Basic Information | |
---|---|
Family ID | F055723 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 138 |
Average Sequence Length | 44 residues |
Representative Sequence | MEIKSTVIFEKNYAALEGPHRFIINEGGSRSSKTYSLCQL |
Number of Associated Samples | 118 |
Number of Associated Scaffolds | 138 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 45.65 % |
% of genes near scaffold ends (potentially truncated) | 99.28 % |
% of genes from short scaffolds (< 2000 bps) | 90.58 % |
Associated GOLD sequencing projects | 112 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (65.217 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (14.493 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.507 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (43.478 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.71% β-sheet: 17.65% Coil/Unstructured: 67.65% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 138 Family Scaffolds |
---|---|---|
PF16677 | GP3_package | 57.97 |
PF05766 | NinG | 1.45 |
PF11325 | DUF3127 | 0.72 |
PF08279 | HTH_11 | 0.72 |
PF00583 | Acetyltransf_1 | 0.72 |
PF03592 | Terminase_2 | 0.72 |
PF13508 | Acetyltransf_7 | 0.72 |
PF04466 | Terminase_3 | 0.72 |
PF08299 | Bac_DnaA_C | 0.72 |
COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
---|---|---|---|
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.72 |
COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 0.72 |
COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.38 % |
Unclassified | root | N/A | 3.62 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001282|B570J14230_10124338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
3300002161|JGI24766J26685_10116605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 564 | Open in IMG/M |
3300003393|JGI25909J50240_1083499 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 639 | Open in IMG/M |
3300003393|JGI25909J50240_1088010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 620 | Open in IMG/M |
3300003394|JGI25907J50239_1036370 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300005417|Ga0068884_1055809 | All Organisms → Viruses → Predicted Viral | 3165 | Open in IMG/M |
3300005581|Ga0049081_10237094 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 644 | Open in IMG/M |
3300005581|Ga0049081_10248610 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 624 | Open in IMG/M |
3300005581|Ga0049081_10286452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300005581|Ga0049081_10338128 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 512 | Open in IMG/M |
3300005805|Ga0079957_1174367 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
3300006484|Ga0070744_10117131 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 768 | Open in IMG/M |
3300006641|Ga0075471_10214557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 998 | Open in IMG/M |
3300006734|Ga0098073_1046039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 588 | Open in IMG/M |
3300006875|Ga0075473_10039613 | All Organisms → Viruses → Predicted Viral | 1816 | Open in IMG/M |
3300007363|Ga0075458_10244700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 547 | Open in IMG/M |
3300007560|Ga0102913_1021894 | All Organisms → Viruses → Predicted Viral | 2100 | Open in IMG/M |
3300007561|Ga0102914_1150028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
3300007585|Ga0102916_1011576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2111 | Open in IMG/M |
3300007597|Ga0102919_1110446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
3300007603|Ga0102921_1138523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
3300007606|Ga0102923_1098148 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 920 | Open in IMG/M |
3300007627|Ga0102869_1129424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
3300007636|Ga0102856_1065844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300007642|Ga0102876_1062738 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
3300007706|Ga0102899_1062844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
3300007706|Ga0102899_1089528 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 746 | Open in IMG/M |
3300007972|Ga0105745_1055511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1096 | Open in IMG/M |
3300007972|Ga0105745_1057912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1077 | Open in IMG/M |
3300008120|Ga0114355_1059880 | All Organisms → Viruses → Predicted Viral | 2728 | Open in IMG/M |
3300008261|Ga0114336_1168957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
3300008266|Ga0114363_1162360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
3300008267|Ga0114364_1068512 | All Organisms → Viruses → Predicted Viral | 1203 | Open in IMG/M |
3300008267|Ga0114364_1188563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300008448|Ga0114876_1239300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300009051|Ga0102864_1134283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300009141|Ga0102884_1048121 | All Organisms → Viruses → Predicted Viral | 1064 | Open in IMG/M |
3300009149|Ga0114918_10759024 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 506 | Open in IMG/M |
3300009169|Ga0105097_10436479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 729 | Open in IMG/M |
3300010354|Ga0129333_11105495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
3300011183|Ga0136713_1062155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300011268|Ga0151620_1024743 | All Organisms → Viruses → Predicted Viral | 2071 | Open in IMG/M |
3300012667|Ga0157208_10047597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300013004|Ga0164293_10219440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1362 | Open in IMG/M |
3300013005|Ga0164292_10579392 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 727 | Open in IMG/M |
3300013372|Ga0177922_10550883 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 606 | Open in IMG/M |
3300014819|Ga0119954_1006192 | All Organisms → Viruses → Predicted Viral | 3045 | Open in IMG/M |
3300015050|Ga0181338_1011378 | All Organisms → Viruses → Predicted Viral | 1452 | Open in IMG/M |
3300017707|Ga0181363_1024706 | All Organisms → Viruses → Predicted Viral | 1160 | Open in IMG/M |
3300017716|Ga0181350_1029001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1528 | Open in IMG/M |
3300017722|Ga0181347_1145810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300017736|Ga0181365_1041451 | Not Available | 1157 | Open in IMG/M |
3300017736|Ga0181365_1155209 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 541 | Open in IMG/M |
3300017780|Ga0181346_1216520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 683 | Open in IMG/M |
3300017785|Ga0181355_1019614 | All Organisms → Viruses → Predicted Viral | 2955 | Open in IMG/M |
3300017785|Ga0181355_1317603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300017785|Ga0181355_1396353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300020109|Ga0194112_10862898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300020516|Ga0207935_1029493 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 676 | Open in IMG/M |
3300020564|Ga0208719_1087936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300021141|Ga0214163_1001549 | All Organisms → Viruses | 9836 | Open in IMG/M |
3300021389|Ga0213868_10718597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300021424|Ga0194117_10083238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1745 | Open in IMG/M |
3300021961|Ga0222714_10238610 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
3300021961|Ga0222714_10331344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
3300021963|Ga0222712_10046229 | All Organisms → Viruses → Predicted Viral | 3289 | Open in IMG/M |
3300022217|Ga0224514_10135113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
3300022396|Ga0210364_1116630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300024346|Ga0244775_10537433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
3300024346|Ga0244775_10989230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 664 | Open in IMG/M |
3300024487|Ga0255222_1044971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300024491|Ga0255203_1043416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300024539|Ga0255231_1063603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300025171|Ga0209104_1003412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1282 | Open in IMG/M |
3300025889|Ga0208644_1346207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300026425|Ga0256300_1003563 | All Organisms → Viruses → Predicted Viral | 1908 | Open in IMG/M |
3300026435|Ga0256297_1006790 | All Organisms → Viruses → Predicted Viral | 1606 | Open in IMG/M |
3300027135|Ga0255073_1057292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
3300027140|Ga0255080_1060383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300027155|Ga0255081_1035741 | All Organisms → Viruses → Predicted Viral | 1079 | Open in IMG/M |
3300027193|Ga0208800_1035921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300027193|Ga0208800_1062146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300027212|Ga0208554_1058174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300027218|Ga0208165_1027096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300027258|Ga0208558_1000174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9620 | Open in IMG/M |
3300027304|Ga0208810_1024416 | All Organisms → Viruses → Predicted Viral | 1393 | Open in IMG/M |
3300027337|Ga0255087_1035359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 998 | Open in IMG/M |
3300027491|Ga0255097_1061427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
3300027547|Ga0209864_1028780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
3300027608|Ga0208974_1070880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 967 | Open in IMG/M |
3300027659|Ga0208975_1193859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300027688|Ga0209553_1283113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300027693|Ga0209704_1019808 | All Organisms → Viruses → Predicted Viral | 1702 | Open in IMG/M |
3300027785|Ga0209246_10353055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300027805|Ga0209229_10309694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300027805|Ga0209229_10412271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
3300027808|Ga0209354_10130764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1025 | Open in IMG/M |
3300027899|Ga0209668_10312688 | Not Available | 1011 | Open in IMG/M |
3300027972|Ga0209079_10168937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
3300028266|Ga0255227_1068849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
3300028298|Ga0268280_1101971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
(restricted) 3300028553|Ga0247839_1065234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1933 | Open in IMG/M |
3300029697|Ga0256301_1018021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1170 | Open in IMG/M |
3300029699|Ga0255233_1046375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
3300031565|Ga0307379_10171490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2254 | Open in IMG/M |
3300031566|Ga0307378_11304715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300031786|Ga0315908_10776809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
3300031787|Ga0315900_10628178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
3300031787|Ga0315900_10879091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300031834|Ga0315290_11645965 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 517 | Open in IMG/M |
3300031857|Ga0315909_10141351 | All Organisms → Viruses → Predicted Viral | 1999 | Open in IMG/M |
3300031951|Ga0315904_10517984 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300031951|Ga0315904_10680952 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300031952|Ga0315294_10991989 | Not Available | 701 | Open in IMG/M |
3300031952|Ga0315294_11120592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
3300031963|Ga0315901_10608220 | All Organisms → Viruses | 828 | Open in IMG/M |
3300031999|Ga0315274_10348294 | All Organisms → Viruses → Predicted Viral | 1743 | Open in IMG/M |
3300031999|Ga0315274_11860929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300032050|Ga0315906_11364034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300032053|Ga0315284_11690990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300032093|Ga0315902_10119383 | All Organisms → Viruses → Predicted Viral | 2813 | Open in IMG/M |
3300032116|Ga0315903_10334203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1263 | Open in IMG/M |
3300032118|Ga0315277_11194928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300032177|Ga0315276_11465189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300033482|Ga0316627_102461194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300033521|Ga0316616_104948369 | Not Available | 501 | Open in IMG/M |
3300033995|Ga0335003_0223085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 888 | Open in IMG/M |
3300034066|Ga0335019_0277670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1058 | Open in IMG/M |
3300034093|Ga0335012_0233819 | Not Available | 960 | Open in IMG/M |
3300034101|Ga0335027_0644079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300034105|Ga0335035_0057821 | All Organisms → Viruses → Predicted Viral | 2546 | Open in IMG/M |
3300034110|Ga0335055_0138344 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
3300034116|Ga0335068_0482716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300034122|Ga0335060_0479614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300034284|Ga0335013_0815290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300034356|Ga0335048_0341768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
3300034356|Ga0335048_0468203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
3300034356|Ga0335048_0567116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 14.49% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.32% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.87% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 9.42% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.25% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.80% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.35% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.62% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.90% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.90% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.17% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 2.17% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.17% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.17% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.17% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.45% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.45% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.45% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.45% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.45% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.72% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.72% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.72% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.72% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.72% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.72% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.72% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.72% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.72% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.72% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300005417 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
3300009141 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011183 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - JTO22cm metaG | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300020516 | Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020564 | Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022217 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24 | Environmental | Open in IMG/M |
3300022396 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.633 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024487 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024491 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h | Environmental | Open in IMG/M |
3300024539 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025171 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - JTO19cm metaG (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300026425 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026435 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027135 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h | Environmental | Open in IMG/M |
3300027140 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300027155 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h | Environmental | Open in IMG/M |
3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027218 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 (SPAdes) | Environmental | Open in IMG/M |
3300027258 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027304 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027337 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d | Environmental | Open in IMG/M |
3300027491 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d | Environmental | Open in IMG/M |
3300027547 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028266 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028298 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40m | Environmental | Open in IMG/M |
3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
3300029697 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029699 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J14230_101243383 | 3300001282 | Freshwater | MAEISIDSTVIFEKNYTALADPGVRFIINEGGSRSSKTY |
JGI24766J26685_101166053 | 3300002161 | Freshwater And Sediment | MDLQSTIVFEKNYDALYNNEARFIINEGGSRSSKTYSLCQLI |
JGI25909J50240_10834993 | 3300003393 | Freshwater Lake | MLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGNRSSKTYSLCQMLIVYC |
JGI25909J50240_10880102 | 3300003393 | Freshwater Lake | MDIKATHIFERNYEALNSPEHRFIINEGGSRSSKTYSLCQLIIVYCLQ |
JGI25907J50239_10363701 | 3300003394 | Freshwater Lake | MLIHLQMQIDSTVIFDKNYAALNDPALRFIINEGGSRSSKTYSL |
Ga0068884_105580910 | 3300005417 | Freshwater Lake | MSQLQINSTVIFEKNFDALQDPSIRFIVNQGGSRSSKTYSLCQLII |
Ga0049081_102370941 | 3300005581 | Freshwater Lentic | MAAITIDSTVIFEKNYTALADPSLRFIINEGGSRSSKTYSL |
Ga0049081_102486102 | 3300005581 | Freshwater Lentic | MEIRSTVIFERNFEALNSPEHRFIINEGGSRSSKTYSLCQLIIVYCLQ |
Ga0049081_102864521 | 3300005581 | Freshwater Lentic | MLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRS |
Ga0049081_103381281 | 3300005581 | Freshwater Lentic | MLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVYCYQNKNKV |
Ga0079957_11743673 | 3300005805 | Lake | MAEITIDSTVIFEKNYTALADPSIRFIINEGGSRSSK |
Ga0070744_101171313 | 3300006484 | Estuarine | MDIKATAIFEKNYEAILSDKRFIINEGGSRSSKTYSLC |
Ga0075471_102145575 | 3300006641 | Aqueous | MEINSTIIFEKNWIALQEKGVRFVINEGGSRSSKTYSLCQMVIVYC |
Ga0098073_10460391 | 3300006734 | Marine | MQVEIDGTVVFWKNQKALESGKRFIVNEGGSRSSKTYSLC |
Ga0075473_100396131 | 3300006875 | Aqueous | MEINSTIIFEKNWSALQEKGVRFVINEGGSRSSKTYSLCQMVIV |
Ga0075458_102447003 | 3300007363 | Aqueous | MEINSTIIFEKNWSALQEKGVRFVINEGGSRSSKTYSLCQMVIVY |
Ga0102913_10218941 | 3300007560 | Estuarine | MAEITIDSTVIFEKNYTALADPGVRFIINEGGSRSSKT |
Ga0102914_11500281 | 3300007561 | Estuarine | MAEISIDSTVIFEKNYTALADPSIRFIINEGGSRSSKT |
Ga0102916_10115761 | 3300007585 | Estuarine | MAEITIDSTVIFEKNYTALADPGVRFIINEGGSRSSKTY |
Ga0102919_11104461 | 3300007597 | Estuarine | MAEISIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQM |
Ga0102921_11385233 | 3300007603 | Estuarine | MAEISIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQ |
Ga0102923_10981483 | 3300007606 | Estuarine | MAEISIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQMIVVYCLQHPGK |
Ga0102869_11294242 | 3300007627 | Estuarine | MEIDSTVIFEKNYEALQDKDIRFIINEGGSRSSKTYSLCQMIIVYSLQNKG |
Ga0102856_10658442 | 3300007636 | Estuarine | MELKATAIFEKNYEAILGDKRFIINEGGSRSSKTYSLCQLMIIYC |
Ga0102876_10627383 | 3300007642 | Estuarine | MAQITIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYS |
Ga0102899_10628443 | 3300007706 | Estuarine | MAQITIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQMI |
Ga0102899_10895283 | 3300007706 | Estuarine | MDLKSTVVFEKNYDALYNNEARFIINEGGSRSSKTYSLCQLILVYCLQN |
Ga0105745_10555115 | 3300007972 | Estuary Water | MDIKATAIFEKNYDAIAGDKRFIINEGGSRSSKTYSLCQLMIIYCLQN |
Ga0105745_10579125 | 3300007972 | Estuary Water | MEIKSTVIFEKNYDAIAGDKRFIINEGGSRSSKTYSLCQ |
Ga0114355_10598808 | 3300008120 | Freshwater, Plankton | MDEISIDSTVIFEKNYTALADPGVRFIINEGGSRSSKTYSLCQMIVVYCHEGDGDI* |
Ga0114336_11689573 | 3300008261 | Freshwater, Plankton | MAEISIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQMIVVY |
Ga0114363_11623603 | 3300008266 | Freshwater, Plankton | MAEISIDSTVIFEKNYTALADPGVRFIINEGGSRS |
Ga0114364_10685121 | 3300008267 | Freshwater, Plankton | MAEITIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQMIVVYCLQHP |
Ga0114364_11885632 | 3300008267 | Freshwater, Plankton | MELKSTIVFERNYDALYNNEARFIINEGGSRSSKTYSLCQLILV |
Ga0114876_12393003 | 3300008448 | Freshwater Lake | MELKSTIVFERNYDALYNNEARFIINEGGSRSSKTYSLCQLI |
Ga0102864_11342831 | 3300009051 | Estuarine | MDIKATAIFEKNYDAIAGDKRFIINEGGSRSSKTYSLCQLMI |
Ga0102884_10481211 | 3300009141 | Estuarine | MAEISIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYS |
Ga0114918_107590242 | 3300009149 | Deep Subsurface | VEIQATKIFEKNWNALQDDGVRFLVNQGGSRSSKTYSLCQLIIVYCLKKPDKVV |
Ga0105097_104364791 | 3300009169 | Freshwater Sediment | MDIKATHIFERNFEALNSPDHRFIINEGGSRSSKTYSLCQLIIVYC |
Ga0129333_111054951 | 3300010354 | Freshwater To Marine Saline Gradient | MEIKSTVIFEKNYEALSGPHRFIINEGGSRSSKTYSLCQLMVIY |
Ga0136713_10621552 | 3300011183 | Freshwater | MEINSTVIFEKNYSALQDKDIRFIINEGGSRSSKTYS |
Ga0151620_10247436 | 3300011268 | Freshwater | MAEITIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQMI |
Ga0157208_100475973 | 3300012667 | Freshwater | MDLQSTIVFEKNYDALYNNEARFIINEGRSRSSKTYSLC |
Ga0164293_102194401 | 3300013004 | Freshwater | MEINSTVIFEKNYEALQDKDIRFIINEGGSRSSKTYS |
Ga0164292_105793921 | 3300013005 | Freshwater | MELNSTIIFEKNFNALQNKGVRFVINEGGSRSSKTYSLCQLLI |
Ga0177922_105508831 | 3300013372 | Freshwater | VELKSTFIFEKNYEAILGDKRFIINEGGSRSSKTYSL |
Ga0119954_10061928 | 3300014819 | Freshwater | MEINSTIIFEKNWSALQKKEVRFVINEGGSRSSKTYSLCQMVI |
Ga0181338_10113781 | 3300015050 | Freshwater Lake | MDIKATAIFERNYEAISGDKRFIINEGGSRSSKTYSLCQLMIIYCLQNNNKV |
Ga0181363_10247061 | 3300017707 | Freshwater Lake | MDLKSTIVFERNYDALYSNEARFIINEGGSRSSKTYSLCQLIMVYCLQNPHKV |
Ga0181350_10290016 | 3300017716 | Freshwater Lake | MEIKATAIFEKNYEAILGDKRFIINEGGSRSSKTYSLCQ |
Ga0181347_11458103 | 3300017722 | Freshwater Lake | MLMLMPMEIDSTVIFEKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVYCYQNKNKVVSII |
Ga0181365_10414514 | 3300017736 | Freshwater Lake | MLIHLQMQIDSTVIFDKNYAALNDPALRFIINEGGS |
Ga0181365_11552093 | 3300017736 | Freshwater Lake | MEIKSTVIFEKNYEALNDPGIRFVINEGGSRSSKTYSLCQLVIIYCLQNN |
Ga0181346_12165203 | 3300017780 | Freshwater Lake | VEIKATKIFEQNYTALSDSATRFIINQGGSRSSKTYSLCQVIIVYCLQN |
Ga0181355_10196149 | 3300017785 | Freshwater Lake | MEIKSTVIFERNYEALNSPDHRFIINEGGSRSSKTYSLCQLIIVYCL |
Ga0181355_13176031 | 3300017785 | Freshwater Lake | MEIKSTVIFEKNYAALNDQGIRFVINEGGSRSSKSS |
Ga0181355_13963531 | 3300017785 | Freshwater Lake | MLMLMPMEIDSTVIFEKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVYCYQNK |
Ga0194112_108628982 | 3300020109 | Freshwater Lake | MEINSTVIFEKNYNAINSGVRFIINEGGSRSSKTYSLCQVVIVYCIQNSNK |
Ga0207935_10294931 | 3300020516 | Freshwater | MQINSTIIFQKNWSALQEKGVRFVINEGGSRSSKTYSLCQMVIVYCLQN |
Ga0208719_10879361 | 3300020564 | Freshwater | MLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGS |
Ga0214163_10015491 | 3300021141 | Freshwater | MDLKSTIVFERNYDALYNNEARFIINEGGSRSSKTYSLCQLIMVYCL |
Ga0213868_107185971 | 3300021389 | Seawater | MEIKSTVIFEKNYEALNDPSLRFVINEGGSRSSKTYSLCQIVIIY |
Ga0194117_100832384 | 3300021424 | Freshwater Lake | MEINSTVIFEKNFEALQSEHRFIINEGGSRSSKTYSLCQLIIVY |
Ga0222714_102386105 | 3300021961 | Estuarine Water | MELKSTIVFERNYDALYNNEARFIINEGGSRSSKTYSLCQLILVYCLQ |
Ga0222714_103313441 | 3300021961 | Estuarine Water | MEIKSTVIFEKNYAALNDQGIRFVINEGGSRSSKTYSLCQLVIIYCLQNN |
Ga0222712_100462291 | 3300021963 | Estuarine Water | VGLEIQATKIFEENFDALQDPSIRFIINQGGSRSSKTYSLCQVLIVYCLQNSNKVVSIV |
Ga0224514_101351131 | 3300022217 | Sediment | VEIKGTIVFNKNWEALQKNKRFIINEGGSRSSKTYSLCQL |
Ga0210364_11166302 | 3300022396 | Estuarine | MAEISIDSTVIFEKNYTALTDPSIRFIINEGGSRSSKTYSLCQMIVVYCLQ |
Ga0244775_105374334 | 3300024346 | Estuarine | MLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSK |
Ga0244775_109892301 | 3300024346 | Estuarine | MDIKATHIFERNFEALNSPDHRFIINEGGSRSSKTYSLCQL |
Ga0255222_10449711 | 3300024487 | Freshwater | MEIKSTVIFEKNYAALEGPHRFIINEGGSRSSKTYSLCQLMVIYCLQN |
Ga0255203_10434161 | 3300024491 | Freshwater | MLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVYCYQNKNKVV |
Ga0255231_10636033 | 3300024539 | Freshwater | MEIKSTVIFEKNYAALEGPHRFIINEGGSRSSKTYSLCQLMVIYCLQ |
Ga0209104_10034124 | 3300025171 | Freshwater | MEINSTVIFEKNYSALQDKDIRFIINEGGSRSSKTY |
Ga0208644_13462073 | 3300025889 | Aqueous | MDLQSTIVFEKNYDALYNNEARFIINEGGSRSSKTYSLCQLIL |
Ga0256300_10035631 | 3300026425 | Freshwater | MEIKSTVIFEKNYEALSGPHRFIINEGGSRSSKTY |
Ga0256297_10067901 | 3300026435 | Freshwater | MEIKSTVIFEKNYEALSGPHRFIINEGGSRSSKTYSLCQLMVIYCLQN |
Ga0255073_10572922 | 3300027135 | Freshwater | MAEITIDSTVIFEKNYTALADPSIRFIINEGGSRS |
Ga0255080_10603831 | 3300027140 | Freshwater | MEIKSTVIFEKNYAALEGPHRFIINEGGSRSSKTYSLCQLMVIYCLQNS |
Ga0255081_10357411 | 3300027155 | Freshwater | MAQITIDSTVIFEKNYTALADPSIRFIINEGGSRS |
Ga0208800_10359213 | 3300027193 | Estuarine | MLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVYCYQNKN |
Ga0208800_10621463 | 3300027193 | Estuarine | MLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVYCY |
Ga0208554_10581741 | 3300027212 | Estuarine | MDLKSTVVFEKNYDALYNNEARFIINEGGSRSSKTY |
Ga0208165_10270963 | 3300027218 | Estuarine | MAQITIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSL |
Ga0208558_10001741 | 3300027258 | Estuarine | MAEITIDSTVIFEKNYTALADPGVRFIINEGGSRSSKTYS |
Ga0208810_10244161 | 3300027304 | Estuarine | MAEITIDSTVIFEKNYTALADPGVRFIINEGGSRSSKTYSLCQMIVVYCLQHPGKV |
Ga0255087_10353595 | 3300027337 | Freshwater | MEINSTIIFEKNWSALQEKGVRFVINEGGSRSSKTYSLCQMVIVYCLQNPN |
Ga0255097_10614273 | 3300027491 | Freshwater | MEIKSTVIFEKNYAALEGPHRFIINEGGSRSSKTYSLCQLMVI |
Ga0209864_10287803 | 3300027547 | Sand | MLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVYC |
Ga0208974_10708801 | 3300027608 | Freshwater Lentic | MDIKATAIFEKNYEAILGDKRFIINEGGSRSSKTYSLCQL |
Ga0208975_11938591 | 3300027659 | Freshwater Lentic | MLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSL |
Ga0209553_12831132 | 3300027688 | Freshwater Lake | MLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLI |
Ga0209704_10198081 | 3300027693 | Freshwater Sediment | MEINSTVIFEKNFNALNSEVRFIINEGGSRSSKTYSLCQL |
Ga0209246_103530553 | 3300027785 | Freshwater Lake | MLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVYCYQ |
Ga0209229_103096943 | 3300027805 | Freshwater And Sediment | MDLQSTIVFEKNYDALYNNEARFIINEGGSRSSKTYSLCQL |
Ga0209229_104122712 | 3300027805 | Freshwater And Sediment | MELNSTVIFEKNWNALQEQGVRFIVNQGGSRSSKTYSICQL |
Ga0209354_101307643 | 3300027808 | Freshwater Lake | MEIKATAIFEKNYEAILGDKRFIINEGGSRSSKTYSLCQLMIIYCLQNNNKVVS |
Ga0209668_103126881 | 3300027899 | Freshwater Lake Sediment | MEIKATNIFQRNYQALSNSGVRFIINQGGSRSSKTY |
Ga0209079_101689371 | 3300027972 | Freshwater Sediment | MELNSTVIFEKNHDALNSDVRFIINEGGSRSSKTYSLCQLV |
Ga0255227_10688491 | 3300028266 | Freshwater | MEIKSTVIFEKNYAALEGPHRFIINEGGSRSSKTYSLCQL |
Ga0268280_11019711 | 3300028298 | Saline Water | MLMLMPMEIDSTVIFQKNYVALTDPALRFIINEGGSRSSKTYSLCQMLIVYCYQN |
(restricted) Ga0247839_10652341 | 3300028553 | Freshwater | MEIKSTVIFEKNYEAILGDRRFIINEGGSRSSKTYSICQLI |
Ga0256301_10180211 | 3300029697 | Freshwater | MEIKSTVIFEKNYAALEGPHRFIINEGGSRSSKTYSL |
Ga0255233_10463751 | 3300029699 | Freshwater | MEIKSTVIFEKNYAALEGPHRFIINEGGSRSSKTYSLCQLM |
Ga0307379_101714901 | 3300031565 | Soil | MAAITIDSTVIFEKNYTALADPSLRFIINEGGSRSSKT |
Ga0307378_113047152 | 3300031566 | Soil | MAAITIDSTVIFEKNYTALADPSLRFIINEGGSRS |
Ga0315908_107768094 | 3300031786 | Freshwater | MEIKSTVIFEKNYAALNDQGIRFVINEGGSRSSKTYSLCQLVIIYCL |
Ga0315900_106281783 | 3300031787 | Freshwater | MAEITIDSTVIFEKNYTALEDKSIRFIINEGGSRSSKTYSLCQMIVVYCL |
Ga0315900_108790913 | 3300031787 | Freshwater | MEIKSTVIFEKNYEALNDPSLRFVINEGGSRSSKTYSLCQLVIIY |
Ga0315290_116459652 | 3300031834 | Sediment | MELNIKATTVFEKNWEAINSEYRFIKNEGGSRSSKTYSLCQCVII |
Ga0315909_101413511 | 3300031857 | Freshwater | MAEISIDSTVIFEKNYTALADPGVRFIINEGGSRSSKTYSLCQMIV |
Ga0315904_105179841 | 3300031951 | Freshwater | MAEITIDSTVIFEKNYTALADPSIRFIINEGGSRSS |
Ga0315904_106809523 | 3300031951 | Freshwater | MAEITIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQMIVVYC |
Ga0315294_109919891 | 3300031952 | Sediment | MDIKATHIFERNYEALTSPEHRFIINEGGSRSSKTFNL |
Ga0315294_111205921 | 3300031952 | Sediment | MEIKSTVIFERNYEALTSPEHRFIINEGGSRSSKTY |
Ga0315901_106082203 | 3300031963 | Freshwater | VDIKATNIFQRNYEALTNEGIRFVINQGGSRSSKT |
Ga0315274_103482945 | 3300031999 | Sediment | MELNSTVIFQKNHEALNSPEHRFIINEGGSRSSKTY |
Ga0315274_118609291 | 3300031999 | Sediment | MDIKATAIFEKNYEAISGDKRFIINEGGSRSSKTYSLCQLMIIYCL |
Ga0315906_113640341 | 3300032050 | Freshwater | MDLKSTIVFERNYDALYNNEARFIINEGGSRSSKTYSLC |
Ga0315284_116909901 | 3300032053 | Sediment | MDIKATAIFEKNYEAISGDKRFIINEGGSRSSKTYSLCQL |
Ga0315902_101193839 | 3300032093 | Freshwater | MAEITIDSTVIFEKNYTALADPGVRFIINEGGSRSSKTYSLCQMIVVYCLQHPGKVVS |
Ga0315903_103342031 | 3300032116 | Freshwater | MEIKSTVIFEKNYEALNDQDIRFVINEGGSRSSKTYSLCQL |
Ga0315277_111949283 | 3300032118 | Sediment | MLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVY |
Ga0315276_114651891 | 3300032177 | Sediment | MLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKT |
Ga0316627_1024611941 | 3300033482 | Soil | MEIKSTVIFEKNYEALSGPHRFIINEGGSRSSKTYSLCQLMVIYCL |
Ga0316616_1049483691 | 3300033521 | Soil | MQINATNIFARNWDALTNREVRFIVNEGGSRSSKTYSLCQMVI |
Ga0335003_0223085_3_155 | 3300033995 | Freshwater | MLMLMQMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQMLIVY |
Ga0335019_0277670_947_1057 | 3300034066 | Freshwater | MLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSR |
Ga0335012_0233819_1_120 | 3300034093 | Freshwater | MLMLMPMEIDSTVIFDKNYAALTDPALRFIINEGGSRSSK |
Ga0335027_0644079_2_139 | 3300034101 | Freshwater | MAEISIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQMIV |
Ga0335035_0057821_2418_2546 | 3300034105 | Freshwater | MEIKSTVIFERNYEALTSPEHRFIINEGGSRSSKTYSLCQLII |
Ga0335055_0138344_1_120 | 3300034110 | Freshwater | MELKSTIVFERNYDALYNNEARFIINEGGSRSSKTYSLCQ |
Ga0335068_0482716_445_576 | 3300034116 | Freshwater | MEIKSTVIFEKNYAALNDQDIRFVINEGGSRSSKTYSLCQLVII |
Ga0335060_0479614_3_143 | 3300034122 | Freshwater | MLMLMPMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQM |
Ga0335013_0815290_3_116 | 3300034284 | Freshwater | MDIKATAIFEKNYEAIAGDKRFIINEGGSRSSKTYSLC |
Ga0335048_0341768_615_761 | 3300034356 | Freshwater | MEIKSTVIFERNYEALTSPEHRFIINEGGSRSSKTYSLCQLIIVYCLQN |
Ga0335048_0468203_3_152 | 3300034356 | Freshwater | MAEITIDSTVIFEKNYTALADPSIRFIINEGGSRSSKTYSLCQMIVVYCL |
Ga0335048_0567116_1_141 | 3300034356 | Freshwater | MLMLMQMEIDSTVIFQKNYAALTDPALRFIINEGGSRSSKTYSLCQM |
⦗Top⦘ |