NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055736

Metagenome / Metatranscriptome Family F055736

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055736
Family Type Metagenome / Metatranscriptome
Number of Sequences 138
Average Sequence Length 68 residues
Representative Sequence MSKPKEGWVGQYAAFNEALKYMYARQNGEEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLI
Number of Associated Samples 122
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 18.84 %
% of genes near scaffold ends (potentially truncated) 98.55 %
% of genes from short scaffolds (< 2000 bps) 86.96 %
Associated GOLD sequencing projects 116
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.406 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(24.638 % of family members)
Environment Ontology (ENVO) Unclassified
(59.420 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(66.667 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.68%    β-sheet: 0.00%    Coil/Unstructured: 66.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF08299Bac_DnaA_C 13.04
PF03167UDG 11.59
PF13730HTH_36 1.45
PF03819MazG 1.45
PF00118Cpn60_TCP1 0.72
PF03796DnaB_C 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 13.04
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 11.59
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 11.59
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 11.59
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 0.72
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.72
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2100351011|ASMM170b_contig09063__length_531___numreads_5All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium531Open in IMG/M
3300001460|JGI24003J15210_10043498All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1539Open in IMG/M
3300001720|JGI24513J20088_1021927All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium687Open in IMG/M
3300002136|M2t6FKB1_1108823All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage755Open in IMG/M
3300002136|M2t6FKB1_1312189All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium565Open in IMG/M
3300003620|JGI26273J51734_10134534All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium658Open in IMG/M
3300004457|Ga0066224_1090500All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium738Open in IMG/M
3300005920|Ga0070725_10499683All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium547Open in IMG/M
3300006467|Ga0099972_13244984All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium659Open in IMG/M
3300006484|Ga0070744_10002470All Organisms → cellular organisms → Bacteria5573Open in IMG/M
3300006734|Ga0098073_1040215All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium639Open in IMG/M
3300006737|Ga0098037_1002232All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium8591Open in IMG/M
3300006737|Ga0098037_1179874All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium699Open in IMG/M
3300006749|Ga0098042_1092368All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium773Open in IMG/M
3300006754|Ga0098044_1287037All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium632Open in IMG/M
3300006789|Ga0098054_1326844All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium546Open in IMG/M
3300006790|Ga0098074_1027265All Organisms → cellular organisms → Bacteria1684Open in IMG/M
3300006802|Ga0070749_10026021All Organisms → cellular organisms → Bacteria3678Open in IMG/M
3300006810|Ga0070754_10255556All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium799Open in IMG/M
3300006921|Ga0098060_1080170All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium937Open in IMG/M
3300006928|Ga0098041_1194484All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium650Open in IMG/M
3300007276|Ga0070747_1057325All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1483Open in IMG/M
3300007344|Ga0070745_1312398All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium558Open in IMG/M
3300008113|Ga0114346_1012135All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium4861Open in IMG/M
3300008999|Ga0102816_1129619All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium777Open in IMG/M
3300009001|Ga0102963_1099317All Organisms → Viruses → Predicted Viral1187Open in IMG/M
3300009026|Ga0102829_1031217All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1555Open in IMG/M
3300009026|Ga0102829_1103484All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium890Open in IMG/M
3300009103|Ga0117901_1308837All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium722Open in IMG/M
3300009135|Ga0118736_10274465All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium553Open in IMG/M
