NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055723

Metagenome / Metatranscriptome Family F055723

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055723
Family Type Metagenome / Metatranscriptome
Number of Sequences 138
Average Sequence Length 44 residues
Representative Sequence MEIKSTVIFEKNYAALEGPHRFIINEGGSRSSKTYSLCQL
Number of Associated Samples 118
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 45.65 %
% of genes near scaffold ends (potentially truncated) 99.28 %
% of genes from short scaffolds (< 2000 bps) 90.58 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (65.217 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(14.493 % of family members)
Environment Ontology (ENVO) Unclassified
(35.507 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(43.478 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.71%    β-sheet: 17.65%    Coil/Unstructured: 67.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF16677GP3_package 57.97
PF05766NinG 1.45
PF11325DUF3127 0.72
PF08279HTH_11 0.72
PF00583Acetyltransf_1 0.72
PF03592Terminase_2 0.72
PF13508Acetyltransf_7 0.72
PF04466Terminase_3 0.72
PF08299Bac_DnaA_C 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 0.72
COG1783Phage terminase large subunitMobilome: prophages, transposons [X] 0.72
COG3728Phage terminase, small subunitMobilome: prophages, transposons [X] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.38 %
UnclassifiedrootN/A3.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001282|B570J14230_10124338All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage755Open in IMG/M
3300002161|JGI24766J26685_10116605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.564Open in IMG/M
3300003393|JGI25909J50240_1083499All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes639Open in IMG/M
3300003393|JGI25909J50240_1088010All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.620Open in IMG/M
3300003394|JGI25907J50239_1036370All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300005417|Ga0068884_1055809All Organisms → Viruses → Predicted Viral3165Open in IMG/M
3300005581|Ga0049081_10237094All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes644Open in IMG/M
3300005581|Ga0049081_10248610All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes624Open in IMG/M
3300005581|Ga0049081_10286452All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300005581|Ga0049081_10338128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes512Open in IMG/M
3300005805|Ga0079957_1174367All Organisms → Viruses → Predicted Viral1065Open in IMG/M
3300006484|Ga0070744_10117131All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes768Open in IMG/M
3300006641|Ga0075471_10214557All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes998Open in IMG/M
3300006734|Ga0098073_1046039All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes588Open in IMG/M
3300006875|Ga0075473_10039613All Organisms → Viruses → Predicted Viral1816Open in IMG/M
3300007363|Ga0075458_10244700All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes547Open in IMG/M
3300007560|Ga0102913_1021894All Organisms → Viruses → Predicted Viral2100Open in IMG/M
3300007561|Ga0102914_1150028All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage721Open in IMG/M
3300007585|Ga0102916_1011576All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2111Open in IMG/M
3300007597|Ga0102919_1110446All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage865Open in IMG/M
3300007603|Ga0102921_1138523All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage882Open in IMG/M
3300007606|Ga0102923_1098148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes920Open in IMG/M
3300007627|Ga0102869_1129424All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage684Open in IMG/M
3300007636|Ga0102856_1065844All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300007642|Ga0102876_1062738All Organisms → Viruses → Predicted Viral1027Open in IMG/M
3300007706|Ga0102899_1062844All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage890Open in IMG/M
