| Basic Information | |
|---|---|
| Family ID | F055703 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 45 residues |
| Representative Sequence | AIFLEWEGERLQPDEIKLGVIVTILGAFLTRMVAIARGIKGWRYV |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.72 % |
| % of genes near scaffold ends (potentially truncated) | 97.83 % |
| % of genes from short scaffolds (< 2000 bps) | 94.93 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.188 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.812 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.986 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.652 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.21% β-sheet: 0.00% Coil/Unstructured: 54.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF00202 | Aminotran_3 | 21.01 |
| PF01019 | G_glu_transpept | 15.22 |
| PF13410 | GST_C_2 | 9.42 |
| PF02826 | 2-Hacid_dh_C | 5.07 |
| PF04240 | Caroten_synth | 4.35 |
| PF04199 | Cyclase | 2.17 |
| PF02538 | Hydantoinase_B | 2.17 |
| PF00324 | AA_permease | 2.17 |
| PF08882 | Acetone_carb_G | 1.45 |
| PF05199 | GMC_oxred_C | 1.45 |
| PF03734 | YkuD | 0.72 |
| PF03458 | Gly_transporter | 0.72 |
| PF00941 | FAD_binding_5 | 0.72 |
| PF00083 | Sugar_tr | 0.72 |
| PF06187 | DUF993 | 0.72 |
| PF13417 | GST_N_3 | 0.72 |
| PF00694 | Aconitase_C | 0.72 |
| PF13673 | Acetyltransf_10 | 0.72 |
| PF00528 | BPD_transp_1 | 0.72 |
| PF02798 | GST_N | 0.72 |
| PF13545 | HTH_Crp_2 | 0.72 |
| PF00155 | Aminotran_1_2 | 0.72 |
| PF05598 | DUF772 | 0.72 |
| PF05222 | AlaDh_PNT_N | 0.72 |
| PF00873 | ACR_tran | 0.72 |
| PF10098 | DUF2336 | 0.72 |
| PF03401 | TctC | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 15.22 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 4.35 |
| COG2324 | Uncharacterized membrane protein | Function unknown [S] | 4.35 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 2.17 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 2.17 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 2.17 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 2.17 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 2.17 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 1.45 |
| COG4647 | Acetone carboxylase, gamma subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.45 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG2860 | Uncharacterized membrane protein YeiH | Function unknown [S] | 0.72 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.19 % |
| Unclassified | root | N/A | 26.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002244|JGI24742J22300_10016242 | Not Available | 1255 | Open in IMG/M |
| 3300004479|Ga0062595_101765601 | Not Available | 586 | Open in IMG/M |
| 3300004479|Ga0062595_102542749 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300004633|Ga0066395_10657876 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300005093|Ga0062594_101785845 | Not Available | 647 | Open in IMG/M |
| 3300005148|Ga0066819_1003788 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300005332|Ga0066388_104986657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300005332|Ga0066388_105948615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 616 | Open in IMG/M |
| 3300005332|Ga0066388_108577593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300005363|Ga0008090_10197186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
| 3300005363|Ga0008090_12885268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia → Bauldia litoralis | 514 | Open in IMG/M |
| 3300005437|Ga0070710_10251858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1135 | Open in IMG/M |
| 3300005439|Ga0070711_100193912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1563 | Open in IMG/M |
| 3300005529|Ga0070741_10759737 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300005539|Ga0068853_101249985 | Not Available | 717 | Open in IMG/M |
| 3300005548|Ga0070665_102280730 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005614|Ga0068856_102590466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300005713|Ga0066905_102134339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 521 | Open in IMG/M |
| 3300005719|Ga0068861_102406190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300005764|Ga0066903_104331826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 758 | Open in IMG/M |
| 3300005764|Ga0066903_105289052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 682 | Open in IMG/M |
| 3300005842|Ga0068858_100670720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1008 | Open in IMG/M |
| 3300006028|Ga0070717_10103679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2418 | Open in IMG/M |
| 3300006028|Ga0070717_11019895 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 754 | Open in IMG/M |
| 3300006028|Ga0070717_12070364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300006059|Ga0075017_100033146 | All Organisms → cellular organisms → Bacteria | 3409 | Open in IMG/M |
| 3300006162|Ga0075030_101456290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 536 | Open in IMG/M |
| 3300006581|Ga0074048_12719066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 583 | Open in IMG/M |
| 3300006755|Ga0079222_11620230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300006854|Ga0075425_101896180 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006904|Ga0075424_100252941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1873 | Open in IMG/M |
| 3300009092|Ga0105250_10327413 | Not Available | 667 | Open in IMG/M |
| 3300009147|Ga0114129_10171326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 2959 | Open in IMG/M |
| 3300009792|Ga0126374_11620091 | Not Available | 535 | Open in IMG/M |
| 3300010048|Ga0126373_10524048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1230 | Open in IMG/M |
| 3300010376|Ga0126381_100943154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1243 | Open in IMG/M |
| 3300010376|Ga0126381_101252308 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300010376|Ga0126381_101914080 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300010868|Ga0124844_1172970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
| 3300012204|Ga0137374_10424573 | Not Available | 1050 | Open in IMG/M |
| 3300012285|Ga0137370_10936061 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012361|Ga0137360_10639413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum populi → Methylorubrum populi BJ001 | 912 | Open in IMG/M |
| 3300012469|Ga0150984_118351790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. ID38640 | 1453 | Open in IMG/M |
| 3300012582|Ga0137358_10396352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 934 | Open in IMG/M |
| 3300012971|Ga0126369_11030529 | Not Available | 911 | Open in IMG/M |
| 3300012971|Ga0126369_12471018 | Not Available | 605 | Open in IMG/M |
| 3300012971|Ga0126369_12837319 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012986|Ga0164304_10081073 | Not Available | 1877 | Open in IMG/M |
| 3300012988|Ga0164306_10472575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 958 | Open in IMG/M |
| 3300013306|Ga0163162_10515572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. D7 | 1325 | Open in IMG/M |
| 3300014325|Ga0163163_11523708 | Not Available | 730 | Open in IMG/M |
| 3300014325|Ga0163163_13222868 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300014968|Ga0157379_11109949 | Not Available | 758 | Open in IMG/M |
| 3300014969|Ga0157376_11295899 | Not Available | 758 | Open in IMG/M |
| 3300015371|Ga0132258_10258620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4260 | Open in IMG/M |
| 3300016270|Ga0182036_11009326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300016319|Ga0182033_11178389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300016357|Ga0182032_10461715 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1038 | Open in IMG/M |
| 3300016387|Ga0182040_10662066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 850 | Open in IMG/M |
| 3300016387|Ga0182040_11968076 | Not Available | 502 | Open in IMG/M |
| 3300017975|Ga0187782_10123134 | Not Available | 1918 | Open in IMG/M |
| 3300018476|Ga0190274_12475119 | Not Available | 616 | Open in IMG/M |
| 3300019873|Ga0193700_1071022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 515 | Open in IMG/M |
| 3300019875|Ga0193701_1106407 | Not Available | 517 | Open in IMG/M |
| 3300020579|Ga0210407_10074174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2557 | Open in IMG/M |
| 3300020580|Ga0210403_10328769 | Not Available | 1251 | Open in IMG/M |
| 3300020581|Ga0210399_10207894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1628 | Open in IMG/M |
| 3300021178|Ga0210408_10850898 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300021362|Ga0213882_10411736 | Not Available | 572 | Open in IMG/M |
| 3300021407|Ga0210383_10867835 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300021432|Ga0210384_11217566 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300021433|Ga0210391_10537566 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300021559|Ga0210409_10792595 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300021560|Ga0126371_10449660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1434 | Open in IMG/M |
| 3300021560|Ga0126371_10839972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1064 | Open in IMG/M |
| 3300024271|Ga0224564_1129929 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300025899|Ga0207642_10812779 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300025906|Ga0207699_11050263 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300025915|Ga0207693_10269159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1335 | Open in IMG/M |
| 3300025920|Ga0207649_11112783 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300025939|Ga0207665_10291742 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300025944|Ga0207661_10395870 | Not Available | 1252 | Open in IMG/M |
| 3300026023|Ga0207677_10548664 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1007 | Open in IMG/M |
| 3300026041|Ga0207639_11446981 | Not Available | 645 | Open in IMG/M |
| 3300026118|Ga0207675_100514437 | Not Available | 1193 | Open in IMG/M |
| 3300026319|Ga0209647_1193718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
| 3300027070|Ga0208365_1025162 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300027070|Ga0208365_1026421 | Not Available | 757 | Open in IMG/M |
| 3300027866|Ga0209813_10466758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group | 519 | Open in IMG/M |
| 3300027874|Ga0209465_10437254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300027898|Ga0209067_10617873 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300027908|Ga0209006_10779042 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300028712|Ga0307285_10038002 | Not Available | 1173 | Open in IMG/M |
| 3300028713|Ga0307303_10031692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Yoonia → Yoonia maricola | 1063 | Open in IMG/M |
| 3300028717|Ga0307298_10241676 | Not Available | 535 | Open in IMG/M |
| 3300028792|Ga0307504_10081014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 997 | Open in IMG/M |
| 3300028872|Ga0307314_10290551 | Not Available | 518 | Open in IMG/M |
| 3300028875|Ga0307289_10078883 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1333 | Open in IMG/M |
| 3300028884|Ga0307308_10194979 | Not Available | 970 | Open in IMG/M |
| 3300028906|Ga0308309_10352626 | Not Available | 1255 | Open in IMG/M |
| 3300031546|Ga0318538_10361214 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 784 | Open in IMG/M |
| 3300031546|Ga0318538_10835091 | Not Available | 500 | Open in IMG/M |
| 3300031680|Ga0318574_10214787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1107 | Open in IMG/M |
| 3300031682|Ga0318560_10143079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1263 | Open in IMG/M |
| 3300031713|Ga0318496_10348236 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
| 3300031744|Ga0306918_10106469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2006 | Open in IMG/M |
| 3300031748|Ga0318492_10077014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1606 | Open in IMG/M |
| 3300031753|Ga0307477_10491687 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300031780|Ga0318508_1036394 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300031781|Ga0318547_10420848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
| 3300031782|Ga0318552_10684077 | Not Available | 523 | Open in IMG/M |
| 3300031792|Ga0318529_10080264 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1452 | Open in IMG/M |
| 3300031798|Ga0318523_10158259 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1127 | Open in IMG/M |
| 3300031805|Ga0318497_10874145 | Not Available | 504 | Open in IMG/M |
| 3300031820|Ga0307473_10064348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1808 | Open in IMG/M |
| 3300031835|Ga0318517_10267316 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 772 | Open in IMG/M |
| 3300031845|Ga0318511_10146583 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300031860|Ga0318495_10141229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1085 | Open in IMG/M |
| 3300031894|Ga0318522_10247402 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300031897|Ga0318520_10909178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300031912|Ga0306921_10515152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 1390 | Open in IMG/M |
| 3300031912|Ga0306921_11996912 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300031945|Ga0310913_10732853 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300031959|Ga0318530_10093879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1186 | Open in IMG/M |
| 3300031981|Ga0318531_10212288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 872 | Open in IMG/M |
| 3300032025|Ga0318507_10205359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 850 | Open in IMG/M |
| 3300032042|Ga0318545_10287064 | Not Available | 591 | Open in IMG/M |
| 3300032051|Ga0318532_10055365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1365 | Open in IMG/M |
| 3300032052|Ga0318506_10055098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1616 | Open in IMG/M |
| 3300032055|Ga0318575_10594887 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300032065|Ga0318513_10524347 | Not Available | 580 | Open in IMG/M |
| 3300032090|Ga0318518_10735676 | Not Available | 501 | Open in IMG/M |
| 3300032091|Ga0318577_10616002 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300032261|Ga0306920_100039638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6801 | Open in IMG/M |
| 3300032261|Ga0306920_100953659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1251 | Open in IMG/M |
| 3300032261|Ga0306920_103442832 | Not Available | 586 | Open in IMG/M |
| 3300033290|Ga0318519_11001300 | Not Available | 519 | Open in IMG/M |
| 3300033433|Ga0326726_10489957 | Not Available | 1175 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.90% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.17% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.45% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.72% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.72% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005148 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24742J22300_100162422 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | IFLEWEGARLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV* |
| Ga0062595_1017656012 | 3300004479 | Soil | WEGARLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV* |
| Ga0062595_1025427492 | 3300004479 | Soil | CGLALAVFLSWEGERLQPDEIKIGVIVIIAAAFSIRMVAIARGMKGWRFV* |
| Ga0066395_106578762 | 3300004633 | Tropical Forest Soil | FLEWEGERLQPDEITLAVIVTISGVFLTRMVAIARDIKGWRYV* |
| Ga0062594_1017858453 | 3300005093 | Soil | FLEWEGARLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV* |
| Ga0066819_10037882 | 3300005148 | Soil | QPAWRTLSRDSRRLGAAFAIFLEWEGARLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV* |
| Ga0066388_1049866571 | 3300005332 | Tropical Forest Soil | FFQWEGERLQTDEIRLAVIITLIGAFLTRVVAILRGIKGWS* |
| Ga0066388_1059486152 | 3300005332 | Tropical Forest Soil | EWEGERLQPDEIKLGVIVTILGAFLTRMVAIARGIKGWRYV* |
| Ga0066388_1085775931 | 3300005332 | Tropical Forest Soil | PEIAVVWGLALALFLEWEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYV* |
| Ga0008090_101971862 | 3300005363 | Tropical Rainforest Soil | LALALFLEWEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYA* |
| Ga0008090_128852681 | 3300005363 | Tropical Rainforest Soil | MFLEWEGERLEPNEITLGVIVTILGAFLTRMVTIARGMKGWPYV* |
| Ga0070710_102518581 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | YPEIAAIRGLALALFLEWEGERLAPDEITIGVVVTIVGAFLTRMVAIARGMKGWPYV* |
| Ga0070711_1001939121 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | EGARLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV* |
| Ga0070741_107597373 | 3300005529 | Surface Soil | PEIAVIWGLAFTLFLEWEGERLQPEEIKWGVIVAIVGCFLTRLVAILRGWRGWSYA* |
| Ga0068853_1012499851 | 3300005539 | Corn Rhizosphere | WEGERLQFDEIRAGVIVTIVGIFVTRIIAIMRDMKGWSYV* |
| Ga0070665_1022807301 | 3300005548 | Switchgrass Rhizosphere | LSWEGERLQPDEIKIGVIVIIAAAFSIRMVAIARGMKGWRFV* |
| Ga0068856_1025904661 | 3300005614 | Corn Rhizosphere | AVWGLALALFLGWEAERLQPDEIWFGVVITILGAFAMRMVAITRRTKGWRYA* |
| Ga0066905_1021343391 | 3300005713 | Tropical Forest Soil | ERLQPDEIKLGVIVTILGAFLTRMVAIARGIKGWRYV* |
| Ga0068861_1024061902 | 3300005719 | Switchgrass Rhizosphere | WEGERLETDEIRLGVIVTLFGVFLTRMLAIARGWKGWSYV* |
| Ga0066903_1043318262 | 3300005764 | Tropical Forest Soil | EWEGERLQPDEIKLGVIVTILGVFLTRMVAIARGIKGWRYV* |
| Ga0066903_1052890521 | 3300005764 | Tropical Forest Soil | AIFLEWEGERLQPDEIKLGVIVTILGAFLTRMVAIARGIKGWRYV* |
| Ga0068858_1006707202 | 3300005842 | Switchgrass Rhizosphere | AGVCGLALAVLSWEGERLQPDEIKIGVIVIIAAAFSIRMVAIARGMKGWRFV* |
| Ga0070717_101036793 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSWEGERLQPDEIKIGVIVIIAAAFSIRMVAIARGMKGWRFV* |
| Ga0070717_110198952 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | HPYNPRPERAAIWGLLFALFLEWEGARLQPDEIRWGVIVTIIAVFVTRMIAILRGTKGWAYV* |
| Ga0070717_120703642 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FFEWEGARLQTDEIRLAVIVTLVGAFLTRVVAIARGMKGWSYV* |
| Ga0075017_1000331463 | 3300006059 | Watersheds | FLGWEGERLQPDEIKFGVIVVILGAFLTRLLAIARGAKGWRYG* |
| Ga0075030_1014562901 | 3300006162 | Watersheds | LQPDEIRLGVIVTILGIFATRMVAIMRGMKGWSYV* |
| Ga0074048_127190662 | 3300006581 | Soil | LEWEGERLEPDEIRLGVTVTILGAFLTRMVAIARGMKGWRYV* |
| Ga0079222_116202301 | 3300006755 | Agricultural Soil | LALFFEWEGARLQTDEIRLAVIVTLVGAFLTRVVAITRGMKGWPYV* |
| Ga0075425_1018961802 | 3300006854 | Populus Rhizosphere | SWEGERLQPDEIKIGVIVIIAAAFSIRMVAIARGMKGWRFV* |
| Ga0075424_1002529414 | 3300006904 | Populus Rhizosphere | WGIALALFLEWEGERLEPDEITIGVVVTIVGAFLTRMVAIARGMKGWPYV* |
| Ga0105250_103274132 | 3300009092 | Switchgrass Rhizosphere | AFAIFLEWEGARLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV* |
| Ga0114129_101713264 | 3300009147 | Populus Rhizosphere | FLEWEGERLEPDEITIGVVVTIVGAFLTRMVAIARGMKGWPYV* |
| Ga0126374_116200911 | 3300009792 | Tropical Forest Soil | GERLEPDEVTLGVIVTILGAFLTRIVVIARGMKGWSYV* |
| Ga0126373_105240481 | 3300010048 | Tropical Forest Soil | ECERLQPDEIKLGVIVTILGAFLTRMLAIARGIQGWRYV* |
| Ga0126381_1009431542 | 3300010376 | Tropical Forest Soil | EWEGERLEPDEVTLGVIVTILGAFLTRIVAIARGMKGWSYA* |
| Ga0126381_1012523082 | 3300010376 | Tropical Forest Soil | EWEGERLEPDEVTLGVIVTILGAFLTRIVAIARGMKGWSYV* |
| Ga0126381_1019140802 | 3300010376 | Tropical Forest Soil | ALAIFLEWEGERLQPDEIKLGVIVTILGAFLTRMMAIARGIKGWRYV* |
| Ga0124844_11729701 | 3300010868 | Tropical Forest Soil | EGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYA* |
| Ga0137374_104245731 | 3300012204 | Vadose Zone Soil | QPDEIRLGVIVTILGAFLTRMAAIVRGTKGWRYI* |
| Ga0137370_109360611 | 3300012285 | Vadose Zone Soil | VWGLALALFLEWEGDRLAPDEITVGVIVTIVGAFLTRMVAIARGMKGWPYV* |
| Ga0137360_106394133 | 3300012361 | Vadose Zone Soil | RLEPDEIRLGVIVTILGAFLTRMVAIARGTKGWRYI* |
| Ga0150984_1183517903 | 3300012469 | Avena Fatua Rhizosphere | LAIFLEWEGARLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV* |
| Ga0137358_103963522 | 3300012582 | Vadose Zone Soil | LEWEGERLEPDEITIGVIVTIVGAFLTRMVAIARGMKGWPYV* |
| Ga0126369_110305291 | 3300012971 | Tropical Forest Soil | ALAVFLEWESERLGPDEITAGVIVTIVGAFLTRMVAIARGLKGWPYV* |
| Ga0126369_124710181 | 3300012971 | Tropical Forest Soil | PEIAVVWGLALALFLEWEGARLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYV* |
| Ga0126369_128373191 | 3300012971 | Tropical Forest Soil | RLQPDEIKLGVIVTILGAFLTRMVAIARGIKGWRYV* |
| Ga0164304_100810733 | 3300012986 | Soil | LAFAIFLEWEGARLQPEEIRLGVIVTILGVFLTRIVAIVRVAKGWSYV* |
| Ga0164306_104725752 | 3300012988 | Soil | LQPDEIKIGVIVTISAAFLIRMAAVVRGTKGWRFV* |
| Ga0163162_105155723 | 3300013306 | Switchgrass Rhizosphere | EWEGERLEPDEITIGVVVMIVGAFLTRMVAFARGMKGWPYV* |
| Ga0163163_115237081 | 3300014325 | Switchgrass Rhizosphere | RLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV* |
| Ga0163163_132228682 | 3300014325 | Switchgrass Rhizosphere | ALALALFFEWEGARLQTDEIRLAVIVTLVGAFLTRVVAITRGMKGWPYV* |
| Ga0157379_111099492 | 3300014968 | Switchgrass Rhizosphere | TRGSTIEPEEIRLGVIVTILGVFLTRIVAIARGAKGWSYV* |
| Ga0157376_112958992 | 3300014969 | Miscanthus Rhizosphere | LAFAIFLEWEGARLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV* |
| Ga0132258_102586201 | 3300015371 | Arabidopsis Rhizosphere | IFLEREGARLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV* |
| Ga0182036_110093262 | 3300016270 | Soil | WGLALALFLEWEGERLEPDEITLAVIVTILGVFLTRMVAIARGIKGWRYV |
| Ga0182033_111783892 | 3300016319 | Soil | LALFLEWEGERLQPDEIKLGVIVTILGAFLTRMVAIARGIKGWRYV |
| Ga0182032_104617152 | 3300016357 | Soil | LEWEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYV |
| Ga0182040_106620662 | 3300016387 | Soil | WGLALALFLEWEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYV |
| Ga0182040_119680761 | 3300016387 | Soil | PEIAAIWGLGLSLFLEWEGERLEPDEIRVGVIVTILGVFLTRMVAIGRGIKGWRYI |
| Ga0187782_101231343 | 3300017975 | Tropical Peatland | EWEGERLQPEEIRWGVIVAILGCFATRIVAILRGSKGWPYV |
| Ga0190274_124751192 | 3300018476 | Soil | AIFLEWEGARLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYVPCA |
| Ga0193700_10710221 | 3300019873 | Soil | AIFLEWEGERLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV |
| Ga0193701_11064071 | 3300019875 | Soil | LQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV |
| Ga0210407_100741741 | 3300020579 | Soil | LGLALFLEWEGERLEPDEITVGVIVTIVGAFLTRMVAIARGMKGWPYV |
| Ga0210403_103287692 | 3300020580 | Soil | GLALAVFLGWEGERLQPDEIKIGVIVTISAAFLIRMAAVVRGTKGWRFV |
| Ga0210399_102078941 | 3300020581 | