NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F055798

Metagenome Family F055798

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055798
Family Type Metagenome
Number of Sequences 138
Average Sequence Length 42 residues
Representative Sequence FIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKKTRALFVD
Number of Associated Samples 114
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.10 %
% of genes from short scaffolds (< 2000 bps) 92.03 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.652 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(18.841 % of family members)
Environment Ontology (ENVO) Unclassified
(31.159 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.072 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.06%    β-sheet: 0.00%    Coil/Unstructured: 52.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF07690MFS_1 5.07
PF00854PTR2 4.35
PF01451LMWPc 2.90
PF00557Peptidase_M24 2.17
PF12275DUF3616 2.17
PF00365PFK 1.45
PF00211Guanylate_cyc 1.45
PF13414TPR_11 1.45
PF13181TPR_8 1.45
PF07719TPR_2 1.45
PF00126HTH_1 0.72
PF02913FAD-oxidase_C 0.72
PF00171Aldedh 0.72
PF00857Isochorismatase 0.72
PF01510Amidase_2 0.72
PF01965DJ-1_PfpI 0.72
PF13174TPR_6 0.72
PF13602ADH_zinc_N_2 0.72
PF00155Aminotran_1_2 0.72
PF08239SH3_3 0.72
PF01979Amidohydro_1 0.72
PF01436NHL 0.72
PF04255DUF433 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG3104Dipeptide/tripeptide permeaseAmino acid transport and metabolism [E] 4.35
COG02056-phosphofructokinaseCarbohydrate transport and metabolism [G] 1.45
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.45
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.72
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.72
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.72
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.72
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.72
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 0.72
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.65 %
UnclassifiedrootN/A4.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY02GMC2JAll Organisms → cellular organisms → Bacteria524Open in IMG/M
2170459010|GIO7OMY02H3G2VAll Organisms → cellular organisms → Bacteria508Open in IMG/M
3300000955|JGI1027J12803_106410557All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300004463|Ga0063356_104686079All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005166|Ga0066674_10091185All Organisms → cellular organisms → Bacteria1409Open in IMG/M
3300005166|Ga0066674_10271568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → Clostridium botulinum800Open in IMG/M
3300005175|Ga0066673_10438018All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium767Open in IMG/M
3300005181|Ga0066678_10245908All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300005187|Ga0066675_10496765All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300005289|Ga0065704_10238076All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300005290|Ga0065712_10005592All Organisms → cellular organisms → Bacteria2822Open in IMG/M
3300005354|Ga0070675_100281157All Organisms → cellular organisms → Bacteria1462Open in IMG/M
3300005364|Ga0070673_100440738All Organisms → cellular organisms → Bacteria1170Open in IMG/M
3300005437|Ga0070710_10089122All Organisms → cellular organisms → Bacteria1816Open in IMG/M
3300005445|Ga0070708_100675560All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300005451|Ga0066681_10020047All Organisms → cellular organisms → Bacteria3414Open in IMG/M
3300005456|Ga0070678_102172003All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005457|Ga0070662_101479044All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium586Open in IMG/M
3300005540|Ga0066697_10583323All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300005544|Ga0070686_101331850All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300005553|Ga0066695_10778555Not Available554Open in IMG/M
3300005554|Ga0066661_10209949All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300005576|Ga0066708_11046197All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005598|Ga0066706_11385672All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005764|Ga0066903_100252489All Organisms → cellular organisms → Bacteria2723Open in IMG/M
3300005764|Ga0066903_101050165All Organisms → cellular organisms → Bacteria1496Open in IMG/M
3300005764|Ga0066903_106903830All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium589Open in IMG/M
3300005844|Ga0068862_102436278All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300006031|Ga0066651_10197429All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300006031|Ga0066651_10729537All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300006034|Ga0066656_10053784All Organisms → cellular organisms → Bacteria2330Open in IMG/M
3300006046|Ga0066652_100284206All Organisms → cellular organisms → Bacteria1462Open in IMG/M
3300006046|Ga0066652_101484274All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300006237|Ga0097621_101657335All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium609Open in IMG/M
3300006796|Ga0066665_10968240All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium655Open in IMG/M
3300006796|Ga0066665_11155487All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300006871|Ga0075434_101615331All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300007255|Ga0099791_10150057All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1088Open in IMG/M
3300007788|Ga0099795_10322679All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium684Open in IMG/M
3300009089|Ga0099828_10313956All Organisms → cellular organisms → Bacteria → Proteobacteria1411Open in IMG/M
3300009098|Ga0105245_13252479All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium503Open in IMG/M
3300009137|Ga0066709_103315208All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium586Open in IMG/M
3300010038|Ga0126315_11102987All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium536Open in IMG/M
3300010047|Ga0126382_10280351Not Available1240Open in IMG/M
3300010047|Ga0126382_11589722All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium606Open in IMG/M
3300010048|Ga0126373_11884377All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300010321|Ga0134067_10370761All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium568Open in IMG/M
3300010322|Ga0134084_10038992All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1361Open in IMG/M
3300010323|Ga0134086_10082516All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300010329|Ga0134111_10160293All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium894Open in IMG/M
3300010366|Ga0126379_11212246All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium861Open in IMG/M
3300010366|Ga0126379_11557281All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium766Open in IMG/M
3300010366|Ga0126379_13192683All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia549Open in IMG/M
3300010366|Ga0126379_13317386All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium539Open in IMG/M
3300010373|Ga0134128_12628513All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium555Open in IMG/M
3300010376|Ga0126381_103506076All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300010398|Ga0126383_12082881All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300010868|Ga0124844_1054301Not Available1421Open in IMG/M
3300011119|Ga0105246_10249749All Organisms → cellular organisms → Bacteria1407Open in IMG/M
3300012198|Ga0137364_10376279All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300012202|Ga0137363_10819108All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium790Open in IMG/M
3300012205|Ga0137362_10230936All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1596Open in IMG/M
3300012208|Ga0137376_10232369All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1598Open in IMG/M
3300012208|Ga0137376_10850963All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium784Open in IMG/M
3300012210|Ga0137378_11247871All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium659Open in IMG/M
3300012285|Ga0137370_10022866All Organisms → cellular organisms → Bacteria3163Open in IMG/M
3300012285|Ga0137370_10808498All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300012285|Ga0137370_11040758All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300012357|Ga0137384_10035365All Organisms → cellular organisms → Bacteria4110Open in IMG/M
3300012360|Ga0137375_10603732All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium913Open in IMG/M
3300012361|Ga0137360_10954541All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium740Open in IMG/M
3300012683|Ga0137398_10701770All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium703Open in IMG/M
3300012685|Ga0137397_10295547All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1207Open in IMG/M
3300012901|Ga0157288_10101310All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300012906|Ga0157295_10153730All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium692Open in IMG/M
3300012914|Ga0157297_10366570All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium566Open in IMG/M
3300012917|Ga0137395_10655269All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300012922|Ga0137394_11033523All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300012925|Ga0137419_11155373All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium647Open in IMG/M
3300012930|Ga0137407_10391238All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1286Open in IMG/M
3300012948|Ga0126375_10473262All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium927Open in IMG/M
3300012948|Ga0126375_10584678All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium850Open in IMG/M
3300012971|Ga0126369_12139771Not Available647Open in IMG/M
3300012975|Ga0134110_10076059All Organisms → cellular organisms → Bacteria1339Open in IMG/M
3300012976|Ga0134076_10016321All Organisms → cellular organisms → Bacteria2590Open in IMG/M
3300012985|Ga0164308_10358238All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1179Open in IMG/M
3300012986|Ga0164304_11709555All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium526Open in IMG/M
3300012987|Ga0164307_10493145All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300014166|Ga0134079_10475514All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium598Open in IMG/M
3300014166|Ga0134079_10687749All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300014325|Ga0163163_12134935All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium620Open in IMG/M
3300014968|Ga0157379_12366595All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300015359|Ga0134085_10224931All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium812Open in IMG/M
3300015372|Ga0132256_100364442All Organisms → cellular organisms → Bacteria1542Open in IMG/M
3300015372|Ga0132256_100809958All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1053Open in IMG/M
3300016371|Ga0182034_11694824All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium556Open in IMG/M
3300018054|Ga0184621_10339693All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300018071|Ga0184618_10177326All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300018433|Ga0066667_10425630All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1079Open in IMG/M
3300018433|Ga0066667_11118613All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium682Open in IMG/M
3300018433|Ga0066667_11517400All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium593Open in IMG/M
3300018468|Ga0066662_10230198Not Available1495Open in IMG/M
3300018482|Ga0066669_10224702All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1461Open in IMG/M
3300019876|Ga0193703_1002076All Organisms → cellular organisms → Bacteria2889Open in IMG/M
3300019879|Ga0193723_1193694All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium512Open in IMG/M
3300019886|Ga0193727_1107170All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium816Open in IMG/M
3300019886|Ga0193727_1163323All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium591Open in IMG/M
3300020002|Ga0193730_1039393All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1369Open in IMG/M
3300021086|Ga0179596_10568877All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300021344|Ga0193719_10024017All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2608Open in IMG/M
3300021560|Ga0126371_10877947All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1041Open in IMG/M
3300021560|Ga0126371_12958392All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium575Open in IMG/M
3300022756|Ga0222622_10057877All Organisms → cellular organisms → Bacteria2221Open in IMG/M
3300022898|Ga0247745_1042384All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium704Open in IMG/M
3300023058|Ga0193714_1060522All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300025552|Ga0210142_1117785All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300025906|Ga0207699_11375048All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300025938|Ga0207704_10670581All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300026307|Ga0209469_1045514All Organisms → cellular organisms → Bacteria1404Open in IMG/M
3300026307|Ga0209469_1054318All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300026308|Ga0209265_1114621All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300026309|Ga0209055_1021887All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales3058Open in IMG/M
3300026316|Ga0209155_1155118All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium767Open in IMG/M
3300026325|Ga0209152_10277346All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300026334|Ga0209377_1280481All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium551Open in IMG/M
3300026524|Ga0209690_1097705All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1208Open in IMG/M
3300026538|Ga0209056_10200950All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1459Open in IMG/M
3300028379|Ga0268266_10420383All Organisms → cellular organisms → Bacteria1267Open in IMG/M
3300028379|Ga0268266_11410904All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium672Open in IMG/M
3300028708|Ga0307295_10031179All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1338Open in IMG/M
3300028799|Ga0307284_10113803All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1022Open in IMG/M
3300028878|Ga0307278_10267987All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300031446|Ga0170820_16387641All Organisms → cellular organisms → Bacteria1643Open in IMG/M
3300031474|Ga0170818_114286101All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium592Open in IMG/M
3300031681|Ga0318572_10830893All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium549Open in IMG/M
3300031941|Ga0310912_10624262Not Available838Open in IMG/M
3300031941|Ga0310912_11341501All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium541Open in IMG/M
3300032205|Ga0307472_102237322All Organisms → cellular organisms → Bacteria552Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil18.84%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.14%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.35%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.17%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.17%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.45%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.45%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.45%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.45%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.45%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.72%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.72%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.72%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.72%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.72%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019876Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300023058Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1EnvironmentalOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_041517002170459010Grass SoilPCFIRPQRLFSVEQHVILHSVGKVTAAKYDEVFKKVRSLFH
F62_083103902170459010Grass SoilIGQPCFIRPQRLFSVEQHVILHSVGKVTAAKYDEVFKKVRSLFID
JGI1027J12803_10641055713300000955SoilGEIGQPCFIRPQRLFSVEQHVILYSVGKVTAAKFDEVFKKARALFVD*
Ga0063356_10468607923300004463Arabidopsis Thaliana RhizosphereDQPCFIRPQRLFTVEQHVILGSVGKVTAEKFDEVFKKARALFVD*
Ga0066674_1009118543300005166SoilFIRPQRLFTVEHHIILHSVGKVTAAKFDEVFKKARALFVD*
Ga0066674_1027156813300005166SoilQPGFIRPQRLFTVEQHVIFHAVGKVTAEKFDEVFKKTRALFVD*
Ga0066673_1043801823300005175SoilFIRPQRLFTVEQHVIFHAVGKVTAEKFDEVFKKTRALFVD*
Ga0066678_1024590823300005181SoilFIRPQRLFTVEHHIILHSAGKVTAAKFDEVFKKARALFVD*
Ga0066675_1049676513300005187SoilQPCFIRPQRLFTVEQHFILHSVGKVTAEKYDEVFKKVRGLFID*
Ga0065704_1023807613300005289Switchgrass RhizosphereGFIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKKARALFVD*
Ga0065712_1000559223300005290Miscanthus RhizosphereLDQPCFIRPQRLFTVEQHVILHSVGKVTAAKYDEVFKKVRTLFID*
Ga0070675_10028115723300005354Miscanthus RhizosphereDQPCFIRPQRLFTVEQHVILHSVGKVTAAKYDEVFKKVRTLFID*
Ga0070673_10044073813300005364Switchgrass RhizosphereLDQPCFIRPQRLFTVEQHVIIRSVGKVTAAKYDEVFKKVRTLFID*
Ga0070710_1008912233300005437Corn, Switchgrass And Miscanthus RhizosphereQCFIRPQRLFTVDCRVILKSVGKVNAAKLDEVSVKVRELFS*
Ga0070708_10067556013300005445Corn, Switchgrass And Miscanthus RhizosphereIRPQRLFSVEQHVILHSVGKVTADKFDEVFKRVRGLLVD*
Ga0066681_1002004713300005451SoilCFIRPQRLFSVEQHFILHSVGKVTTDKFDEVFKRVRGLLVD*
Ga0070678_10217200313300005456Miscanthus RhizosphereCERGEIGQPCFIRPQRLFTVEQHVILHSVGKVTAEKYDEVFKKTRTLFID*
Ga0070662_10147904423300005457Corn RhizosphereIGQPCFIRPQRLFTVEQRVCLKAIGKVTAEKFDEVFKRARSLFVD*
Ga0066697_1058332323300005540SoilLDQPCFIRPQRLFTLEHHIILHSVGKVNAAKFDEVFKKVRGLLVD*
Ga0070686_10133185023300005544Switchgrass RhizosphereIRPQRLFTVEQHVIIRSVGKVTAAKYDEVFKKVRTLFID*
Ga0066695_1077855523300005553SoilMNANPQRLFTVEQHIILNSVGKVTAEKFDEMFKKVRGLLVD*
Ga0066661_1020994933300005554SoilIRPQRLFTVEQHVILRSVGKVTAEKFDEVFKKARALFVD*
Ga0066708_1104619713300005576SoilCFIRPQRLFTVEQHVILHSVGKVTSEKFDEVFKRVRGLFVD*
Ga0066706_1138567213300005598SoilERGEIDQPCFIRPQRLFTVEQHVILHSVGKVTSEKFDEVFKRMRGLFVD*
Ga0066903_10025248913300005764Tropical Forest SoilPQRLFTVEQHIILHSVGKVTAAKFDEVFKKTRALLVD*
Ga0066903_10105016513300005764Tropical Forest SoilERGQIGRPCFIRPQRLFTVEQRVCLQSVGKVTAEKFDEVFKKARALFVD*
Ga0066903_10690383033300005764Tropical Forest SoilRLFTVEQRVCLQSVGKVSAEKFDEVFKKARALFVD*
Ga0068862_10243627823300005844Switchgrass RhizosphereFIRPQRLFTVEQHVILHSVGKVTAAKYDEVFKKVRTLFID*
Ga0066651_1019742913300006031SoilRLFTVEHHIILHSVGKVTAAKFHEVFKKTRALFID*
Ga0066651_1072953713300006031SoilCFIRPQRLFSVEQHVILRSVGKVTTNKFDEVFKRVRGLFVD*
Ga0066656_1005378453300006034SoilRLFTVEHHIILHSVGKVTAAKFDEVFNKARALFVD*
Ga0066652_10028420623300006046SoilCFIRPQRLFTVEQHVCLHSVGKVTAEKFDEVFKKVRGLLVD*
Ga0066652_10148427423300006046SoilGFIRPQRLFTVDYRVILKSVGKVNTVKLDEVLVKVRELFD*
Ga0097621_10165733523300006237Miscanthus RhizosphereQRLFTVEQHVIIRSVGKVTAAKYDEVFKKVRTLFID*
Ga0066665_1096824043300006796SoilLFTLEHHIILHSVGKVNAAKFDEVFKKARALFVD*
Ga0066665_1115548723300006796SoilERGEIGQPCFIRPQRLFTVEHHIILHSVGKVTAAKFDEVFKKARALFVD*
Ga0075434_10161533123300006871Populus RhizosphereIDQPCVIRPQRLFTVEQHVILHSVGKVTAQKYDEVFKKVRGLFID*
Ga0099791_1015005723300007255Vadose Zone SoilCFIRPQRLFNVEQHFILKSVGKVTPAKFDEVFKKARTLFVD*
Ga0099795_1032267913300007788Vadose Zone SoilQLPQPGFIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKKARALFVD*
Ga0099828_1031395613300009089Vadose Zone SoilRPQRLFTVEHHTILSSIGKVQAAKLDEVLRKARAFFD*
Ga0105245_1325247913300009098Miscanthus RhizosphereLFTVEQHVILHSVGKVTAAKYDEVFKKVRTLFID*
Ga0066709_10331520823300009137Grasslands SoilVGKPCLIRQQRLFTVEQHVCLHSGGKVTAAKFDEVFKKARARLVD*
Ga0126315_1110298713300010038Serpentine SoilGVDQPSFIRPQRLFTVEQHVILRSVGKVTAEKFDEVFKKTRTLFID*
Ga0126382_1028035123300010047Tropical Forest SoilPKRLVAVEQRICLRSVGKVPAEKFDEVFKKARALFVD*
Ga0126382_1158972223300010047Tropical Forest SoilLVTVEQNAILSWVGKVTAEKVDEVFKRVRGLVID*
Ga0126373_1188437723300010048Tropical Forest SoilRPQRLFTIEQRVCLRSIGKVTAEKFDEVFKKARSLFVD*
Ga0134067_1037076123300010321Grasslands SoilQRLFTVEQHVILHSVGKVTSEKFDEVFKRMRGLFVD*
Ga0134084_1003899213300010322Grasslands SoilLFTVEQHVILHSVGKVTAQKFDEVFKKMRTLFVD*
Ga0134086_1008251633300010323Grasslands SoilQIDKPCFIRPQRLFSVEQHVILHSVGKVTADKFDEVFKRVRGLLVD*
Ga0134111_1016029323300010329Grasslands SoilMNANPQRLFTVEHHIILNSVSKVTAAKFDDVFKRVRALFVN*
Ga0126379_1121224613300010366Tropical Forest SoilLFTVEQRVCLQSVGKVSAEKFDEVFKKARALFVD*
Ga0126379_1155728123300010366Tropical Forest SoilGPCFIRPQRLFTVEQHIILHSVGKVTAAKFDEVFKKTRALLVD*
Ga0126379_1319268313300010366Tropical Forest SoilIRPQRLFTVEQHVILHSVGKVVPEKFDEVFKKARALLID*
Ga0126379_1331738623300010366Tropical Forest SoilGQLDQPCFIRPQRLFTVDQHVILHSVGKVTPGKLDEVFKKTRALLVD*
Ga0134128_1262851313300010373Terrestrial SoilPQRLFTVEQHVILRTVGKVTAAKYDEVFKKTRTLFID*
Ga0126381_10350607623300010376Tropical Forest SoilLFTVDQHVILNSVGKVTAEKFDEVFKKARALFVD*
Ga0126383_1208288123300010398Tropical Forest SoilQPCFIRAQRLFTVEQHVILSSVGKVTPQKFDEVFKKARALLVD*
Ga0124844_105430113300010868Tropical Forest SoilFIRPQRLFTVEQRIILHSVGKVSAEKFDEVFKKARALFVD*
Ga0105246_1024974913300011119Miscanthus RhizosphereGHPCFIRPQRLFTVEQHVILSSVGKVTAEKFDEVFKKTRTLFVD*
Ga0137364_1037627923300012198Vadose Zone SoilVIAEFDKADRSQRLFTVEHHIILHSVGKVTAAKFHEVFKKTRALFID*
Ga0137363_1081910813300012202Vadose Zone SoilCERGEIGQPCFIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKKVRTLFVD*
Ga0137362_1023093613300012205Vadose Zone SoilRGQIDKPCFIRPQRLFSVEQHFILHSVGKVTTDKFDEVFKKVRGLLVD*
Ga0137376_1023236933300012208Vadose Zone SoilIRPQRLFTVEQHVILRTVGKVTAAKYDEVFKKTRTLFID*
Ga0137376_1085096323300012208Vadose Zone SoilIRPQRLFTVEQHVILRTVGKVTAAKYDEVFKKTRALFID*
Ga0137378_1124787113300012210Vadose Zone SoilPGFIRPQRLFTVEHHIILNSVSKVTAAKFDDVFKRVRALFVN*
Ga0137370_1002286613300012285Vadose Zone SoilLFTVEQHVILHSVGKVTAEKFDEVFKKARALFVD*
Ga0137370_1080849813300012285Vadose Zone SoilAEFDKADRSQRLFTVEHHIILHSVGKVTAAKFHEVFKKTRALFID*
Ga0137370_1104075823300012285Vadose Zone SoilGFIRPQRLFTVEHHIILSTVGKVTAEKFDEVFKKARALFVD*
Ga0137384_1003536513300012357Vadose Zone SoilLGQPCFIRPQRLFTVEHHIILSSIGKVQTAKLDEVLRKARAFFD*
Ga0137375_1060373213300012360Vadose Zone SoilLFTLEHHIILHSVGKVNAAKFDEVFKKVRGLLVD*
Ga0137360_1095454123300012361Vadose Zone SoilRPQRLFSVEHHIILHSVGKVTAEKFDEVFKKARALFVD*
Ga0137398_1070177023300012683Vadose Zone SoilERGQLDQPCFIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKKARALFVD*
Ga0137397_1029554713300012685Vadose Zone SoilRLFTVEQHVILHAVGKVTAEKFDEVFKKTRTLFVD*
Ga0157288_1010131023300012901SoilERGEIDQPCFIRPQRLFTVEQHVILQSVGKVTAVKYDEVFKKVRTLFID*
Ga0157295_1015373013300012906SoilPQRLFTVEQHVIIRSVGKVTAAKYDEVFKKVRTLFID*
Ga0157297_1036657013300012914SoilRLFTVEQHVIIHSMGKVTAAKYDEVFKKVRTLFID*
Ga0137395_1065526913300012917Vadose Zone SoilQPCFIRPQRLFTVEHHIILSSIGKVQTAKLGEVLRKARAFFD*
Ga0137394_1103352313300012922Vadose Zone SoilRLFTVEQHVILHSVGKVTSEKFDEVFKKTRTLFVD*
Ga0137419_1115537313300012925Vadose Zone SoilIDQPCFIRPQRLFTVEQHVILHSMGKVTAAKYDEVFKKVRALFVD*
Ga0137407_1039123823300012930Vadose Zone SoilPQRLFTVEQHVILHSVGKVTAEKFDEVFKKARALFVD*
Ga0126375_1047326213300012948Tropical Forest SoilQRLFTVEQHIILQSIGKVTAEKFDEVFKKARALFVD*
Ga0126375_1058467813300012948Tropical Forest SoilPCFIRPQRLFTVEQRIILHSVGKVSAEKFDEVFKKARALFVD*
Ga0126369_1213977113300012971Tropical Forest SoilRFAQPSFIRPQRLFTVEQRVILYSIGKVKAAKMAEVLAKARALFS*
Ga0134110_1007605913300012975Grasslands SoilPQRLFSVEQHVILHSVGKVTTEKFDEVFKRVRELFVD*
Ga0134076_1001632143300012976Grasslands SoilGFIRPQRLFTVEHHIILSSVGKVTAAKFDEVFKKARALFVD*
Ga0164308_1035823813300012985SoilIDHPCLIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKKARALFVD*
Ga0164304_1170955513300012986SoilLFTVEQHVIFHSVEKVTAAKYDEVFKKVRTLFID*
Ga0164307_1049314513300012987SoilCFIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKKTRTLFVD*
Ga0134079_1047551413300014166Grasslands SoilQLPQPGFIRSQRLFTVEQHVILHSVGKVTAEKFDEVFKKARALFVD*
Ga0134079_1068774913300014166Grasslands SoilRLFSVEQHVILRSVGKVTAEKFDEVFKRVRGLFVD*
Ga0163163_1213493513300014325Switchgrass RhizosphereGGVGHPCFIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKKARALFVD*
Ga0157379_1236659513300014968Switchgrass RhizosphereQLDGPCFIRPQRLFTVEQHLILRSVGKVTAEKFDEVFKKARALLVD*
Ga0134085_1022493113300015359Grasslands SoilIRPQRLFTVDYRVILSSVGKVNTAKLDEVLVKVRELFD*
Ga0132256_10036444223300015372Arabidopsis RhizosphereGEIGDPCFIRPQRLFTVEQHVILSSVGKVIAEKFDEVFKKMRTLFVD*
Ga0132256_10080995813300015372Arabidopsis RhizosphereEIDQPCFIRPQRLFTVEQHVILHSVGKVTAVKYDEVFKKVRTLFID*
Ga0182034_1169482413300016371SoilRGQIGRPCFIRPQRLFTVEQRVCLQSVGKVTAEKFDEVFKKARALFVD
Ga0184621_1033969313300018054Groundwater SedimentIRPQRLFTVEQHVILHAVGKVTAEKFDEVFKKARALFVD
Ga0184618_1017732623300018071Groundwater SedimentIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKKTRALFVD
Ga0066667_1042563013300018433Grasslands SoilRGEIDQPCFIRPQRLFTVEQHVILHSVGEVTSEKFDEVFKQMRGLFVD
Ga0066667_1111861313300018433Grasslands SoilQIDRPCFIRPQRLFSVEQHVILHSIGKVTAEKFDEVFKKARALFVD
Ga0066667_1151740013300018433Grasslands SoilQGFIRPQRLFTVDYRVILHSVGKVQAAKLDEVLVKVRELFV
Ga0066662_1023019823300018468Grasslands SoilFIRPQRLFAVEQHVILHSIGKVTAEKFDEVFKKTRALFVD
Ga0066669_1022470223300018482Grasslands SoilCFIRPQRLFTVEQHVILHSLGKVTAAKFEEVFKKARALLVD
Ga0193703_100207613300019876SoilCFIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKRTRALFVD
Ga0193723_119369413300019879SoilGQPGFIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKKTLTLFVD
Ga0193727_110717013300019886SoilERGEIGQPCFIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKKTLTLFVD
Ga0193727_116332323300019886SoilIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKRTRALFVD
Ga0193730_103939313300020002SoilQLDQPCFIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKRTRALFVD
Ga0179596_1056887713300021086Vadose Zone SoilAQPCFIRPQRLFTVEHHIILSSIGKVQAAKLDEVLKKARAFFD
Ga0193719_1002401713300021344SoilERGQIDQPCFIRPQRLFSVEHHIILSSVAKVTAAKFDEVFKKTRALFVD
Ga0126371_1087794723300021560Tropical Forest SoilCFIRPQRLFTVEQHVILHSIGKVTGEKFDEVFKKFRGLFVD
Ga0126371_1295839223300021560Tropical Forest SoilRPQRLFTVEQRVCLQSVGKVSAEKFDEVFKKARALFVD
Ga0222622_1005787713300022756Groundwater SedimentEIGQPGFIRSQRLFTVEQHVILHSIGKVTAEKFDEVFKKTRALFVD
Ga0247745_104238413300022898SoilIRSQRLFTVEQHVILHSMGKVTAAKYDEVFKKVRTLFID
Ga0193714_106052213300023058SoilDQPCFIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKKMRTLFVD
Ga0210142_111778513300025552Natural And Restored WetlandsAPCFIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKKTRTLFVD
Ga0207699_1137504813300025906Corn, Switchgrass And Miscanthus RhizosphereERGEIGHPCFIRPPRLFTVEQHLILRSVGKVTAEKFDEVFKKARSLIVD
Ga0207704_1067058113300025938Miscanthus RhizosphereFIRPQRLFTVEQHVILHSVGKVTAAKYDEVFKKTRTLFID
Ga0209469_104551413300026307SoilIRPQRLFTVEHHIILHSVGKVTAAKFDEVFKKARALFVD
Ga0209469_105431813300026307SoilRPQRLFTVEHHIILHSVGKVTTEKFDEVFKRVRELFVD
Ga0209265_111462123300026308SoilIRPQRLFSVEQHVILHSVGKVTTEKFDEVFKRVRELFVD
Ga0209055_102188733300026309SoilQRLFAVEQHVILHSIGKVTAEKFDEVFKKTRALFVD
Ga0209155_115511813300026316SoilFIRPQRLFTVEQHVIFHAVGKVTAEKFDEVFKKTRALFVD
Ga0209152_1027734623300026325SoilVITPQRLFTVEQHVILHSIGKVTAEKFDEVFKKARALFVD
Ga0209377_128048113300026334SoilFIRPQRLFTVEHHIILHSVGKVTAAKFDEVFKKTRALFID
Ga0209690_109770513300026524SoilFEHGQFTQQGFIRPQRLFTVDYRVILKSVGKVNTVKLDEVLVKVRELFD
Ga0209056_1020095033300026538SoilFERGQLPQPGFIRPQRLFTVEQHVIFHAVGKVTAEKFDEVFKKTRALFVD
Ga0268266_1042038323300028379Switchgrass RhizosphereEIGQPCFIRPQRLFTGEQHVILHSVGKVTAEKFDEVFKKTRTLFVD
Ga0268266_1141090413300028379Switchgrass RhizosphereCFIRPQRLFTVEQHVIIRSVGKVTAAKYDEVFKKVRTLFID
Ga0307295_1003117913300028708SoilCERGEIGQPCFIRPQRLFTVEQHVILHSVGKVTAAKYDEVFKKTLTLFVD
Ga0307284_1011380313300028799SoilCFIRPQRLFTVEQHVILHSVGKVTAAKYDEVFKKVRTLFID
Ga0307278_1026798713300028878SoilFIRPQRLFTVEQHVILHSVGKVTAEKFDEVFKKTRALFVD
Ga0170820_1638764133300031446Forest SoilRPQRLFTVEQHVILHSVGKVTAEKFDEVFKKARALFVD
Ga0170818_11428610113300031474Forest SoilPQRLFTVEQHVILHSVGKVTAEKFDEVFKKVRALFVD
Ga0318572_1083089313300031681SoilQPCFIRPQRLFTVEQRVCLQSVGKVSAEKFDEVFKKARALFVD
Ga0310912_1062426223300031941SoilERGRLAQPRFIRPQRLFTVEQRVILYSIGKVKAAKMAEVLAKAHALFS
Ga0310912_1134150113300031941SoilDCERGQIGQPCFIRPQRLFTVEQRVCLQSVGKVSAEKFDEVFKKARALFVD
Ga0307472_10223732213300032205Hardwood Forest SoilGQPCFIRPQRLFSVEQHVILSSVGKVTAAKFDEVFKKVRGLLLD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.