3300007706|Ga0102899_1089528All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes746Open in IMG/M
3300007972|Ga0105745_1055511All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1096Open in IMG/M
3300007972|Ga0105745_1057912All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1077Open in IMG/M
3300008120|Ga0114355_1059880All Organisms → Viruses → Predicted Viral2728Open in IMG/M
3300008261|Ga0114336_1168957All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage950Open in IMG/M
3300008266|Ga0114363_1162360All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage729Open in IMG/M
3300008267|Ga0114364_1068512All Organisms → Viruses → Predicted Viral1203Open in IMG/M
3300008267|Ga0114364_1188563All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300008448|Ga0114876_1239300All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300009051|Ga0102864_1134283All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage676Open in IMG/M
3300009141|Ga0102884_1048121All Organisms → Viruses → Predicted Viral1064Open in IMG/M
3300009149|Ga0114918_10759024All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes506Open in IMG/M
3300009169|Ga0105097_10436479All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.729Open in IMG/M
3300010354|Ga0129333_11105495All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage662Open in IMG/M
3300011183|Ga0136713_1062155All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300011268|Ga0151620_1024743All Organisms → Viruses → Predicted Viral2071Open in IMG/M
3300012667|Ga0157208_10047597All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
3300013004|Ga0164293_10219440All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1362Open in IMG/M
3300013005|Ga0164292_10579392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes727Open in IMG/M
3300013372|Ga0177922_10550883All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes606Open in IMG/M
3300014819|Ga0119954_1006192All Organisms → Viruses → Predicted Viral3045Open in IMG/M
3300015050|Ga0181338_1011378All Organisms → Viruses → Predicted Viral1452Open in IMG/M
3300017707|Ga0181363_1024706All Organisms → Viruses → Predicted Viral1160Open in IMG/M
3300017716|Ga0181350_1029001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1528Open in IMG/M
3300017722|Ga0181347_1145810All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage648Open in IMG/M
3300017736|Ga0181365_1041451Not Available1157Open in IMG/M
3300017736|Ga0181365_1155209All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes541Open in IMG/M
3300017780|Ga0181346_1216520All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes683Open in IMG/M
3300017785|Ga0181355_1019614All Organisms → Viruses → Predicted Viral2955Open in IMG/M
3300017785|Ga0181355_1317603All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage580Open in IMG/M
3300017785|Ga0181355_1396353All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300020109|Ga0194112_10862898All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300020516|Ga0207935_1029493All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes676Open in IMG/M
3300020564|Ga0208719_1087936All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300021141|Ga0214163_1001549All Organisms → Viruses9836Open in IMG/M
3300021389|Ga0213868_10718597All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
3300021424|Ga0194117_10083238All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1745Open in IMG/M
3300021961|Ga0222714_10238610All Organisms → Viruses → Predicted Viral1026Open in IMG/M
3300021961|Ga0222714_10331344All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage824Open in IMG/M
3300021963|Ga0222712_10046229All Organisms → Viruses → Predicted Viral3289Open in IMG/M
3300022217|Ga0224514_10135113All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage862Open in IMG/M
3300022396|Ga0210364_1116630All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300024346|Ga0244775_10537433All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage952Open in IMG/M
3300024346|Ga0244775_10989230All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.664Open in IMG/M
3300024487|Ga0255222_1044971All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage663Open in IMG/M
3300024491|Ga0255203_1043416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage594Open in IMG/M
3300024539|Ga0255231_1063603All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
3300025171|Ga0209104_1003412All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1282Open in IMG/M
3300025889|Ga0208644_1346207All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage569Open in IMG/M
3300026425|Ga0256300_1003563All Organisms → Viruses → Predicted Viral1908Open in IMG/M
3300026435|Ga0256297_1006790All Organisms → Viruses → Predicted Viral1606Open in IMG/M
3300027135|Ga0255073_1057292All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage632Open in IMG/M
3300027140|Ga0255080_1060383All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
3300027155|Ga0255081_1035741All Organisms → Viruses → Predicted Viral1079Open in IMG/M
3300027193|Ga0208800_1035921All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage668Open in IMG/M
3300027193|Ga0208800_1062146All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage509Open in IMG/M
3300027212|Ga0208554_1058174All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage605Open in IMG/M
3300027218|Ga0208165_1027096All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage861Open in IMG/M
3300027258|Ga0208558_1000174All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9620Open in IMG/M
3300027304|Ga0208810_1024416All Organisms → Viruses → Predicted Viral1393Open in IMG/M
3300027337|Ga0255087_1035359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes998Open in IMG/M
3300027491|Ga0255097_1061427All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300027547|Ga0209864_1028780All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300027608|Ga0208974_1070880All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage967Open in IMG/M
3300027659|Ga0208975_1193859All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300027688|Ga0209553_1283113All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
3300027693|Ga0209704_1019808All Organisms → Viruses → Predicted Viral1702Open in IMG/M
3300027785|Ga0209246_10353055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage558Open in IMG/M
3300027805|Ga0209229_10309694All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage695Open in IMG/M
3300027805|Ga0209229_10412271All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage585Open in IMG/M
3300027808|Ga0209354_10130764All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1025Open in IMG/M
3300027899|Ga0209668_10312688Not Available1011Open in IMG/M
3300027972|Ga0209079_10168937All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage749Open in IMG/M
3300028266|Ga0255227_1068849All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300028298|Ga0268280_1101971All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage777Open in IMG/M
(restricted) 3300028553|Ga0247839_1065234All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1933Open in IMG/M
3300029697|Ga0256301_1018021All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1170Open in IMG/M
3300029699|Ga0255233_1046375All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage859Open in IMG/M
3300031565|Ga0307379_10171490All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2254Open in IMG/M
3300031566|Ga0307378_11304715All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage566Open in IMG/M
3300031786|Ga0315908_10776809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage784Open in IMG/M
3300031787|Ga0315900_10628178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage778Open in IMG/M
3300031787|Ga0315900_10879091All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M
3300031834|Ga0315290_11645965All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium517Open in IMG/M
3300031857|Ga0315909_10141351All Organisms → Viruses → Predicted Viral1999Open in IMG/M
3300031951|Ga0315904_10517984All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300031951|Ga0315904_10680952All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300031952|Ga0315294_10991989Not Available701Open in IMG/M
3300031952|Ga0315294_11120592All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage645Open in IMG/M
3300031963|Ga0315901_10608220All Organisms → Viruses828Open in IMG/M
3300031999|Ga0315274_10348294All Organisms → Viruses → Predicted Viral1743Open in IMG/M
3300031999|Ga0315274_11860929All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300032050|Ga0315906_11364034All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300032053|Ga0315284_11690990All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage659Open in IMG/M
3300032093|Ga0315902_10119383All Organisms → Viruses → Predicted Viral2813Open in IMG/M
3300032116|Ga0315903_10334203All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1263Open in IMG/M
3300032118|Ga0315277_11194928All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage675Open in IMG/M
3300032177|Ga0315276_11465189All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage711Open in IMG/M
3300033482|Ga0316627_102461194All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300033521|Ga0316616_104948369Not Available501Open in IMG/M
3300033995|Ga0335003_0223085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage888Open in IMG/M
3300034066|Ga0335019_0277670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1058Open in IMG/M
3300034093|Ga0335012_0233819Not Available960Open in IMG/M
3300034101|Ga0335027_0644079All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage638Open in IMG/M
3300034105|Ga0335035_0057821All Organisms → Viruses → Predicted Viral2546Open in IMG/M
3300034110|Ga0335055_0138344All Organisms → Viruses → Predicted Viral1102Open in IMG/M
3300034116|Ga0335068_0482716All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300034122|Ga0335060_0479614All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage644Open in IMG/M
3300034284|Ga0335013_0815290All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300034356|Ga0335048_0341768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage761Open in IMG/M
3300034356|Ga0335048_0468203All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage610Open in IMG/M
3300034356|Ga0335048_0567116All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine14.49%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake12.32%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater10.87%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater9.42%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater7.25%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.80%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic4.35%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.62%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.90%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.90%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.17%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment2.17%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.17%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.17%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.45%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.45%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.45%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.45%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.72%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.72%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.72%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.72%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.72%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.72%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.72%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.72%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.72%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300005417Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007560Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007585Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3EnvironmentalOpen in IMG/M
3300007597Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02EnvironmentalOpen in IMG/M
3300007603Estuarine microbial communities from the Columbia River estuary - metaG 1568-02EnvironmentalOpen in IMG/M
3300007606Estuarine microbial communities from the Columbia River estuary - metaG 1569-02EnvironmentalOpen in IMG/M
3300007627Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02EnvironmentalOpen in IMG/M
3300007636Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3EnvironmentalOpen in IMG/M
3300007642Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3EnvironmentalOpen in IMG/M
3300007706Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3EnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300009051Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02EnvironmentalOpen in IMG/M
3300009141Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300011183Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - JTO22cm metaGEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012667Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014819Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011AEnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300020109Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400mEnvironmentalOpen in IMG/M
3300020516Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020564Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021141Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnionEnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022217Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24EnvironmentalOpen in IMG/M
3300022396Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.633 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024487Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024491Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8hEnvironmentalOpen in IMG/M
3300024539Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025171Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - JTO19cm metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026425Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026435Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027135Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8hEnvironmentalOpen in IMG/M
3300027140Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8hEnvironmentalOpen in IMG/M
3300027155Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8hEnvironmentalOpen in IMG/M
3300027193Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)EnvironmentalOpen in IMG/M
3300027212Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027218Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027258Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027304Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027337Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8dEnvironmentalOpen in IMG/M
3300027491Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8dEnvironmentalOpen in IMG/M
3300027547Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027688Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028266Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028298Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40mEnvironmentalOpen in IMG/M
3300028553 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16mEnvironmentalOpen in IMG/M
3300029697Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029699Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034110Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J14230_1012433833300001282FreshwaterMAEISIDSTVIFEKNYTALADPGVRFIINEGGSRSSKTY
JGI24766J26685_1011660533300002161Freshwater And SedimentMDLQSTIVFEKNYDALYNNEARFIINEGGSRSSKTYSLCQLI
JGI25909J50240_108349933300003393Freshwater LakeMLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGNRSSKTYSLCQMLIVYC
JGI25909J50240_108801023300003393Freshwater LakeMDIKATHIFERNYEALNSPEHRFIINEGGSRSSKTYSLCQLIIVYCLQ
JGI25907J50239_103637013300003394Freshwater LakeMLIHLQMQIDSTVIFDKNYAALNDPALRFIINEGGSRSSKTYSL
Ga0068884_1055809103300005417Freshwater LakeMSQLQINSTVIFEKNFDALQDPSIRFIVNQGGSRSSKTYSLCQLII
Ga0049081_1023709413300005581Freshwater LenticMAAITIDSTVIFEKNYTALADPSLRFIINEGGSRSSKTYSL
Ga0049081_1024861023300005581Freshwater LenticMEIRSTVIFERNFEALNSPEHRFIINEGGSRSSKTYSLCQLIIVYCLQ
Ga0049081_1028645213300005581Freshwater LenticMLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRS
Ga0049081_1033812813300005581Freshwater LenticMLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVYCYQNKNKV
Ga0079957_117436733300005805LakeMAEITIDSTVIFEKNYTALADPSIRFIINEGGSRSSK
Ga0070744_1011713133300006484EstuarineMDIKATAIFEKNYEAILSDKRFIINEGGSRSSKTYSLC
Ga0075471_1021455753300006641AqueousMEINSTIIFEKNWIALQEKGVRFVINEGGSRSSKTYSLCQMVIVYC
Ga0098073_104603913300006734MarineMQVEIDGTVVFWKNQKALESGKRFIVNEGGSRSSKTYSLC
Ga0075473_1003961313300006875AqueousMEINSTIIFEKNWSALQEKGVRFVINEGGSRSSKTYSLCQMVIV
Ga0075458_1024470033300007363AqueousMEINSTIIFEKNWSALQEKGVRFVINEGGSRSSKTYSLCQMVIVY
Ga0102913_102189413300007560EstuarineMAEITIDSTVIFEKNYTALADPGVRFIINEGGSRSSKT
Ga0102914_115002813300007561EstuarineMAEISIDSTVIFEKNYTALADPSIRFIINEGGSRSSKT
Ga0102916_101157613300007585EstuarineMAEITIDSTVIFEKNYTALADPGVRFIINEGGSRSSKTY
Ga0102919_111044613300007597EstuarineMAEISIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQM
Ga0102921_113852333300007603EstuarineMAEISIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQ
Ga0102923_109814833300007606EstuarineMAEISIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQMIVVYCLQHPGK
Ga0102869_112942423300007627EstuarineMEIDSTVIFEKNYEALQDKDIRFIINEGGSRSSKTYSLCQMIIVYSLQNKG
Ga0102856_106584423300007636EstuarineMELKATAIFEKNYEAILGDKRFIINEGGSRSSKTYSLCQLMIIYC
Ga0102876_106273833300007642EstuarineMAQITIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYS
Ga0102899_106284433300007706EstuarineMAQITIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQMI
Ga0102899_108952833300007706EstuarineMDLKSTVVFEKNYDALYNNEARFIINEGGSRSSKTYSLCQLILVYCLQN
Ga0105745_105551153300007972Estuary WaterMDIKATAIFEKNYDAIAGDKRFIINEGGSRSSKTYSLCQLMIIYCLQN
Ga0105745_105791253300007972Estuary WaterMEIKSTVIFEKNYDAIAGDKRFIINEGGSRSSKTYSLCQ
Ga0114355_105988083300008120Freshwater, PlanktonMDEISIDSTVIFEKNYTALADPGVRFIINEGGSRSSKTYSLCQMIVVYCHEGDGDI*
Ga0114336_116895733300008261Freshwater, PlanktonMAEISIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQMIVVY
Ga0114363_116236033300008266Freshwater, PlanktonMAEISIDSTVIFEKNYTALADPGVRFIINEGGSRS
Ga0114364_106851213300008267Freshwater, PlanktonMAEITIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQMIVVYCLQHP
Ga0114364_118856323300008267Freshwater, PlanktonMELKSTIVFERNYDALYNNEARFIINEGGSRSSKTYSLCQLILV
Ga0114876_123930033300008448Freshwater LakeMELKSTIVFERNYDALYNNEARFIINEGGSRSSKTYSLCQLI
Ga0102864_113428313300009051EstuarineMDIKATAIFEKNYDAIAGDKRFIINEGGSRSSKTYSLCQLMI
Ga0102884_104812113300009141EstuarineMAEISIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYS
Ga0114918_1075902423300009149Deep SubsurfaceVEIQATKIFEKNWNALQDDGVRFLVNQGGSRSSKTYSLCQLIIVYCLKKPDKVV
Ga0105097_1043647913300009169Freshwater SedimentMDIKATHIFERNFEALNSPDHRFIINEGGSRSSKTYSLCQLIIVYC
Ga0129333_1110549513300010354Freshwater To Marine Saline GradientMEIKSTVIFEKNYEALSGPHRFIINEGGSRSSKTYSLCQLMVIY
Ga0136713_106215523300011183FreshwaterMEINSTVIFEKNYSALQDKDIRFIINEGGSRSSKTYS
Ga0151620_102474363300011268FreshwaterMAEITIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQMI
Ga0157208_1004759733300012667FreshwaterMDLQSTIVFEKNYDALYNNEARFIINEGRSRSSKTYSLC
Ga0164293_1021944013300013004FreshwaterMEINSTVIFEKNYEALQDKDIRFIINEGGSRSSKTYS
Ga0164292_1057939213300013005FreshwaterMELNSTIIFEKNFNALQNKGVRFVINEGGSRSSKTYSLCQLLI
Ga0177922_1055088313300013372FreshwaterVELKSTFIFEKNYEAILGDKRFIINEGGSRSSKTYSL
Ga0119954_100619283300014819FreshwaterMEINSTIIFEKNWSALQKKEVRFVINEGGSRSSKTYSLCQMVI
Ga0181338_101137813300015050Freshwater LakeMDIKATAIFERNYEAISGDKRFIINEGGSRSSKTYSLCQLMIIYCLQNNNKV
Ga0181363_102470613300017707Freshwater LakeMDLKSTIVFERNYDALYSNEARFIINEGGSRSSKTYSLCQLIMVYCLQNPHKV
Ga0181350_102900163300017716Freshwater LakeMEIKATAIFEKNYEAILGDKRFIINEGGSRSSKTYSLCQ
Ga0181347_114581033300017722Freshwater LakeMLMLMPMEIDSTVIFEKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVYCYQNKNKVVSII
Ga0181365_104145143300017736Freshwater LakeMLIHLQMQIDSTVIFDKNYAALNDPALRFIINEGGS
Ga0181365_115520933300017736Freshwater LakeMEIKSTVIFEKNYEALNDPGIRFVINEGGSRSSKTYSLCQLVIIYCLQNN
Ga0181346_121652033300017780Freshwater LakeVEIKATKIFEQNYTALSDSATRFIINQGGSRSSKTYSLCQVIIVYCLQN
Ga0181355_101961493300017785Freshwater LakeMEIKSTVIFERNYEALNSPDHRFIINEGGSRSSKTYSLCQLIIVYCL
Ga0181355_131760313300017785Freshwater LakeMEIKSTVIFEKNYAALNDQGIRFVINEGGSRSSKSS
Ga0181355_139635313300017785Freshwater LakeMLMLMPMEIDSTVIFEKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVYCYQNK
Ga0194112_1086289823300020109Freshwater LakeMEINSTVIFEKNYNAINSGVRFIINEGGSRSSKTYSLCQVVIVYCIQNSNK
Ga0207935_102949313300020516FreshwaterMQINSTIIFQKNWSALQEKGVRFVINEGGSRSSKTYSLCQMVIVYCLQN
Ga0208719_108793613300020564FreshwaterMLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGS
Ga0214163_100154913300021141FreshwaterMDLKSTIVFERNYDALYNNEARFIINEGGSRSSKTYSLCQLIMVYCL
Ga0213868_1071859713300021389SeawaterMEIKSTVIFEKNYEALNDPSLRFVINEGGSRSSKTYSLCQIVIIY
Ga0194117_1008323843300021424Freshwater LakeMEINSTVIFEKNFEALQSEHRFIINEGGSRSSKTYSLCQLIIVY
Ga0222714_1023861053300021961Estuarine WaterMELKSTIVFERNYDALYNNEARFIINEGGSRSSKTYSLCQLILVYCLQ
Ga0222714_1033134413300021961Estuarine WaterMEIKSTVIFEKNYAALNDQGIRFVINEGGSRSSKTYSLCQLVIIYCLQNN
Ga0222712_1004622913300021963Estuarine WaterVGLEIQATKIFEENFDALQDPSIRFIINQGGSRSSKTYSLCQVLIVYCLQNSNKVVSIV
Ga0224514_1013511313300022217SedimentVEIKGTIVFNKNWEALQKNKRFIINEGGSRSSKTYSLCQL
Ga0210364_111663023300022396EstuarineMAEISIDSTVIFEKNYTALTDPSIRFIINEGGSRSSKTYSLCQMIVVYCLQ
Ga0244775_1053743343300024346EstuarineMLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSK
Ga0244775_1098923013300024346EstuarineMDIKATHIFERNFEALNSPDHRFIINEGGSRSSKTYSLCQL
Ga0255222_104497113300024487FreshwaterMEIKSTVIFEKNYAALEGPHRFIINEGGSRSSKTYSLCQLMVIYCLQN
Ga0255203_104341613300024491FreshwaterMLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVYCYQNKNKVV
Ga0255231_106360333300024539FreshwaterMEIKSTVIFEKNYAALEGPHRFIINEGGSRSSKTYSLCQLMVIYCLQ
Ga0209104_100341243300025171FreshwaterMEINSTVIFEKNYSALQDKDIRFIINEGGSRSSKTY
Ga0208644_134620733300025889AqueousMDLQSTIVFEKNYDALYNNEARFIINEGGSRSSKTYSLCQLIL
Ga0256300_100356313300026425FreshwaterMEIKSTVIFEKNYEALSGPHRFIINEGGSRSSKTY
Ga0256297_100679013300026435FreshwaterMEIKSTVIFEKNYEALSGPHRFIINEGGSRSSKTYSLCQLMVIYCLQN
Ga0255073_105729223300027135FreshwaterMAEITIDSTVIFEKNYTALADPSIRFIINEGGSRS
Ga0255080_106038313300027140FreshwaterMEIKSTVIFEKNYAALEGPHRFIINEGGSRSSKTYSLCQLMVIYCLQNS
Ga0255081_103574113300027155FreshwaterMAQITIDSTVIFEKNYTALADPSIRFIINEGGSRS
Ga0208800_103592133300027193EstuarineMLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVYCYQNKN
Ga0208800_106214633300027193EstuarineMLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVYCY
Ga0208554_105817413300027212EstuarineMDLKSTVVFEKNYDALYNNEARFIINEGGSRSSKTY
Ga0208165_102709633300027218EstuarineMAQITIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSL
Ga0208558_100017413300027258EstuarineMAEITIDSTVIFEKNYTALADPGVRFIINEGGSRSSKTYS
Ga0208810_102441613300027304EstuarineMAEITIDSTVIFEKNYTALADPGVRFIINEGGSRSSKTYSLCQMIVVYCLQHPGKV
Ga0255087_103535953300027337FreshwaterMEINSTIIFEKNWSALQEKGVRFVINEGGSRSSKTYSLCQMVIVYCLQNPN
Ga0255097_106142733300027491FreshwaterMEIKSTVIFEKNYAALEGPHRFIINEGGSRSSKTYSLCQLMVI
Ga0209864_102878033300027547SandMLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVYC
Ga0208974_107088013300027608Freshwater LenticMDIKATAIFEKNYEAILGDKRFIINEGGSRSSKTYSLCQL
Ga0208975_119385913300027659Freshwater LenticMLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSL
Ga0209553_128311323300027688Freshwater LakeMLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLI
Ga0209704_101980813300027693Freshwater SedimentMEINSTVIFEKNFNALNSEVRFIINEGGSRSSKTYSLCQL
Ga0209246_1035305533300027785Freshwater LakeMLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVYCYQ
Ga0209229_1030969433300027805Freshwater And SedimentMDLQSTIVFEKNYDALYNNEARFIINEGGSRSSKTYSLCQL
Ga0209229_1041227123300027805Freshwater And SedimentMELNSTVIFEKNWNALQEQGVRFIVNQGGSRSSKTYSICQL
Ga0209354_1013076433300027808Freshwater LakeMEIKATAIFEKNYEAILGDKRFIINEGGSRSSKTYSLCQLMIIYCLQNNNKVVS
Ga0209668_1031268813300027899Freshwater Lake SedimentMEIKATNIFQRNYQALSNSGVRFIINQGGSRSSKTY
Ga0209079_1016893713300027972Freshwater SedimentMELNSTVIFEKNHDALNSDVRFIINEGGSRSSKTYSLCQLV
Ga0255227_106884913300028266FreshwaterMEIKSTVIFEKNYAALEGPHRFIINEGGSRSSKTYSLCQL
Ga0268280_110197113300028298Saline WaterMLMLMPMEIDSTVIFQKNYVALTDPALRFIINEGGSRSSKTYSLCQMLIVYCYQN
(restricted) Ga0247839_106523413300028553FreshwaterMEIKSTVIFEKNYEAILGDRRFIINEGGSRSSKTYSICQLI
Ga0256301_101802113300029697FreshwaterMEIKSTVIFEKNYAALEGPHRFIINEGGSRSSKTYSL
Ga0255233_104637513300029699FreshwaterMEIKSTVIFEKNYAALEGPHRFIINEGGSRSSKTYSLCQLM
Ga0307379_1017149013300031565SoilMAAITIDSTVIFEKNYTALADPSLRFIINEGGSRSSKT
Ga0307378_1130471523300031566SoilMAAITIDSTVIFEKNYTALADPSLRFIINEGGSRS
Ga0315908_1077680943300031786FreshwaterMEIKSTVIFEKNYAALNDQGIRFVINEGGSRSSKTYSLCQLVIIYCL
Ga0315900_1062817833300031787FreshwaterMAEITIDSTVIFEKNYTALEDKSIRFIINEGGSRSSKTYSLCQMIVVYCL
Ga0315900_1087909133300031787FreshwaterMEIKSTVIFEKNYEALNDPSLRFVINEGGSRSSKTYSLCQLVIIY
Ga0315290_1164596523300031834SedimentMELNIKATTVFEKNWEAINSEYRFIKNEGGSRSSKTYSLCQCVII
Ga0315909_1014135113300031857FreshwaterMAEISIDSTVIFEKNYTALADPGVRFIINEGGSRSSKTYSLCQMIV
Ga0315904_1051798413300031951FreshwaterMAEITIDSTVIFEKNYTALADPSIRFIINEGGSRSS
Ga0315904_1068095233300031951FreshwaterMAEITIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQMIVVYC
Ga0315294_1099198913300031952SedimentMDIKATHIFERNYEALTSPEHRFIINEGGSRSSKTFNL
Ga0315294_1112059213300031952SedimentMEIKSTVIFERNYEALTSPEHRFIINEGGSRSSKTY
Ga0315901_1060822033300031963FreshwaterVDIKATNIFQRNYEALTNEGIRFVINQGGSRSSKT
Ga0315274_1034829453300031999SedimentMELNSTVIFQKNHEALNSPEHRFIINEGGSRSSKTY
Ga0315274_1186092913300031999SedimentMDIKATAIFEKNYEAISGDKRFIINEGGSRSSKTYSLCQLMIIYCL
Ga0315906_1136403413300032050FreshwaterMDLKSTIVFERNYDALYNNEARFIINEGGSRSSKTYSLC
Ga0315284_1169099013300032053SedimentMDIKATAIFEKNYEAISGDKRFIINEGGSRSSKTYSLCQL
Ga0315902_1011938393300032093FreshwaterMAEITIDSTVIFEKNYTALADPGVRFIINEGGSRSSKTYSLCQMIVVYCLQHPGKVVS
Ga0315903_1033420313300032116FreshwaterMEIKSTVIFEKNYEALNDQDIRFVINEGGSRSSKTYSLCQL
Ga0315277_1119492833300032118SedimentMLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVY
Ga0315276_1146518913300032177SedimentMLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKT
Ga0316627_10246119413300033482SoilMEIKSTVIFEKNYEALSGPHRFIINEGGSRSSKTYSLCQLMVIYCL
Ga0316616_10494836913300033521SoilMQINATNIFARNWDALTNREVRFIVNEGGSRSSKTYSLCQMVI
Ga0335003_0223085_3_1553300033995FreshwaterMLMLMQMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVY
Ga0335019_0277670_947_10573300034066FreshwaterMLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSR
Ga0335012_0233819_1_1203300034093FreshwaterMLMLMPMEIDSTVIFDKNYAALTDPALRFIINEGGSRSSK
Ga0335027_0644079_2_1393300034101FreshwaterMAEISIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQMIV
Ga0335035_0057821_2418_25463300034105FreshwaterMEIKSTVIFERNYEALTSPEHRFIINEGGSRSSKTYSLCQLII
Ga0335055_0138344_1_1203300034110FreshwaterMELKSTIVFERNYDALYNNEARFIINEGGSRSSKTYSLCQ
Ga0335068_0482716_445_5763300034116FreshwaterMEIKSTVIFEKNYAALNDQDIRFVINEGGSRSSKTYSLCQLVII
Ga0335060_0479614_3_1433300034122FreshwaterMLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQM
Ga0335013_0815290_3_1163300034284FreshwaterMDIKATAIFEKNYEAIAGDKRFIINEGGSRSSKTYSLC
Ga0335048_0341768_615_7613300034356FreshwaterMEIKSTVIFERNYEALTSPEHRFIINEGGSRSSKTYSLCQLIIVYCLQN
Ga0335048_0468203_3_1523300034356FreshwaterMAEITIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQMIVVYCL
Ga0335048_0567116_1_1413300034356FreshwaterMLMLMQMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.