3300009149|Ga0114918_10209579All Organisms → Viruses → Predicted Viral1128Open in IMG/M
3300009420|Ga0114994_10279588All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1114Open in IMG/M
3300009432|Ga0115005_11577987All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium538Open in IMG/M
3300009440|Ga0115561_1351635All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium541Open in IMG/M
3300009441|Ga0115007_10513822All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium792Open in IMG/M
3300009512|Ga0115003_10157282All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1378Open in IMG/M
3300009703|Ga0114933_10915269All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium557Open in IMG/M
3300009705|Ga0115000_10113433All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1819Open in IMG/M
3300009705|Ga0115000_10142465All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1599Open in IMG/M
3300009785|Ga0115001_10023998All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium4058Open in IMG/M
3300009785|Ga0115001_10310236All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium999Open in IMG/M
3300009786|Ga0114999_10531357All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium903Open in IMG/M
3300010148|Ga0098043_1129852All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium722Open in IMG/M
3300010148|Ga0098043_1189676All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium572Open in IMG/M
3300010155|Ga0098047_10009318All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium3997Open in IMG/M
3300010297|Ga0129345_1290280All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium567Open in IMG/M
3300010883|Ga0133547_10578144All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium2252Open in IMG/M
3300011013|Ga0114934_10377140All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium633Open in IMG/M
3300011261|Ga0151661_1155952All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium709Open in IMG/M
3300011268|Ga0151620_1032444All Organisms → Viruses → Predicted Viral1774Open in IMG/M
3300012730|Ga0157602_1138658All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium534Open in IMG/M
3300012920|Ga0160423_10742743All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium661Open in IMG/M
3300012920|Ga0160423_10793778All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium637Open in IMG/M
3300012953|Ga0163179_11259403All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium656Open in IMG/M
3300012953|Ga0163179_11364695All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium633Open in IMG/M
3300013098|Ga0164320_10470870All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium635Open in IMG/M
3300014903|Ga0164321_10019042All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium2259Open in IMG/M
3300017706|Ga0181377_1017332All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1613Open in IMG/M
3300017709|Ga0181387_1029010All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1083Open in IMG/M
3300017713|Ga0181391_1129720All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium563Open in IMG/M
3300017717|Ga0181404_1025501All Organisms → Viruses → Predicted Viral1520Open in IMG/M
3300017719|Ga0181390_1176062All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium525Open in IMG/M
3300017724|Ga0181388_1048560All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1027Open in IMG/M
3300017748|Ga0181393_1094712All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium773Open in IMG/M
3300017763|Ga0181410_1002795All Organisms → cellular organisms → Bacteria6969Open in IMG/M
3300017763|Ga0181410_1149684All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium656Open in IMG/M
3300017768|Ga0187220_1152367All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium698Open in IMG/M
3300017776|Ga0181394_1175742All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium659Open in IMG/M
3300017777|Ga0181357_1318465All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium524Open in IMG/M
3300017780|Ga0181346_1080811All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1281Open in IMG/M
3300017780|Ga0181346_1303731All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium541Open in IMG/M
3300017782|Ga0181380_1191733All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium687Open in IMG/M
3300017783|Ga0181379_1214933All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium671Open in IMG/M
3300017785|Ga0181355_1335882All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium559Open in IMG/M
3300017786|Ga0181424_10251495All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium740Open in IMG/M
3300017786|Ga0181424_10394409All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium564Open in IMG/M
3300017967|Ga0181590_10205774All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1475Open in IMG/M
3300019784|Ga0181359_1117518All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium955Open in IMG/M
3300020200|Ga0194121_10197478All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1096Open in IMG/M
3300020347|Ga0211504_1006948All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium3704Open in IMG/M
3300020414|Ga0211523_10416317All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium542Open in IMG/M
3300020420|Ga0211580_10313954All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium643Open in IMG/M
3300020421|Ga0211653_10396310All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium594Open in IMG/M
3300020430|Ga0211622_10270113All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium728Open in IMG/M
3300020451|Ga0211473_10039623All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium2351Open in IMG/M
3300021352|Ga0206680_10110465All Organisms → Viruses → Predicted Viral1062Open in IMG/M
3300021356|Ga0213858_10457177All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium594Open in IMG/M
3300021379|Ga0213864_10002326All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium8373Open in IMG/M
3300021957|Ga0222717_10113918All Organisms → Viruses → Predicted Viral1680Open in IMG/M
3300021959|Ga0222716_10058191All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium2718Open in IMG/M
3300021960|Ga0222715_10415812All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium732Open in IMG/M
3300022067|Ga0196895_1026573All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium655Open in IMG/M
3300022176|Ga0212031_1003957All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1775Open in IMG/M
3300022190|Ga0181354_1098287All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium955Open in IMG/M
(restricted) 3300022938|Ga0233409_10356411All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium515Open in IMG/M
(restricted) 3300023089|Ga0233408_10164019All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium520Open in IMG/M
(restricted) 3300023112|Ga0233411_10002430All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium5291Open in IMG/M
3300023119|Ga0255762_10110007All Organisms → Viruses → Predicted Viral1636Open in IMG/M
3300023698|Ga0228682_1056828All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium529Open in IMG/M
3300024293|Ga0228651_1038663All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1164Open in IMG/M
3300024296|Ga0228629_1022088All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1705Open in IMG/M
3300024306|Ga0255148_1071629All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium598Open in IMG/M
3300024348|Ga0244776_10896114All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium526Open in IMG/M
(restricted) 3300024528|Ga0255045_10184773All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium807Open in IMG/M
3300025057|Ga0208018_107617All Organisms → Viruses → Predicted Viral1631Open in IMG/M
3300025086|Ga0208157_1146299All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium524Open in IMG/M
3300025093|Ga0208794_1082407All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium552Open in IMG/M
3300025093|Ga0208794_1083986All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium545Open in IMG/M
3300025110|Ga0208158_1118711All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium614Open in IMG/M
3300025120|Ga0209535_1120774All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium891Open in IMG/M
3300025151|Ga0209645_1050344All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1462Open in IMG/M
3300025168|Ga0209337_1332616All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium530Open in IMG/M
3300025276|Ga0208814_1157929All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium502Open in IMG/M
3300025483|Ga0209557_1107955All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium561Open in IMG/M
3300025879|Ga0209555_10393624All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium508Open in IMG/M
3300025892|Ga0209630_10164152All Organisms → Viruses → Predicted Viral1114Open in IMG/M
3300027770|Ga0209086_10150752All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1124Open in IMG/M
3300027788|Ga0209711_10369582All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium597Open in IMG/M
(restricted) 3300027861|Ga0233415_10074999All Organisms → Viruses → Predicted Viral1454Open in IMG/M
(restricted) 3300027996|Ga0233413_10014183All Organisms → cellular organisms → Bacteria2963Open in IMG/M
(restricted) 3300027996|Ga0233413_10049366All Organisms → Viruses → Predicted Viral1623Open in IMG/M
(restricted) 3300027996|Ga0233413_10504790All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium536Open in IMG/M
3300028022|Ga0256382_1094289All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium717Open in IMG/M
3300031141|Ga0308021_10152020All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium909Open in IMG/M
3300031539|Ga0307380_10252090All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1667Open in IMG/M
3300031566|Ga0307378_10014697All Organisms → cellular organisms → Bacteria9819Open in IMG/M
3300031608|Ga0307999_1165540All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium511Open in IMG/M
3300031673|Ga0307377_10045871All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium3749Open in IMG/M
3300031757|Ga0315328_10204784All Organisms → Viruses → Predicted Viral1154Open in IMG/M
3300031774|Ga0315331_10210428All Organisms → Viruses → Predicted Viral1444Open in IMG/M
3300031774|Ga0315331_10240707All Organisms → Viruses → Predicted Viral1340Open in IMG/M
3300031851|Ga0315320_10419065All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium923Open in IMG/M
3300032088|Ga0315321_10239232All Organisms → Viruses → Predicted Viral1178Open in IMG/M
3300032257|Ga0316205_10084181All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1380Open in IMG/M
3300032274|Ga0316203_1013869All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium2430Open in IMG/M
3300033742|Ga0314858_037005All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1149Open in IMG/M
3300033742|Ga0314858_080454All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium816Open in IMG/M
3300034093|Ga0335012_0484427All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium590Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine24.64%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater10.87%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater5.07%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake4.35%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.35%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater4.35%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine4.35%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.62%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.90%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.17%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.17%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil2.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.45%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.45%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.45%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.45%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine1.45%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.45%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.45%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment1.45%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface1.45%
MarineEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine1.45%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.72%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.72%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.72%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.72%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.72%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.72%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.72%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.72%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.72%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.72%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.72%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.72%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.72%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.72%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.72%
Coastal Water And SedimentEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment0.72%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.72%
Marine SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment0.72%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2100351011Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from medium methane PC12-240-170cmEnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001720Marine viral communities from the Pacific Ocean - LP-36EnvironmentalOpen in IMG/M
3300002136M2t6FKB1 (104f)EnvironmentalOpen in IMG/M
3300003620Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNAEnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300005920Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2EnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009103Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7umEnvironmentalOpen in IMG/M
3300009135Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsfEnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009703Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaGEnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300011261Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02EnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012730Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013098Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cmEnvironmentalOpen in IMG/M
3300014903Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cmEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020200Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50mEnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020414Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028)EnvironmentalOpen in IMG/M
3300020420Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300020430Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160)EnvironmentalOpen in IMG/M
3300020451Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)EnvironmentalOpen in IMG/M
3300021352Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022067Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3)EnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022938 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MGEnvironmentalOpen in IMG/M
3300023089 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MGEnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300023119Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaGEnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024293Seawater microbial communities from Monterey Bay, California, United States - 63DEnvironmentalOpen in IMG/M
3300024296Seawater microbial communities from Monterey Bay, California, United States - 36DEnvironmentalOpen in IMG/M
3300024306Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8hEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024528 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23EnvironmentalOpen in IMG/M
3300025057Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025093Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025483Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300027770Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028022Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750mEnvironmentalOpen in IMG/M
3300031141Marine microbial communities from water near the shore, Antarctic Ocean - #351EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031608Marine microbial communities from water near the shore, Antarctic Ocean - #1EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031757Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032257Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyriteEnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ASMM170b_062115002100351011Coastal Water And SedimentMSKPKEAWVGQYAAFNEALKYMHARQNGQEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKH
JGI24003J15210_1004349853300001460MarineMSKTDKSWVGQHAAFSEALKYMNARQKGEEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGK
JGI24513J20088_102192733300001720MarineMSKPKESWVGQYAAFNEALKYMFRRSTGEEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLIKDQIIRESFA
M2t6FKB1_110882333300002136MarineMSKPTEAWVGQYAAFNEALKYMRGRQNGTEKSIYTPWPKFNDAATDGLEWNTLTVI
M2t6FKB1_131218933300002136MarineMSKPTEAWVGQYAAFNEALKYMRGRQNGTEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLIKDQ
JGI26273J51734_1013453433300003620MarineMSKPTEGWVGQYAAFNDALKYMYKRANGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKD
Ga0066224_109050013300004457MarineMGKTNKSWVGQHAAFTEALKYMNARQKGEEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTL
Ga0070725_1049968323300005920Marine SedimentMSKTKESWVGQYTAFNEALKYMFRRSTGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQIIRESFMLN
Ga0099972_1324498423300006467MarineMSKPTSAWVGQYTAFNDALKYMYARSTGEEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLIKD
Ga0070744_10002470153300006484EstuarineMSKPTESWIGQYAAFNEALKYMYKRQTGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGK
Ga0098073_104021513300006734MarineMAKLATKAWDGQYKAFNEALKYMLDRQSGKEKSIYTPWAKFNDAVTDGLEWNTLTVIGGRPGSGKTLIKD
Ga0098037_1002232203300006737MarineMSKIKPAWDGQYQSFNEALKYMLARQSGQEKSIQTPWPKFNDAITEGLEWNTLTVIGGRPGSGKTLI
Ga0098037_117987423300006737MarineMTKIKPAWDGQYQSFNEALKYMLARQSGQEKSIQTPWPKFNDAITEGLEWNTLTVIGGRPGSGKTLI
Ga0098042_109236813300006749MarineMSKITPAWDGQYQSFNEALKYMLARQSGQEKSIQTPWPKFNDAITEGLEWNTLTVIGGRPGSGKTLIKDQ
Ga0098044_128703713300006754MarineMSKIKPAWDGQYQAFNEALKYMLARQSGKEKSIQTPWPKFNDAITDGLEWNTLTVIGGRPGS
Ga0098054_132684423300006789MarineMSNEQAWAGQYSSFNEALKYMLDRQTGKEKSIQTPWPKFNDAVTDELEWNTLTVIG
Ga0098074_102726533300006790MarineMKNKTWFPQNNSFKEALIYMKNRMEGTEKSIYTPWHKFNDAATDGLEWNTLTIIGGRPGSGKTLIKDQIIRESFVLNP
Ga0070749_1002602113300006802AqueousMSLSEKLWGGQHAAFNEALKYMKNRQAGLEKSIYTPWPKFNDATVDGLEWNSLTVIAARPGSGKTLIKDQIVRES
Ga0070754_1025555633300006810AqueousMQRKHEWQSQHVDYNEALKYMKRRQEGTEKSIYTPWPKFNDAALDGLEWNTTTIIGGRPGAGKTLIKDQII
Ga0098060_108017033300006921MarineMKAWNGQYEAFNEALKYMLDRQSGKEKSIQTPWPKFNDAITDGLEWNTLTVIGGRPGSGK
Ga0098041_119448413300006928MarineMSNIKPAWGGQYAAFNEALKYMLKRKNGQEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKD
Ga0070747_105732553300007276AqueousMSKAWNGQYQSFNEALKYMLDRQSGKEKSIQTPWPKFNDAVTDGLEWNTLTVIGGRP
Ga0070745_131239813300007344AqueousMQIKHEWQSQHVDFNEALKYMKRRQEGTEKSIYTPWPKFNDAGTDGIEWNTTTIIGGR
Ga0114346_1012135113300008113Freshwater, PlanktonMSKPEKAWNGQYASFNEALKYMQKRAAGQEKSIYTPWPKFNDATTDGLEWNTLTVIGGRP
Ga0102816_112961923300008999EstuarineMSKPTESWIGQYAAFNEALKYMYKRQTGEEKSIYTPLPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKD
Ga0102963_109931713300009001Pond WaterMSKSEEGWVGQYAAFNDALKYMVKRANGEEKSIYTPWPKFNDACTDGLEWNTLTVI
Ga0102829_103121713300009026EstuarineMSKPTESWIGQYAAFNEALKYMYKRQTGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQIVRESFALN
Ga0102829_110348423300009026EstuarineMSKPTESWIGQYAAFNEALKYMYKRQTGEEKSIYTPWPKFNDATTDGLEWNTLTVIG
Ga0117901_130883723300009103MarineMSNKAWNGQYQSFNEALKYMLDRQSGKEKSIYTPWPKFNDAVTDGLEWNTLTVIGGRPGSGKTLIKDQIIRES
Ga0118736_1027446523300009135Marine SedimentMKEQWESQHADFNEALKYMRRRQQGIEKSIFTPWPKFNDAGTDGLEWNTLTIIGGRP
Ga0114918_1020957963300009149Deep SubsurfaceMSKPTEAWVGQYAAFNEALKYMRGRQNGTEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLIK
Ga0114994_1027958813300009420MarineMSNNEWGGQYTAFNEALRYMLDRQSGKEKSIQTPWPKFNDAITDGLEWNTLTVIGGR
Ga0115005_1157798733300009432MarineMSKTDKSWVGQHAAFSEALKYMSARSKGEEKSIYTPWPKFNDAATDGLEWNTLTVIGGRP
Ga0115561_135163523300009440Pelagic MarineMSKPTSAWVGQYTAFNDALKYMYARSTGEEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLIKDQIIR
Ga0115007_1051382243300009441MarineMSKPTPAWVGQYTAFNDALKYMYARSTGAEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLIKDQIIR
Ga0115003_1015728243300009512MarineMSKPTSAWVGQYTAFNDALKYMYARSTGEEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLIKDQIIRESFAL
Ga0114933_1091526923300009703Deep SubsurfaceMSKIKPAWDGQYQAFNEALKYMLARQSGKEKSIQTPWPKFNDAITDGLEWNTLTVIGGRPGSGKTLIK
Ga0115000_1011343343300009705MarineMSQIKQEWDGQYQAFNEALKYMLARQSGKEKSIQTPWPKFNDAITDGLEWNTLTVIGG
Ga0115000_1014246543300009705MarineMKAWKGQYTAFNEALKYMLDRQSGKEKSIQTPWPKFNDAITDGLEWNTLTVIGGRPGSGKTLIKDQIIRESFIHNPS
Ga0115001_1002399813300009785MarineMGKTDKSWVGQHAAFSEALKYMSARSKGEEKSIYTPWPKFNDAATDGLEWNTLTVIGGRP
Ga0115001_1031023613300009785MarineMSNEKPWNGQYTAFNEALKYMLDRQSGKEKSIQTPWPKSNDAVTDGLEWNTLTVIGGRPGSGKTLIKDQIIRESFV
Ga0114999_1053135733300009786MarineMSKPTGSWVGQYAAFNEALKYMYARQKGEEKSIYTPWPKFNDAATDGIEWNTLTVIGGRPGSGKTLIKDQ
Ga0098043_112985223300010148MarineMSNKAWNGQYQSFNEALKYMLDRQSGKEKSIYTPWPKFNDAVTDGLEWNTLTVIGGRPGSGKTLIKD
Ga0098043_118967613300010148MarineMSKITPAWDGQYQSFNEALKYMLARQSGQEKSIQTPWPKFNDAITDGLEWNTLTVI
Ga0098047_1000931813300010155MarineMNKLKPQWGGQYQNFNDALKYMLDRQNGDEKSIFTPWPKFNDAGTDGLEWNTLTVIGGRPGSGKTLIKDQIVREAFVL
Ga0129345_129028013300010297Freshwater To Marine Saline GradientMSLPDKLWSGQHSAFNEALKYMKNRQAGLEKSIYTPWPKFNDATVDGLEWNSLTVIAARPGSGKT
Ga0133547_1057814463300010883MarineMSNNEWGGQYTAFNEALRYMLDRQSGKEKSIQTPWPKFNDAITDGLEWNTLTVIGGRPGSGKTLIK
Ga0114934_1037714013300011013Deep SubsurfaceMSKIKPAWDGQYQAFNEALKYMLARQSGKEKSIQTPWPKFNDAITDGLEWNTLTVIGGRPGSGKT
Ga0151661_115595233300011261MarineMKKTSEAWVGQYAAFNEALKYMYRRSTGEEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLIKDQIIRESFALNTKDSI*
Ga0151620_103244433300011268FreshwaterMSKPEKAWNGQYASFNEALKYMQKRSAGLEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQDYQGIIFIESK*
Ga0157602_113865823300012730FreshwaterMSEKLWDGQHASFNEALKYIKNRQAGNDKSIHTPWPKFNDATVDGLEWNSLTVIAARP
Ga0160423_1074274313300012920Surface SeawaterMSQIKQEWDGQYHAFNEALKYMLARQNGTEKSIQTPWPKFNDAVTDGLEWNTLTVIGGRPGSGKTLIKDQIV
Ga0160423_1079377823300012920Surface SeawaterMKKAWDGQHKAFGEALKYMLDRSTGKEKSIYTPWPKFNDAVTDGLEWNTLTVIGGRPGSGKTLI
Ga0163179_1125940313300012953SeawaterMSKIKPAWDGQYQSFNEALKYMLARQSGKEKSIQTPWPKFNDAITDGLEWNTLTVIGGRPGSGKTLIKDQIVRESF
Ga0163179_1136469523300012953SeawaterMTKIKPAWDGQYQSFNEALKYMLARQSGQEKSIQTPWPKFNDAITDGLEWNTLTVIGGRPGSGKTLIKDQIVRESF
Ga0164320_1047087023300013098Marine SedimentMKKTTDAWIGQYAAFNEALKYMYKRSTGEEKSKYTPWPTFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQIIRESFLLNPNDT
Ga0164321_1001904213300014903Marine SedimentMKKKPSWVGQYAAFNEALNYMYARSTGEEKSIYTPWPKFNDACTDGLEWNTLTVIGGRPGSGKTLSKDQIIRESFI
Ga0181377_101733213300017706MarineMSKVKEEWIGQYSAFNEALKYMSKRANGEEKSIYTPWAKFNDATTDGLEWNTLTVMGGRP
Ga0181387_102901013300017709SeawaterMSTVKPAWDGQYQAFNDALKYMLARQSGEEKSIQTPWPKFNDAITDGLEWNTLTVIGGRPGSGKTLIKDQIIS
Ga0181391_112972013300017713SeawaterMSTVKPAWDGQYQAFNDALKYMLARQSGEEKSIQTPWPKFNDAITDGLEWNTLTVIGGRPGSGKTLIKDQIIR
Ga0181404_102550143300017717SeawaterMKKTSEAWVGQYAAFNEALKYMYARSTGDEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGK
Ga0181390_117606213300017719SeawaterMSKNKLWNGQYTAFNEALKYMLDRQSGKEKSIQTPWPKFNDAVTDGLEWNTLTVIGGRPGSGKTLIKDQIIRESFV
Ga0181388_104856013300017724SeawaterMSKTKESWVGQYTAFNEALKYMFRRSTGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQIIRESFMFS
Ga0181393_109471213300017748SeawaterMSQIKQEWDGQYHAFNEALKYMLARQSGTEKSIQTPWPKFNDAITDGLEWNTLTVIGGRPGSGKTLIPLP
Ga0181410_100279513300017763SeawaterMKKTSEAWVGQYAAFNEALKYMYARSTGDEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKT
Ga0181410_114968433300017763SeawaterMSKIVKAWDGQYTAFNEALKYMHNRQQGKEKSVLTPWPKFNDAATDGLEWNTLTVIGGRPGSG
Ga0187220_115236713300017768SeawaterMSQIKQEWDGQYHAFNEALKYMLARQSGTEKSIQTPWPKFNDAITDGLEWNTLTVIGGRPGS
Ga0181394_117574233300017776SeawaterMSKAQKAWAGQYQAFNEALKYMNNRMHGEERSILTPWSKFNDAGTDGIEWNTLTVIGGRPGSGKTLIKD
Ga0181357_131846533300017777Freshwater LakeMSKPTESWIGQYAAFNEALKYMYKRQTGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTL
Ga0181346_108081113300017780Freshwater LakeMSKPTESWIGQYAAFNDALKYMYKRQTGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKT
Ga0181346_130373133300017780Freshwater LakeMSKPTESWIGQYAAFNEALKYMYKRQTGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKT
Ga0181380_119173313300017782SeawaterMSKVKPAWDGQYQSFNEALKYMLARQSGKEKSIQTPWPKFNDAVTDGLEWNTLTVIGGRPGSGKTLIK
Ga0181379_121493313300017783SeawaterMSKNKLWNGQYQSFNEALKYMLDRQSGKEKSIYTPWPKFNDAVTDGLEWNTLTVIGGRPGSGKTLIKDQIIRES
Ga0181355_133588233300017785Freshwater LakeMSKPTESWIGQYAAFNDALKYMYKRQTGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGR
Ga0181424_1025149523300017786SeawaterMSQIKQEWDGQYHAFNEALKYMLARQSGKEKSIQTPWPKFNDAITDGLEWNTLTVIG
Ga0181424_1039440933300017786SeawaterMSKPISAWGGQYKAFKEALNYMSKRQSGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQIIRE
Ga0181590_1020577413300017967Salt MarshMSKPTEEWVGQYASFNDALKYMVKRANGEEKSIYTPWPKFNDATTDGLEWNTLTVMGGRPGSGKTLI
Ga0181359_111751813300019784Freshwater LakeMSKPTESWIGQYAAFNDALKYMYKRQTGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQIIRE
Ga0194121_1019747813300020200Freshwater LakeMSGHLWDGQHSAFNEALKYIKSRQSGQDKSIYTPWPKFNDATVDGLEWNSLTVIAARPGSGKTLI
Ga0211504_100694813300020347MarineMKNKPSWIGQYAAFNDALKYMYARSTGEEKSIYTPWPKFNDAATDGIEWNTLTVIGGRPGSGKTLIKDQ
Ga0211523_1041631713300020414MarineMAKAKEAWVGQYAAFNEALKYMYRRQTGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSG
Ga0211580_1031395423300020420MarineMSRKPAWNGQHESFNEALKYMFQRQSGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQII
Ga0211653_1039631013300020421MarineMSQVKPAWDGQYQSFNEALKYMLARQSGKEKSIQTPWPKFNDAVTDGLEWNTLTVIG
Ga0211622_1027011323300020430MarineMKKAWDGQHKAFGEALKYMLDRSTGEEKSIYTPWPKFNDAVTDGLEWNTLTVIGGRPGSGKTLI
Ga0211473_1003962313300020451MarineMKKKPSWVGQYAAFNEALKYMYARSTGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQIIRESF
Ga0206680_1011046543300021352SeawaterMAKSTEGWVGQYSAFNEALKYMQGRQNGTEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLIKDQII
Ga0213858_1045717723300021356SeawaterMTEELWGGQYAAFNEALKYMYRRANGEEKSIYTPWAKFNDATTDGLEWNTLTVMGGRPGSGKTLIKDQI
Ga0213864_10002326213300021379SeawaterMSKQSQPSWIGQYAAFNEALKYMYKRQSGEEKSIYTPWPKFNDATTDGLEWNTLTVMGGRPGSGKTLIKDQII
Ga0222717_1011391813300021957Estuarine WaterMSKPTEGWAGQYAAFNDALKYMVKRANGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRP
Ga0222716_1005819173300021959Estuarine WaterMSKPTEGWAGQYAAFNDALKYMVKRANGEEKSIYTPWPKFNDATTDGLEWNTLTVIG
Ga0222715_1041581213300021960Estuarine WaterMSRPKPAWVGQYEAFNDALKYMYARSTGDEKSIYTPWPKFNDACTDGLEWNTLTVIGGRPGSGKTL
Ga0196895_102657313300022067AqueousMQRKHEWQSQHVDYNEALKYMKRRQEGTEKSIYTPWPKFNDAALDGLEWNTTTIIGGRPGAGKTLH
Ga0212031_100395713300022176AqueousMSNVKPEWEGQHKSFSEALNYMLKRQTGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQII
Ga0181354_109828713300022190Freshwater LakeMSKPTESWIGQYAAFNDALKYMYKRQTGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQI
(restricted) Ga0233409_1035641113300022938SeawaterMSKPTPAWVGQYTAFNDALKYMYARSTGDEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLIKDQIIRESFMLNPN
(restricted) Ga0233408_1016401923300023089SeawaterMSKVKEEWIGQFSAFNEALKYMSKRANGEEKSIYTPWAKFNDATTDGLEWNTLTVMGGRPGSGKTLIKDQIIRESFMLNPNDDF
(restricted) Ga0233411_1000243013300023112SeawaterMSKPTPAWVGQYTAFNDALKYMYARSTGDEKSIYTPWPKFNDAATDGLEWNTLTVIGGRP
Ga0255762_1011000713300023119Salt MarshMSKPTEEWVGQYASFNDALKYMVKRANGEEKSIYTPWPKFNDATTDGLEWNTLTVMGGRPGSGKTLIKDPIIRES
Ga0228682_105682823300023698SeawaterMSKPTPAWVGQYTAFNDALKYMYARSTGEEKSIYTPWPKFNDAATDGLEWNTLTVIGGR
Ga0228651_103866313300024293SeawaterMSKPTPAWVGQYTAFNDALKYMYARSTGEEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLIKDQIIRESFALN
Ga0228629_102208853300024296SeawaterMAKSTEGWVGQYSAFNEALKYMQGRQNGTEKSIYTPWPKFNDAATDGLEWNTLTVIGGRP
Ga0255148_107162913300024306FreshwaterMSKPEKAWNGQYASFNEALKYMQKRAAGQEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQIIRESFSL
Ga0244776_1089611413300024348EstuarineMSKPEKAWNGQYASFNEALKYMQKRSAGLEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQIIR
(restricted) Ga0255045_1018477313300024528SeawaterMSRPTEGWVGQYAAFNEALKYMQGRQNGTEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLIKDQIIRESFA
Ga0208018_10761713300025057MarineMSKPTPAWRGQYEAFNDALKYMYARSTGEEKSIYTPWPKFNDACTDGLEWNTLTVIGGRPGSGKTLIKDQ
Ga0208157_114629923300025086MarineMKNKTWFPQNNSFKEALRYMKARMDGTEKSIYTPWHKFNDAATDGLEWNTLTIIGGRPGSGKTLIKDQIIRESFV
Ga0208794_108240733300025093MarineMSKAQKAWAGQYQAFNEALKYMNNRMHGEERSILTPWSKFNDAGTDGIEWNTLTVIGGRPGSGKTLIKDQIIRESF
Ga0208794_108398613300025093MarineMSFVQMWSPQRNSFTEALVYMKKRQSGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQIVRESF
Ga0208158_111871123300025110MarineMSQIKQEWDGQYHAFNEALKYMLARQSGKEKSIQTPWPKFNDAITEGLEWNTLTVIGGRPGSGKTLIKDQIIRE
Ga0209535_112077423300025120MarineMKKTSEAWVGQYAAFNEALKYMFKRSTGEEKSIYTPWPKFNDAATDGIEWNTLTVIGGRPGSGKTLIKDQIIRESF
Ga0209645_105034433300025151MarineMKAWNGQYQSFNEALKYMLDRQSGKEKSIQTPWPKFNDAVTDGLEWNTLTVIGGRPGS
Ga0209337_133261623300025168MarineMKKKESWVGQYAAFNEALKYMYARSTGEEKSIYTPWPKFNDAATDGIEWNTLTVIGGRPGSGKTLIKDQIIRESFA
Ga0208814_115792913300025276Deep OceanMKKTSEAWVGQYAAFNEALKYMFKRSTGEEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKT
Ga0209557_110795513300025483MarineMSITKIEWEGQYSTFNSGLKYMLNRQKGLEKSIYTPWPKFNDATTDGLEWNTLTVIG
Ga0209555_1039362423300025879MarineMSKTQQEWDGQYASFNDALKYMLKRSKGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIK
Ga0209630_1016415213300025892Pelagic MarineMKTKESWVGQYAAFNEALKYMYARSTGEEKSIYTPWPKFNDAATDGIEWNTLTVIGGRPGSGKTLIKDQI
Ga0209086_1015075233300027770Freshwater LakeMSKPTESWIGQYAAFNDALKYMYKRQTGEEKSIYTPWPKFNEATTDGLEWNTLTVIGGRPGSGKTLIKDQIIRESF
Ga0209711_1036958233300027788MarineMSKTDKSWVGQHAAFSEALKYMNARQKGEEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTL
(restricted) Ga0233415_1007499913300027861SeawaterMSKPTEGWVGQYAAFNDALKYMYKRANGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQIIRE
(restricted) Ga0233413_1001418393300027996SeawaterMKAWNGQYEAFNEALKYMLDRQSGKEKSIQTPWPKFNDAITDGLEWNTLTVIGGRPGS
(restricted) Ga0233413_1004936613300027996SeawaterMSNNSEAWVGQYAAFNEALKYMDARQKGLEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLIKDQIIRE
(restricted) Ga0233413_1050479033300027996SeawaterMSKFEKAWNGQFNAFNEALKYMQKRQTGEEKSIYTPWPKFNEATTDGLEWNTLTVIGG
Ga0256382_109428913300028022SeawaterMAKLATKAWDGQYKAFNEALKYMLDRQSGKEKSIYTPWAKFNDAVTDGLEWNTLTVIG
Ga0308021_1015202023300031141MarineMTDKKAWGGQYTAFNEALKYMLDRQSGKEKSIQTPWPKFNDAITDGLEWNTLTVIGGRPGSGKTLIKDQII
Ga0307380_1025209013300031539SoilMIENAWGGQYAAFNEALKYMLDRQTGKQKSIQTPWPKFNDAITDGLEWNTLTVIGGRPGSGKTLIKDQIIRESFIH
Ga0307378_10014697233300031566SoilMSKPTPAWVGQYTAFNDALKYMYARSTGDEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSG
Ga0307999_116554013300031608MarineMSKPKEGWVGQYAAFNEALKYMHARQNGLEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLIKDQIIRESFAL
Ga0307377_1004587113300031673SoilMSKPAEAWVGQYAAFNEALKYMRGRQNGTEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLIKD
Ga0315328_1020478413300031757SeawaterMSKAWEGQHKAFQEALRYMLDRQSGKEKSIYTPWHKFNDAVTDGLEWNTLTVIGGRP
Ga0315331_1021042843300031774SeawaterMKKTTDAWIGQYAAFNEALKYMYARSTGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQIVRES
Ga0315331_1024070713300031774SeawaterMKNKPSWIGQYAAFNDALKYMYARSTGEEKSIYTPWPKFNDAATDGIEWNTLTVIGGRPGSGKTLIKDQIIRESFALN
Ga0315320_1041906513300031851SeawaterMKKTSEAWVGQYAAFNEALKYMFKRSTGEEKSIYTPWPKFNDAATDGIEWNTLTVIGGRPGSGKTLIKDQIIRES
Ga0315321_1023923233300032088SeawaterMKKKESWVGQYAAFNEALKYMYARSTGEEKSIYTPWPKFNDAATDGIEWNTLTVIGGRPGSGKTLIKDQ
Ga0316205_1008418113300032257Microbial MatMAKSTEGWVGQYAAFNEALKYMQGRQNGTEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLIK
Ga0316203_101386963300032274Microbial MatMSTIKPSWGGQYESFNEALKYMLNRQKGLEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLI
Ga0314858_037005_2_1753300033742Sea-Ice BrineMSKSTGSWIGQFAAFNEALKYMYARQKGEEKSIYTPWPKFNDAATDGLEWNTLTVIGG
Ga0314858_080454_2_2023300033742Sea-Ice BrineMSKPKEGWVGQYAAFNEALKYMYARQNGEEKSIYTPWPKFNDAATDGLEWNTLTVIGGRPGSGKTLI
Ga0335012_0484427_1_2283300034093FreshwaterMSKPTTSWIGQYAAFNEALKYMYKRQTGEEKSIYTPWPKFNDATTDGLEWNTLTVIGGRPGSGKTLIKDQIIRESF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.