Metagenome / Metatranscriptome Family F055795

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F055795
Family Type	Metagenome / Metatranscriptome
Number of Sequences	138
Average Sequence Length	46 residues
Representative Sequence	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVESDETDRD
Number of Associated Samples	108
Number of Associated Scaffolds	138

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	71.74 %
% of genes near scaffold ends (potentially truncated)	31.88 %
% of genes from short scaffolds (< 2000 bps)	87.68 %
Associated GOLD sequencing projects	100
AlphaFold2 3D model prediction	No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (93.478 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.667 % of family members)
Environment Ontology (ENVO)	Unclassified (31.884 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (58.696 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 138 Family Scaffolds
PF12706	Lactamase_B_2	39.86
PF08042	PqqA	15.94
PF10282	Lactonase	9.42
PF00118	Cpn60_TCP1	1.45
PF03070	TENA_THI-4	1.45
PF02239	Cytochrom_D1	1.45
PF06441	EHN	0.72
PF00005	ABC_tran	0.72
PF13517	FG-GAP_3	0.72

COG ID	Name	Functional Category	% Frequency in 138 Family Scaffolds
COG0459	Chaperonin GroEL (HSP60 family)	Posttranslational modification, protein turnover, chaperones [O]	1.45
COG0596	2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold	Coenzyme transport and metabolism [H]	0.72

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	93.48 %
Unclassified	root	N/A	6.52 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	93.48 %
Unclassified	root	N/A	6.52 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	93.48 %
Unclassified	root	N/A	6.52 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	38.41 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	7.97 %
Unclassified	root	N/A	6.52 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	0.72 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	18.84 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	10.14 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	7.97 %
Unclassified	root	N/A	6.52 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	3.62 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	0.72 %

Name	Rank	Taxonomy	Distribution
Nevskiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales	13.04 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	7.97 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	7.25 %
Unclassified	root	N/A	6.52 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3.62 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	0.72 %

Name	Rank	Taxonomy	Distribution
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	13.04 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	7.97 %
Elioraeaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae	7.25 %
Unclassified	root	N/A	6.52 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	3.62 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	0.72 %

Name	Rank	Taxonomy	Distribution
unclassified Sinobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae	13.04 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	7.97 %
Elioraea	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea	7.25 %
Unclassified	root	N/A	6.52 %
Sorangiineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae	3.62 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	0.72 %

Name	Rank	Taxonomy	Distribution
Sinobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	13.04 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	7.97 %
Elioraea tepidiphila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	7.25 %
Unclassified	root	N/A	6.52 %
Polyangiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae	3.62 %
Nitrospira moscoviensis	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis	0.72 %

Name	Rank	Taxonomy	Distribution
Sinobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	13.04 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	7.97 %
Elioraea tepidiphila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	7.25 %
Unclassified	root	N/A	6.52 %
Sorangium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium	1.45 %
Nitrospira moscoviensis	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis	0.72 %

Name	Rank	Taxonomy	Distribution
Sinobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	13.04 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	7.97 %
Elioraea tepidiphila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	7.25 %
Unclassified	root	N/A	6.52 %
Sorangium cellulosum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum	1.45 %
Nitrospira moscoviensis	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis	0.72 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000559\|F14TC_101323615	Not Available	526	Open in IMG/M
3300004025\|Ga0055433_10120828	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	612	Open in IMG/M
3300004153\|Ga0063455_101482380	All Organisms → cellular organisms → Bacteria	528	Open in IMG/M
3300004463\|Ga0063356_100086674	All Organisms → cellular organisms → Bacteria → Proteobacteria	3336	Open in IMG/M
3300004643\|Ga0062591_102154874	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	579	Open in IMG/M
3300005205\|Ga0068999_10095344	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	586	Open in IMG/M
3300005327\|Ga0070658_11614235	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	562	Open in IMG/M
3300005328\|Ga0070676_10056899	All Organisms → cellular organisms → Bacteria	2312	Open in IMG/M
3300005329\|Ga0070683_100001515	All Organisms → cellular organisms → Bacteria → Proteobacteria	17949	Open in IMG/M
3300005329\|Ga0070683_100077073	All Organisms → cellular organisms → Bacteria → Proteobacteria	3117	Open in IMG/M
3300005329\|Ga0070683_101223803	All Organisms → cellular organisms → Bacteria → Proteobacteria	722	Open in IMG/M
3300005330\|Ga0070690_100028505	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae	3459	Open in IMG/M
3300005334\|Ga0068869_100059808	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2791	Open in IMG/M
3300005338\|Ga0068868_100208152	All Organisms → cellular organisms → Bacteria	1633	Open in IMG/M
3300005340\|Ga0070689_100058353	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum	2997	Open in IMG/M
3300005340\|Ga0070689_100403045	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	1156	Open in IMG/M
3300005354\|Ga0070675_100436293	All Organisms → cellular organisms → Bacteria	1173	Open in IMG/M
3300005354\|Ga0070675_100686633	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	932	Open in IMG/M
3300005365\|Ga0070688_100025963	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae	3474	Open in IMG/M
3300005365\|Ga0070688_100587625	All Organisms → cellular organisms → Bacteria	851	Open in IMG/M
3300005438\|Ga0070701_10360457	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	911	Open in IMG/M
3300005438\|Ga0070701_11116976	All Organisms → cellular organisms → Bacteria	556	Open in IMG/M
3300005440\|Ga0070705_101008056	All Organisms → cellular organisms → Bacteria	676	Open in IMG/M
3300005441\|Ga0070700_100434792	All Organisms → cellular organisms → Bacteria	995	Open in IMG/M
3300005458\|Ga0070681_10055212	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae	3956	Open in IMG/M
3300005466\|Ga0070685_10090818	All Organisms → cellular organisms → Bacteria	1848	Open in IMG/M
3300005535\|Ga0070684_100364618	All Organisms → cellular organisms → Bacteria	1330	Open in IMG/M
3300005535\|Ga0070684_100970317	All Organisms → cellular organisms → Bacteria	797	Open in IMG/M
3300005535\|Ga0070684_101869078	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	567	Open in IMG/M
3300005539\|Ga0068853_100257340	All Organisms → cellular organisms → Bacteria	1604	Open in IMG/M
3300005547\|Ga0070693_101107787	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	604	Open in IMG/M
3300005548\|Ga0070665_100938215	All Organisms → cellular organisms → Bacteria	878	Open in IMG/M
3300005614\|Ga0068856_102059869	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	581	Open in IMG/M
3300005618\|Ga0068864_101291632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	730	Open in IMG/M
3300005764\|Ga0066903_100000356	All Organisms → cellular organisms → Bacteria → Proteobacteria	27705	Open in IMG/M
3300005764\|Ga0066903_101049779	All Organisms → cellular organisms → Bacteria	1496	Open in IMG/M
3300005836\|Ga0074470_10557634	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	589	Open in IMG/M
3300005836\|Ga0074470_11711217	All Organisms → cellular organisms → Bacteria → Proteobacteria	1372	Open in IMG/M
3300005841\|Ga0068863_100122433	All Organisms → cellular organisms → Bacteria	2481	Open in IMG/M
3300006237\|Ga0097621_102117920	All Organisms → cellular organisms → Bacteria	538	Open in IMG/M
3300006871\|Ga0075434_101488983	All Organisms → cellular organisms → Bacteria	686	Open in IMG/M
3300006881\|Ga0068865_100532996	All Organisms → cellular organisms → Bacteria → Proteobacteria	984	Open in IMG/M
3300009012\|Ga0066710_101472131	All Organisms → cellular organisms → Bacteria → Acidobacteria	1052	Open in IMG/M
3300009137\|Ga0066709_101946739	All Organisms → cellular organisms → Bacteria	816	Open in IMG/M
3300009156\|Ga0111538_14082223	All Organisms → cellular organisms → Bacteria	504	Open in IMG/M
3300009177\|Ga0105248_12491735	Not Available	589	Open in IMG/M
3300009551\|Ga0105238_11207551	All Organisms → cellular organisms → Bacteria → Acidobacteria	781	Open in IMG/M
3300009609\|Ga0105347_1181703	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	837	Open in IMG/M
3300010320\|Ga0134109_10223219	All Organisms → cellular organisms → Bacteria	702	Open in IMG/M
3300010362\|Ga0126377_13006258	All Organisms → cellular organisms → Bacteria	544	Open in IMG/M
3300010399\|Ga0134127_13384916	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis	522	Open in IMG/M
3300010403\|Ga0134123_11064426	All Organisms → cellular organisms → Bacteria	830	Open in IMG/M
3300011405\|Ga0137340_1019530	All Organisms → cellular organisms → Bacteria	1240	Open in IMG/M
3300011422\|Ga0137425_1073345	All Organisms → cellular organisms → Bacteria	804	Open in IMG/M
3300011429\|Ga0137455_1135200	All Organisms → cellular organisms → Bacteria → Acidobacteria	732	Open in IMG/M
3300012212\|Ga0150985_103996319	All Organisms → cellular organisms → Bacteria	528	Open in IMG/M
3300012353\|Ga0137367_10228877	All Organisms → cellular organisms → Bacteria	1341	Open in IMG/M
3300012892\|Ga0157294_10104953	Not Available	731	Open in IMG/M
3300012895\|Ga0157309_10031805	All Organisms → cellular organisms → Bacteria	1224	Open in IMG/M
3300012898\|Ga0157293_10187689	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	613	Open in IMG/M
3300012899\|Ga0157299_10102972	All Organisms → cellular organisms → Bacteria	741	Open in IMG/M
3300012909\|Ga0157290_10224254	Not Available	653	Open in IMG/M
3300012958\|Ga0164299_10760592	All Organisms → cellular organisms → Bacteria	686	Open in IMG/M
3300012961\|Ga0164302_10587460	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	805	Open in IMG/M
3300012984\|Ga0164309_11042534	All Organisms → cellular organisms → Bacteria	677	Open in IMG/M
3300012986\|Ga0164304_10849904	All Organisms → cellular organisms → Bacteria	709	Open in IMG/M
3300012987\|Ga0164307_10489880	All Organisms → cellular organisms → Bacteria	927	Open in IMG/M
3300012989\|Ga0164305_10800583	All Organisms → cellular organisms → Bacteria	782	Open in IMG/M
3300014318\|Ga0075351_1011327	All Organisms → cellular organisms → Bacteria	1275	Open in IMG/M
3300014745\|Ga0157377_10319182	All Organisms → cellular organisms → Bacteria	1031	Open in IMG/M
3300014969\|Ga0157376_11126618	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	811	Open in IMG/M
3300014969\|Ga0157376_12968213	All Organisms → cellular organisms → Bacteria	513	Open in IMG/M
3300015201\|Ga0173478_10238151	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	788	Open in IMG/M
3300015371\|Ga0132258_10021853	All Organisms → cellular organisms → Bacteria	13990	Open in IMG/M
3300015371\|Ga0132258_11290337	All Organisms → cellular organisms → Bacteria	1845	Open in IMG/M
3300015371\|Ga0132258_11952691	All Organisms → cellular organisms → Bacteria → Acidobacteria	1477	Open in IMG/M
3300015372\|Ga0132256_102029221	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	681	Open in IMG/M
3300015374\|Ga0132255_100338268	All Organisms → cellular organisms → Bacteria	2176	Open in IMG/M
3300015374\|Ga0132255_102093600	All Organisms → cellular organisms → Bacteria → Acidobacteria	862	Open in IMG/M
3300015374\|Ga0132255_102648645	All Organisms → cellular organisms → Bacteria → Acidobacteria	766	Open in IMG/M
3300015374\|Ga0132255_104559904	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	587	Open in IMG/M
3300015374\|Ga0132255_105803725	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	522	Open in IMG/M
3300018073\|Ga0184624_10136154	All Organisms → cellular organisms → Bacteria → Acidobacteria	1072	Open in IMG/M
3300018073\|Ga0184624_10248798	Not Available	797	Open in IMG/M
3300018084\|Ga0184629_10499848	All Organisms → cellular organisms → Bacteria	633	Open in IMG/M
3300018469\|Ga0190270_10513347	All Organisms → cellular organisms → Bacteria → Acidobacteria	1146	Open in IMG/M
3300018476\|Ga0190274_10816487	All Organisms → cellular organisms → Bacteria	991	Open in IMG/M
3300018481\|Ga0190271_10419709	All Organisms → cellular organisms → Bacteria	1436	Open in IMG/M
3300018482\|Ga0066669_10602464	All Organisms → cellular organisms → Bacteria	963	Open in IMG/M
3300019263\|Ga0184647_1259614	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	620	Open in IMG/M
3300019361\|Ga0173482_10645532	Not Available	539	Open in IMG/M
3300019362\|Ga0173479_10362583	All Organisms → cellular organisms → Bacteria	685	Open in IMG/M
3300021082\|Ga0210380_10253375	All Organisms → cellular organisms → Bacteria	798	Open in IMG/M
3300022756\|Ga0222622_10078847	All Organisms → cellular organisms → Bacteria	1963	Open in IMG/M
3300024055\|Ga0247794_10030513	All Organisms → cellular organisms → Bacteria → Acidobacteria	1394	Open in IMG/M
3300025315\|Ga0207697_10087301	All Organisms → cellular organisms → Bacteria → Proteobacteria	1319	Open in IMG/M
3300025315\|Ga0207697_10168033	All Organisms → cellular organisms → Bacteria	959	Open in IMG/M
3300025893\|Ga0207682_10561282	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300025904\|Ga0207647_10577235	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	622	Open in IMG/M
3300025918\|Ga0207662_10002479	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	9266	Open in IMG/M
3300025918\|Ga0207662_11046938	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	580	Open in IMG/M
3300025926\|Ga0207659_11206844	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	650	Open in IMG/M
3300025930\|Ga0207701_10086065	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum	2835	Open in IMG/M
3300025930\|Ga0207701_10203515	All Organisms → cellular organisms → Bacteria	1739	Open in IMG/M
3300025930\|Ga0207701_11231291	Not Available	616	Open in IMG/M
3300025936\|Ga0207670_10860847	All Organisms → cellular organisms → Bacteria	757	Open in IMG/M
3300025936\|Ga0207670_11274946	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	623	Open in IMG/M
3300025937\|Ga0207669_11544296	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	566	Open in IMG/M
3300025938\|Ga0207704_10297025	All Organisms → cellular organisms → Bacteria	1235	Open in IMG/M
3300025940\|Ga0207691_11562098	All Organisms → cellular organisms → Bacteria	538	Open in IMG/M
3300025941\|Ga0207711_10839425	All Organisms → cellular organisms → Bacteria	855	Open in IMG/M
3300025941\|Ga0207711_11023476	All Organisms → cellular organisms → Bacteria → Acidobacteria	766	Open in IMG/M
3300025944\|Ga0207661_10197076	All Organisms → cellular organisms → Bacteria	1769	Open in IMG/M
3300025944\|Ga0207661_10950902	All Organisms → cellular organisms → Bacteria	791	Open in IMG/M
3300025954\|Ga0210135_1007675	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	966	Open in IMG/M
3300025961\|Ga0207712_10488955	All Organisms → cellular organisms → Bacteria	1050	Open in IMG/M
3300025961\|Ga0207712_11907675	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	532	Open in IMG/M
3300025962\|Ga0210070_1045990	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300025981\|Ga0207640_10994537	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	737	Open in IMG/M
3300025986\|Ga0207658_10197173	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea tepidiphila	1678	Open in IMG/M
3300025986\|Ga0207658_12021202	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	524	Open in IMG/M
3300026023\|Ga0207677_10592650	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	972	Open in IMG/M
3300026095\|Ga0207676_12537717	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300026116\|Ga0207674_11148336	All Organisms → cellular organisms → Bacteria	746	Open in IMG/M
3300028381\|Ga0268264_12643662	All Organisms → cellular organisms → Bacteria	506	Open in IMG/M
3300028768\|Ga0307280_10001602	All Organisms → cellular organisms → Bacteria	5467	Open in IMG/M
3300028768\|Ga0307280_10006517	All Organisms → cellular organisms → Bacteria	3053	Open in IMG/M
3300031716\|Ga0310813_11061366	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	741	Open in IMG/M
3300031778\|Ga0318498_10096950	All Organisms → cellular organisms → Bacteria → Acidobacteria	1335	Open in IMG/M
3300031854\|Ga0310904_10383100	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	916	Open in IMG/M
3300031854\|Ga0310904_10459344	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	846	Open in IMG/M
3300031938\|Ga0308175_101376680	Not Available	787	Open in IMG/M
3300031939\|Ga0308174_10655540	All Organisms → cellular organisms → Bacteria	873	Open in IMG/M
3300032075\|Ga0310890_10602191	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	850	Open in IMG/M
3300032122\|Ga0310895_10644369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	547	Open in IMG/M
3300033412\|Ga0310810_11034390	All Organisms → cellular organisms → Bacteria	696	Open in IMG/M
3300033412\|Ga0310810_11215790	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium	608	Open in IMG/M
3300034643\|Ga0370545_156744	Not Available	527	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	63.77%
Host-Associated	Host-Associated	36.23%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	52.17%
Plants	Host-Associated → Plants	36.23%
Aquatic	Environmental → Aquatic	11.59%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	52.17%
Rhizoplane	Host-Associated → Plants → Rhizoplane	18.84%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.67%
Sediment	Environmental → Aquatic → Sediment	7.25%
Marine	Environmental → Aquatic → Marine	2.90%
Freshwater	Environmental → Aquatic → Freshwater	1.45%
Roots	Host-Associated → Plants → Roots	0.72%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	31.16%
Loam	Environmental → Terrestrial → Soil → Loam	20.29%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	12.32%
Soil	Host-Associated → Plants → Rhizosphere → Soil	8.70%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	7.25%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.97%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	6.52%
Wetlands	Environmental → Aquatic → Marine → Wetlands	2.90%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.45%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.72%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.72%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	20.29%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	17.39%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	12.32%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	8.70%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	7.25%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.97%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	6.52%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.35%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	4.35%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	2.90%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.45%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.45%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.45%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.45%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.72%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.72%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.72%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	16.67%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	7.25%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	6.52%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	5.80%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	5.07%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	4.35%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.62%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.62%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.62%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.62%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	2.90%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	2.90%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.90%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.17%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.17%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	2.17%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.17%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.17%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.45%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	1.45%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.45%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.45%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.45%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.45%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.45%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.72%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.72%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.72%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.72%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.72%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.72%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.72%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.72%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.72%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.72%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.72%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300004025	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1	Environmental	Open in IMG/M
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005205	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2	Environmental	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009609	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890	Environmental	Open in IMG/M
3300010320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011405	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2	Environmental	Open in IMG/M
3300011422	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2	Environmental	Open in IMG/M
3300011429	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012892	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1	Environmental	Open in IMG/M
3300012895	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2	Environmental	Open in IMG/M
3300012898	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1	Environmental	Open in IMG/M
3300012899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2	Environmental	Open in IMG/M
3300012909	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300014318	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015201	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019263	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300024055	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025954	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 (SPAdes)	Environmental	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025962	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028768	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031778	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24	Environmental	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300034643	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F14TC_1013236152	3300000559	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVEQRGRAEPSPADRD*
Ga0055433_101208281	3300004025	Natural And Restored Wetlands	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVRTGLIDEPTATDRD*
Ga0063455_1014823802	3300004153	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPIAESHVGDDSSSADRD*
Ga0063356_1000866743	3300004463	Arabidopsis Thaliana Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDSDETDRD*
Ga0062591_1021548742	3300004643	Soil	ETPAFVEINMSAEIGGYQSDFSDRDPRDPVVETEDNRSDRD*
Ga0068999_100953441	3300005205	Natural And Restored Wetlands	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQPDEASAATDRD*
Ga0070658_116142351	3300005327	Corn Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVEGSVGDGSPADRD*
Ga0070676_100568993	3300005328	Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVESDETDRD*
Ga0070683_1000015154	3300005329	Corn Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVEGDASPADRD*
Ga0070683_1000770733	3300005329	Corn Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVETEERATD*
Ga0070683_1012238031	3300005329	Corn Rhizosphere	AMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDGTVEQSPDRD*
Ga0070690_1000285055	3300005330	Switchgrass Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDSDETDSE*
Ga0068869_1000598083	3300005334	Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQQLVNGDETDSD*
Ga0068868_1002081522	3300005338	Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDGNVEPSTDRD*
Ga0070689_1000583535	3300005340	Switchgrass Rhizosphere	LAKGKPTMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQQLVNGDETDSD*
Ga0070689_1004030452	3300005340	Switchgrass Rhizosphere	PKLAKGKPTMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDSDETDSE*
Ga0070675_1004362932	3300005354	Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVETEDSRSDRD*
Ga0070675_1006866332	3300005354	Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVEDQPRASADSSDRR*
Ga0070688_1000259631	3300005365	Switchgrass Rhizosphere	TMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDSDETDSE*
Ga0070688_1005876251	3300005365	Switchgrass Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVETEDTRSDRD*
Ga0070701_103604572	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	AAMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQHRTDDQPATDRD*
Ga0070701_111169762	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	AFVEINMSAEIGGYQSDFSDRDPRDPVVQQLVNGDETDSD*
Ga0070705_1010080562	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQHRTDDQPATDRD*
Ga0070700_1004347922	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVETEDNRSDRD*
Ga0070681_100552126	3300005458	Corn Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVETDERATD*
Ga0070685_100908182	3300005466	Switchgrass Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVENDGDAQPSDR*
Ga0070684_1003646182	3300005535	Corn Rhizosphere	MKWETPAFTEINMSAEIGGYQSDFSDRDPRDPVVETEERPADRD*
Ga0070684_1009703172	3300005535	Corn Rhizosphere	MQWETPSFIEINMSAEIGGYQSDFSDRDPRDPVVQADDSATDRD*
Ga0070684_1018690782	3300005535	Corn Rhizosphere	AMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDSDETDSE*
Ga0068853_1002573403	3300005539	Corn Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVENDGDAQSSDR*
Ga0070693_1011077872	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDGDDHSSADRD*
Ga0070665_1009382152	3300005548	Switchgrass Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVESKTDDRSSDRD*
Ga0068856_1020598692	3300005614	Corn Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPIVESNVGDGSSSADRD*
Ga0068864_1012916322	3300005618	Switchgrass Rhizosphere	MQWETPSFIEINMSAEIGGYQSDFSDRDPRDPVVQTDADERPAAASTDRR*
Ga0066903_1000003568	3300005764	Tropical Forest Soil	MKWETPTFVEINMSAEIGGYQSDFSDRDPRDPVVETEERASDRD*
Ga0066903_1010497792	3300005764	Tropical Forest Soil	MKWETPAFVEINMSAEIGGYQSDSSDRDPRDPVVETEERANDRD*
Ga0074470_105576342	3300005836	Sediment (Intertidal)	LAKGKAAMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQGRVGDSASSADRD*
Ga0074470_117112172	3300005836	Sediment (Intertidal)	MTWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDGDDHSSADRD*
Ga0068863_1001224333	3300005841	Switchgrass Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVEQRGAEPSTAADRD*
Ga0097621_1021179201	3300006237	Miscanthus Rhizosphere	MQWETPSFIEINMSAEIGGYQSDFSDRDPRDPVVQADDGATDRD*
Ga0075434_1014889831	3300006871	Populus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVEGDKPSPASDRD*
Ga0068865_1005329961	3300006881	Miscanthus Rhizosphere	AMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVEGSVGDGSPTDRD*
Ga0066710_1014721311	3300009012	Grasslands Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVEGDDRTPADRD
Ga0066709_1019467392	3300009137	Grasslands Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVESHVGDGSSSADRD*
Ga0111538_140822231	3300009156	Populus Rhizosphere	PKFAKGQAAMKWETPAFVEINMSAEIGGDQSDFSERDPRDPVVQDDQPATDRD*
Ga0105248_124917352	3300009177	Switchgrass Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQHRTDDQPAPDRD*
Ga0105238_112075511	3300009551	Corn Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVETEERTTDRD*
Ga0105347_11817032	3300009609	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVAQDEPSKTDRD*
Ga0134109_102232191	3300010320	Grasslands Soil	MKWETPTFVEINMSAEIGGYQSDFSDRDPRDPVVETDERANDRD*
Ga0126377_130062581	3300010362	Tropical Forest Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVIETEAPAVDRD*
Ga0134127_133849161	3300010399	Terrestrial Soil	MKWETPTFVEINMSAEIGGYQSDFSDRDPRDPVVEDQPRASADSSDRR*
Ga0134123_110644261	3300010403	Terrestrial Soil	TFVEINMSAEIGGYQSDFSDRDPRDPVVEDQPRASADSSDRR*
Ga0137340_10195302	3300011405	Soil	MKWETSAFVEINMSAEIGGYQSDFSDRDPRDPVVETEDSRSDRD*
Ga0137425_10733452	3300011422	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVAQDEPSQTDRD*
Ga0137455_11352002	3300011429	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQDDSSATDRE*
Ga0150985_1039963192	3300012212	Avena Fatua Rhizosphere	WETPAFVEINMSAEIGGYQSDFGDRDPRDPVVNAVEDKSTDATDRS*
Ga0137367_102288772	3300012353	Vadose Zone Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPIVESHVGDGSSSADRD*
Ga0157294_101049532	3300012892	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVAEQGDDVESSDRR*
Ga0157309_100318052	3300012895	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDGNVEHRPSTDRD*
Ga0157293_101876892	3300012898	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDSDETDSE
Ga0157299_101029722	3300012899	Soil	MKWEPPAFVEINMSAEIGGYQSDFSDRDPRDPVVQQLVNGDETDSD*
Ga0157290_102242541	3300012909	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVESDSDTKSSDR*
Ga0164299_107605922	3300012958	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDGNVEPSPDRD*
Ga0164302_105874602	3300012961	Soil	AKGQAAMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDGDDHSSADRD*
Ga0164309_110425342	3300012984	Soil	MKWETPAFVEFNMSAEIGGYQSDFSDRDPRDPVVETEERTTDRD*
Ga0164304_108499042	3300012986	Soil	MKWETPAFVEINMSAEIGGYQSDLSDRDPRDPVVDGNVEPSPDRD*
Ga0164307_104898802	3300012987	Soil	MKWETPAFVEINMSAEIGGYQIDFSDRDPRDPVVDGNVEPSPDRD*
Ga0164305_108005832	3300012989	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVETEERATDRD*
Ga0075351_10113272	3300014318	Natural And Restored Wetlands	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQSDETETD*
Ga0157377_103191822	3300014745	Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVETEDCRSDRD*
Ga0157376_111266181	3300014969	Miscanthus Rhizosphere	MQWETPTFIEINMSAEIGGYQSDFSDRDPRDPVVQQRRSDDESAATDRA*
Ga0157376_129682131	3300014969	Miscanthus Rhizosphere	PAFVEINMSAEIGGYQSDFSDRDPRDPVVDGNVEPSPDRD*
Ga0173478_102381512	3300015201	Soil	MQNRHPKLAKGKPAMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDSDETDRD*
Ga0132258_1002185311	3300015371	Arabidopsis Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDSQAEQRPAASTDRR*
Ga0132258_112903372	3300015371	Arabidopsis Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQSDETETE*
Ga0132258_119526912	3300015371	Arabidopsis Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVENDGDAAKSDR*
Ga0132256_1020292211	3300015372	Arabidopsis Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVENDGDTQSSDR*
Ga0132255_1003382685	3300015374	Arabidopsis Rhizosphere	VEINMSAEIGGYQSDFSDRDPRDPVVESDETDRD*
Ga0132255_1020936001	3300015374	Arabidopsis Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQSDDESAATDRA
Ga0132255_1026486452	3300015374	Arabidopsis Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVENDSDTKSSDR*
Ga0132255_1045599042	3300015374	Arabidopsis Rhizosphere	WETPAFVEINMSAEIGGYQSDFSDRDPRDPVVESDGDAAKSDR*
Ga0132255_1058037251	3300015374	Arabidopsis Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVETEDNRSDRY*
Ga0184624_101361542	3300018073	Groundwater Sediment	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPIVEADDRASSADRD
Ga0184624_102487982	3300018073	Groundwater Sediment	MKWETPAFVEINMSAEIGGYQSDSPDRDPRDPVVEADYAIARAPARD
Ga0184629_104998482	3300018084	Groundwater Sediment	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQHLADEPSKTDRD
Ga0190270_105133471	3300018469	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQHRTDEPSTTDRD
Ga0190274_108164872	3300018476	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVAEQGDDVESSDRR
Ga0190271_104197092	3300018481	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQHLTDELPATDRD
Ga0066669_106024642	3300018482	Grasslands Soil	MKWETPTFVEINMSAEIGGYQSDFSDRDPRDPVVETDERANDRD
Ga0184647_12596141	3300019263	Groundwater Sediment	GQAAMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQHLADEPSATDRD
Ga0173482_106455321	3300019361	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDGNVEHRPSTDRD
Ga0173479_103625831	3300019362	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQQLVNGDETDSD
Ga0210380_102533752	3300021082	Groundwater Sediment	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQHLADEPSATDRD
Ga0222622_100788474	3300022756	Groundwater Sediment	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVAEQQGDDADSSDRR
Ga0247794_100305133	3300024055	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDGNV
Ga0207697_100873013	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	ETPAFVEINMSAEIGGYQSDFSDRDPRDPVVEGSVGDGSPTDRD
Ga0207697_101680332	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVESDETDRD
Ga0207682_105612822	3300025893	Miscanthus Rhizosphere	KGKAAMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVESDETDRD
Ga0207647_105772351	3300025904	Corn Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVEGSVGDGSPADRD
Ga0207662_100024796	3300025918	Switchgrass Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVEQRGAEPSTAADRD
Ga0207662_110469382	3300025918	Switchgrass Rhizosphere	WETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQHRTDDQPATDRD
Ga0207659_112068442	3300025926	Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVETEDSRSDRD
Ga0207701_100860655	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	KGKAAMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVEGSVGDGSPADRD
Ga0207701_102035152	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVENDGDAQPSDR
Ga0207701_112312912	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVETEDTRSDRD
Ga0207670_108608471	3300025936	Switchgrass Rhizosphere	LAKGKPTMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQQLVNGDETDSD
Ga0207670_112749462	3300025936	Switchgrass Rhizosphere	PKLAKGKPTMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDSDETDSE
Ga0207669_115442961	3300025937	Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQQLVNGDETDS
Ga0207704_102970251	3300025938	Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVEGSVGDGSPTDRD
Ga0207691_115620982	3300025940	Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQHRTDDQPATDRD
Ga0207711_108394252	3300025941	Switchgrass Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQHRADDQPAPDRD
Ga0207711_110234761	3300025941	Switchgrass Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVENDGAAAKSDR
Ga0207661_101970763	3300025944	Corn Rhizosphere	GQAAMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDGTVEQSPDRD
Ga0207661_109509022	3300025944	Corn Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVETEERATD
Ga0210135_10076752	3300025954	Natural And Restored Wetlands	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQSDETETD
Ga0207712_104889551	3300025961	Switchgrass Rhizosphere	PPKLAKGKAAMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVESDETDRD
Ga0207712_119076752	3300025961	Switchgrass Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVESDET
Ga0210070_10459902	3300025962	Natural And Restored Wetlands	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVQPDEASAATDRD
Ga0207640_109945372	3300025981	Corn Rhizosphere	ETPAFVEINMSAEIGGYQSDFSDRDPRDPVVESDETDRD
Ga0207658_101971731	3300025986	Switchgrass Rhizosphere	KWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDGNVEPSTDRD
Ga0207658_120212021	3300025986	Switchgrass Rhizosphere	ETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDGDDHSSADRD
Ga0207677_105926501	3300026023	Miscanthus Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDGNVEPSTDRD
Ga0207676_125377171	3300026095	Switchgrass Rhizosphere	MQWETPSFIEINMSAEIGGYQSDFSDRDPRDPVVQADDGAT
Ga0207674_111483362	3300026116	Corn Rhizosphere	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDSDETDRD
Ga0268264_126436622	3300028381	Switchgrass Rhizosphere	KLAKGKPTMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDSDETDSE
Ga0307280_100016021	3300028768	Soil	MQWETPAFVEINMSAEIGGYQSDSPDRDPRDPVVEADDPTRSGTSRQGRC
Ga0307280_100065172	3300028768	Soil	MKWEPPAFVEINMSAEIGGYQSDFSDRDPRDPIVQGDDHSSSADRD
Ga0310813_110613661	3300031716	Soil	PAFVEINMSAEIGGYQSDFSDRDPRDPVVDGTVEQSPDRD
Ga0318498_100969502	3300031778	Soil	MSPNLTKGSAMKWETPAFVEINMSAEIGGYQSDFSDRDPWGPVAPR
Ga0310904_103831002	3300031854	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVETEDNRSDRD
Ga0310904_104593441	3300031854	Soil	RGQNRPPKLAKGKPTMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVESDETDRD
Ga0308175_1013766801	3300031938	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDTEERANDRD
Ga0308174_106555402	3300031939	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVETEQRPNDRE
Ga0310890_106021912	3300032075	Soil	KLAKGQAAMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVESDETDRD
Ga0310895_106443691	3300032122	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVESDETDR
Ga0310810_110343902	3300033412	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVEGDKPSPASDRD
Ga0310810_112157902	3300033412	Soil	KLAKGQAAMKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVDGTVEQSPDRD
Ga0370545_156744_381_515	3300034643	Soil	MKWETPAFVEINMSAEIGGYQSDFSDRDPRDPVVKDESTATDRD

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F055795

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences