVAAALVALATVAAFTVLSSKIATRITTLGNYIP* |
| Ga0066671_100162341 | 3300005184 | Soil | LSEYAVAAALIALAVITAFTALGTNIGTKITSLANTVNG* |
| Ga0065705_103143743 | 3300005294 | Switchgrass Rhizosphere | ETGLELSEYAVAAALVALACVVAYQTLGTNIGARIETLAGYIQF* |
| Ga0068869_1008880474 | 3300005334 | Miscanthus Rhizosphere | ELSEYAVAAALIALACVAAFQLLGTNIGTKINDLAGKIK* |
| Ga0070689_1006218553 | 3300005340 | Switchgrass Rhizosphere | ETGLELSEYAVAAALIALATVAAFQLLGTNIAGKITGLANTVK* |
| Ga0070671_1000922601 | 3300005355 | Switchgrass Rhizosphere | GLELSEYAVAAALIALATVAAFQLLGTNIAGKITGLANTVK* |
| Ga0070688_1014223341 | 3300005365 | Switchgrass Rhizosphere | YAVAAALVALACVAAFQLLGSSIGTKINSLAGTINSGSTTP* |
| Ga0070694_1001134561 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | EYAVAAALVALACVAAFQLLGSSIGTKINSLAGTINTGSTTP* |
| Ga0070694_1007111201 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GLELSEYAVAAALIALACVLAFTALGTNIGARIQSLADTIGQ* |
| Ga0070707_1013504872 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GLELSEYAVAAALIALATVTAFQLLGTSITSKITDLANNVK* |
| Ga0070697_1008247941 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ELSEYAVAAALVALAAVLAFQALGTNIGAKIQSLADTIGQ* |
| Ga0070693_1016483163 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | TGLELSEYAVAAALVALACVAAFQLLGTNIGIKINELAGKIQ* |
| Ga0070704_1002253041 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | ELSEYAVAAALIALACVAAFQLLGTNIGIKINDLAGKIK* |
| Ga0070704_1012011191 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | ETGLELSEYAVAAALIALACVVAFQTLGTNIGTKINELAGKIQ* |
| Ga0058697_106462671 | 3300005562 | Agave | VAAALVALAAVAAFQLLGTNIGLKITSLADTIKP* |
| Ga0068854_1016714173 | 3300005578 | Corn Rhizosphere | SEYAVAAALVALAAVAAFQLLGTNIGTKINELAGKIK* |
| Ga0068859_1003012015 | 3300005617 | Switchgrass Rhizosphere | GLELSEYAVAAALVALACVVAFQTLGTNIGTKINELAGKIK* |
| Ga0068859_1008688254 | 3300005617 | Switchgrass Rhizosphere | GLELSEYAVAAALIALACVAAFQLLGTNIGLKINDLAGKIK* |
| Ga0068859_1014063914 | 3300005617 | Switchgrass Rhizosphere | ELSEYAVAAALVALACVAAFQLLGTNIATAISNLAGKIK* |
| Ga0068870_113344421 | 3300005840 | Miscanthus Rhizosphere | AVAAALVALAAVVAFQTLGTQIGARIDTLAGFIK* |
| Ga0068863_1005078881 | 3300005841 | Switchgrass Rhizosphere | YAVAAALVALACVVAFQTLGTNIGTKINELAGKIK* |
| Ga0075295_10038981 | 3300005879 | Rice Paddy Soil | AVAAALVALAAVAAFQLLGTNIGTKINELAGKIQ* |
| Ga0075286_10298662 | 3300005886 | Rice Paddy Soil | GLELSEYAVAAALVAIAAVAAFQLLGTNIGSRINTLAGYIK* |
| Ga0075292_10564112 | 3300005887 | Rice Paddy Soil | LELSEYAVAAALIALATVGAFQLLGTNITSKITDLANNVK* |
| Ga0075417_105379471 | 3300006049 | Populus Rhizosphere | ELSEYAVAAALIALATVAAFQLLGTSITSKITDLANNVK* |
| Ga0097621_1008488242 | 3300006237 | Miscanthus Rhizosphere | YAVAAALVALAAVAAFQLLGTQIGAKINTLAGYIQ* |
| Ga0075428_1017315811 | 3300006844 | Populus Rhizosphere | EYAVAAALVALAAVLAFTALGSNIGVRIQALADTIGSN* |
| Ga0075421_1014689003 | 3300006845 | Populus Rhizosphere | YAVAAALVALAAVVAFQTLGTNISTKITDLAGKIK* |
| Ga0075425_1009109721 | 3300006854 | Populus Rhizosphere | GLELSEYAVAAALVALACVAAFQLLGTNIAAKITSLANIIQ* |
| Ga0079219_120842911 | 3300006954 | Agricultural Soil | TGLELSEYAVAAALVALACVAAFQLLGTNIAARINTLAGYIQ* |
| Ga0105251_106404932 | 3300009011 | Switchgrass Rhizosphere | GLELSEYAVAAALIALACVVAFQTLGTNIGTKINELAGKIK* |
| Ga0099829_109789491 | 3300009038 | Vadose Zone Soil | LSEYAVAAALIAIACVVAFTTLGTAISSKINTLAATISG* |
| Ga0105250_102877654 | 3300009092 | Switchgrass Rhizosphere | EYAVAAALVALAAVAAFQLLGTNIGTKINELAGKIK* |
| Ga0105240_113573942 | 3300009093 | Corn Rhizosphere | AVAAALVAMAAVVAFRTLGTNIATKITELANTITQ* |
| Ga0075418_118619032 | 3300009100 | Populus Rhizosphere | EYAVAAALVALACVAAFQLLGSSIGTKINSLAGTINTGATTP* |
| Ga0105247_107433893 | 3300009101 | Switchgrass Rhizosphere | EYAVAAALIALAAVAAFQLLGTNIGTKINELAGKIQ* |
| Ga0105247_110973061 | 3300009101 | Switchgrass Rhizosphere | AVAAALVAVATVAAFQLLGTNIGSRINALAGWIK* |
| Ga0105243_106072053 | 3300009148 | Miscanthus Rhizosphere | YAVAAALVALAAVAAFTALGGKISGAIENLGSKIQ* |
| Ga0111538_127201051 | 3300009156 | Populus Rhizosphere | LSEYAVAAALVALATVAAFSMLSSKIASRISTLGNYIP* |
| Ga0105241_102440894 | 3300009174 | Corn Rhizosphere | EYAVAAALIALACVAAFTLLGENIGARINALANTIGSN* |
| Ga0105241_106870623 | 3300009174 | Corn Rhizosphere | LELSEYAVAAALVAIAAVAAFQLLGTNIGSRINTLAGYIK* |
| Ga0105242_103620761 | 3300009176 | Miscanthus Rhizosphere | TGLELSEYAVAAALVALACVVAFQTLGTNIGTKINELAGKIK* |
| Ga0105248_103539771 | 3300009177 | Switchgrass Rhizosphere | AVAAALVAVATIAAFQLVGTNIGLRISTLAGYIK* |
| Ga0105248_105324621 | 3300009177 | Switchgrass Rhizosphere | ALVALACVAAFQLLGENIGAKINTLAETIGSGAAQ* |
| Ga0105248_132400652 | 3300009177 | Switchgrass Rhizosphere | AVAAALVAMAAVIAFRTLGTNIATKITELANTIVQ* |
| Ga0105238_100154601 | 3300009551 | Corn Rhizosphere | ETGLELSEYAVAAALVALACVVAFQTLGTNIGTKINELAGKIK* |
| Ga0105249_103182253 | 3300009553 | Switchgrass Rhizosphere | SEYAVAAALVALATVAAFSMLSSKIATRITTLGNYIP* |
| Ga0126313_108331443 | 3300009840 | Serpentine Soil | LELSEYAVAAALVALAAVAAFQLLGTNIGLKINELAGKIK* |
| Ga0126304_100925611 | 3300010037 | Serpentine Soil | ETGLELSEYAVAAALIAVACVLAFTTLGTTIKNAINNLSSKIPVNP* |
| Ga0126312_112014501 | 3300010041 | Serpentine Soil | YAVAAALVALAAVAAFQLLGTNIGIKITDLANKIK* |
| Ga0126310_104416121 | 3300010044 | Serpentine Soil | LELSEYAVAAALVAVATVAAFQLLGTNIGSRINTLAGFIK* |
| Ga0126311_112272972 | 3300010045 | Serpentine Soil | LELSEYAVAAALVALAAVAAFQLLGTNIGLKINKLADTIKP* |
| Ga0126320_11488961 | 3300010146 | Soil | ETGLELSEYAVAAALIALATVAAFGGLGTKIKDAITNLSGKIPTTG* |
| Ga0126320_12264542 | 3300010146 | Soil | GLELSEYAVAAALVALAAVVAFQALGTNIGTKIQALADTIGQ* |
| Ga0134082_104144052 | 3300010303 | Grasslands Soil | GLELSEYAVAAALIAIACVVAFRSLGTAIGSRIDTLAATING* |
| Ga0105239_115535071 | 3300010375 | Corn Rhizosphere | LELSEYAVAAALIALACVAAFQLLGTNIGLKINELAGKIQ* |
| Ga0134126_112018063 | 3300010396 | Terrestrial Soil | KDETGLELSEYAVAAALVALAAVVAFQTLGTQIGARINTLAGYIK* |
| Ga0134124_106708613 | 3300010397 | Terrestrial Soil | EQGLELSEYAVAAALVALATVAAFSVLSSKIATRITTLGNYIP* |
| Ga0134122_117575662 | 3300010400 | Terrestrial Soil | LELSEYAVAAALVALAAVLAFQTLGGNISSKINELAGKIQ* |
| Ga0134121_112885424 | 3300010401 | Terrestrial Soil | YAVAAALVALACVAAFQLLGTNIATAISNLAGKIK* |
| Ga0105246_122713651 | 3300011119 | Miscanthus Rhizosphere | SEYAVAAALVALAAVAAFQLLGTNIATRINTLAGYIQ* |
| Ga0127502_100156882 | 3300011333 | Soil | SEYAVAAALVALAAVAAFQLLGANIGTKINELAGKIQ* |
| Ga0137424_10418051 | 3300011412 | Soil | AVAAALIALATVGAFQLLGTNITTKITDVANTVK* |
| Ga0136621_10888943 | 3300012092 | Polar Desert Sand | YAVAAALVALAVITAFSTLGTNIGTKIGNLATEVGK* |
| Ga0136620_103597843 | 3300012186 | Polar Desert Sand | ETGLELSEYAVAAALVALAVITAFSTLGTNIGTKINNLATEVGK* |
| Ga0137381_103349681 | 3300012207 | Vadose Zone Soil | YAVAAALVALAAIVAFTALGTNIGTKIQGLADKIK* |
| Ga0150985_1063451671 | 3300012212 | Avena Fatua Rhizosphere | TGLELSEYAVAAALVALAAVVAFQTLGTNISTKITDLAGKIK* |
| Ga0150985_1082515301 | 3300012212 | Avena Fatua Rhizosphere | LSEYAVAAALVAIAAVAAFQLLGTNIGSRINTLAGYIK* |
| Ga0150984_1089038851 | 3300012469 | Avena Fatua Rhizosphere | LELSEYAVAAALIALAVVGAFQLLGTNISGKINNLANTVK* |
| Ga0150984_1161324941 | 3300012469 | Avena Fatua Rhizosphere | TGLELSEYAVAAALVALAVITAFTTLGTNIGSKINNLAGKVGP* |
| Ga0157290_102072053 | 3300012909 | Soil | EYAVAAALVALAAVAAFQLLGGNIAAKINELAGKLQ* |
| Ga0157306_103544841 | 3300012912 | Soil | EYAVAAALIALACVAAFQLLGTNIGLKINELAGKIQ* |
| Ga0137359_103514694 | 3300012923 | Vadose Zone Soil | EYAVAAALVALAAIVAFTALGTNIGTKIQGLADKIK* |
| Ga0164302_115089191 | 3300012961 | Soil | TGLELSEYAVAAALVAIAAVAAFQLLGTNIGSRINTLAGYIK* |
| Ga0157373_110923453 | 3300013100 | Corn Rhizosphere | LELSEYAVAAALIALACVVAFQTLGTNIGTKINELAGKLQ* |
| Ga0157373_115388062 | 3300013100 | Corn Rhizosphere | ETGLELSEYAVAAALVALAAVVAFQALGSNIGTKIQSLADTIGK* |
| Ga0157371_115645361 | 3300013102 | Corn Rhizosphere | GLELSEYAVAAALVAVATVAAFQLLGTNIGSRINALAGWIK* |
| Ga0157378_121024442 | 3300013297 | Miscanthus Rhizosphere | MIIKFLRDDTGLELSVYAVAAAHEAMATIMAFQLVGANIGARISTLAGYIQ* |
| Ga0157375_108072801 | 3300013308 | Miscanthus Rhizosphere | LSEYAVAAALVALATVAAFTMLSSKIATRITTLGNYIP* |
| Ga0163163_105372094 | 3300014325 | Switchgrass Rhizosphere | LELSEYAVAAALVALACVVAFQTLGTNIGTKINELAGKIK* |
| Ga0157379_110257102 | 3300014968 | Switchgrass Rhizosphere | GLELSEYAVAAALVAVATIAAFQLVGTNIGLRISTLAGYIK* |
| Ga0157379_111387673 | 3300014968 | Switchgrass Rhizosphere | LSEYAVAAALVALAAVLAFQTLGGNISSKINDLAGKMK* |
| Ga0167623_100007218 | 3300015161 | Glacier Forefield Soil | LSEYAVAAALVALAAVAAFQLLGGNIGAKINELAIKITG* |
| Ga0137418_106965691 | 3300015241 | Vadose Zone Soil | EYAVAAALVALAVVTAFTTLGGKINSAISNLASKIN* |
| Ga0132255_1061124373 | 3300015374 | Arabidopsis Rhizosphere | ELSEYAVAAALVALAAVLAFQTLGGNISSKINDLAGKIK* |
| Ga0136617_104595821 | 3300017789 | Polar Desert Sand | EYAVAAALVAITVVGAFQLLGGNINTKIRELAGYVSGNVTP |
| Ga0190272_121037711 | 3300018429 | Soil | TGLELSEYAVAAALVALAAVAAFQLLGTNIGARINTLAGYIQ |
| Ga0190268_115112542 | 3300018466 | Soil | SEYAVGAALVAIAAVLAFQTLGNQIGARISSLAGFIQ |
| Ga0190273_110635901 | 3300018920 | Soil | MIKILLQDDTGLELSEYAVAAALVALAVVGVFNTLGDAIKLKIDLLSSKL |
| Ga0193597_10190614 | 3300019142 | Soil | ELSEYAVAAALVALAVITAFSTLGKNIGIKIGDLATEITKTP |
| Ga0190267_106531822 | 3300019767 | Soil | ELSEYAVAAALVALAAVAAFQLLGTNIGTKITELANTVAK |
| Ga0207710_101202621 | 3300025900 | Switchgrass Rhizosphere | GLELSEYAVAAALVALACVVAFQTLGTQIGARIDTLAGFIK |
| Ga0207647_101628941 | 3300025904 | Corn Rhizosphere | EYAVAAALIALACVAAFQLLGTNIGLKINDLAGKIK |
| Ga0207709_116993391 | 3300025935 | Miscanthus Rhizosphere | ELSEYAVAAALVAVATVAAFQLLGTNIGSRINALAGSIK |
| Ga0207670_106676971 | 3300025936 | Switchgrass Rhizosphere | TGLELSEYAVAAALVALACVAAFQLLGSSIGTKINSLAGTINTGSTTP |
| Ga0207670_115458331 | 3300025936 | Switchgrass Rhizosphere | ETGLELSEYAVAAALVAVATVAAFQLLGTNIGSRINALAGWIK |
| Ga0207691_103558441 | 3300025940 | Miscanthus Rhizosphere | SGLELSEYAVAAALIALACVVAFQTLGTNIGTKINELAGKLQ |
| Ga0207691_105254761 | 3300025940 | Miscanthus Rhizosphere | YAVAAALIALACVAAFQLLGTNIGTKINELAGKIQ |
| Ga0207640_109553121 | 3300025981 | Corn Rhizosphere | TGLELSEYAVAAALVALAAVLAFQALGSNIGTKIQSLADTIGK |
| Ga0207640_114875431 | 3300025981 | Corn Rhizosphere | YAVAAALVALAAVAAFQLLGTNIGTKINELAGKIK |
| Ga0208531_10268401 | 3300026020 | Rice Paddy Soil | LELSEYAVAAALIALATVGAFQLLGTNITSKITDLANNVK |
| Ga0207677_104506903 | 3300026023 | Miscanthus Rhizosphere | LSEYAVAAALIALACVAAFQLLGTNIGLKINELAGKIQ |
| Ga0207703_100272435 | 3300026035 | Switchgrass Rhizosphere | ELSEYAVAAALVALAAVAAFQLLGTQIGAKINTLAGYIQ |
| Ga0207648_112687731 | 3300026089 | Miscanthus Rhizosphere | EYAVAAALIALACVAAFQLLGGNIGLKINELAGKIQYTFRF |
| Ga0207676_101755673 | 3300026095 | Switchgrass Rhizosphere | ETGLELSEYAVAAALVAMAAVVAFRTLGTNIAAKITELATTITGQ |
| Ga0209180_105141182 | 3300027846 | Vadose Zone Soil | LSEYAVAAALIAIACVVAFTTLGTAISSKINTLAATISG |
| Ga0268266_122161512 | 3300028379 | Switchgrass Rhizosphere | EYAVAAALVALAAVAAFQLLGTQIGAKINTLAGYIQ |
| Ga0307503_107119151 | 3300028802 | Soil | ELSEYAVAAALVALAVITAFTTLGTNIGAKIGNLATAISSTP |
| Ga0308178_10152073 | 3300030990 | Soil | MELSEYATAAALVTLAAITAFQLLGGNIGAKISELATKITG |
| Ga0308197_104407873 | 3300031093 | Soil | LELSEYAVAAALVALAAVAAFQLLGTNIGTKITALANTVK |
| Ga0308179_10284281 | 3300031424 | Soil | GLELSEYAVAAALIALATVAAFQLLGTNITGKITSLANTVK |
| Ga0310813_115249171 | 3300031716 | Soil | ELSEYAVAAALVALAAVAAFQLLGTNIGTKINELAGKIK |
| Ga0310904_101327413 | 3300031854 | Soil | GLELSEYAVAAALVAVATIAAFQLLGTNIGSRINALAGTIK |
| Ga0307412_102744861 | 3300031911 | Rhizosphere | LELSEYAVAAALVALAAVLAFQTLGTNIGLKINELADKIKP |
| Ga0307414_115144072 | 3300032004 | Rhizosphere | YAVAAALVALAAVAAFQLLGGNIGSKINELATKIQ |
| Ga0310890_107077534 | 3300032075 | Soil | YAVAAALIALACVAAFQLLGTNIGLKINDLAGKIK |
| Ga0307470_119309421 | 3300032174 | Hardwood Forest Soil | LELSEYAVAAALVAIAVVAAFTLLGGAISARITSLAGTISG |
| Ga0307471_1025503372 | 3300032180 | Hardwood Forest Soil | YAVAAALIAVATVAAFQLLGTSITSRITTLANNVK |
| Ga0334949_039698_1218_1343 | 3300034027 | Biocrust | LSEYAVAAALVALAVITAFTTLGTNISGRIDSLATKIGVTP |
| Ga0334929_055421_1_135 | 3300034135 | Hypolithic Biocrust | GLELSEYAVAAALIALATVTAFSGLGTTIKNAITNLSGKIPTTG |
| Ga0364935_0115554_711_833 | 3300034151 | Sediment | LELSEYAVAAALIALATVGAFQLLGTNITTKITDVANTVK |
| Ga0314782_068787_2_130 | 3300034661 | Soil | TGLELSEYAVAAALVALACVVAFQTLGTNIGTKINELAGKIK |
| Ga0314787_080667_459_578 | 3300034665 | Soil | ELSEYAVAAALVALAAVVAFQTLGANISTKITDLAGKIK |
| Ga0314788_081769_584_697 | 3300034666 | Soil | SEYAVAAALIALACVAAFQLLGTNIGLKINDLAGKIK |
| Ga0314792_229325_411_533 | 3300034667 | Soil | ELSEYAVAAALVALAAVAAFQLLGENIGAKINTLAETIAQ |
| Ga0314798_101110_500_610 | 3300034673 | Soil | EYAVAAALVALACVVAFQTLGTNIGTKINELASKIQ |
| Ga0314798_137332_424_549 | 3300034673 | Soil | GLELSEYAVAAALVAIAAVAAFQLLGTNIGSRINTLAGYIK |
| Ga0314798_151728_1_114 | 3300034673 | Soil | EYAVAAALIALACVAAFTLLGENIGAKINSLANTIAQ |
| Ga0314803_017980_2_115 | 3300034678 | Soil | AVAAALVALAAVAAFQLLGTNIGTKINELAGKIKYYF |
| ⦗Top⦘ |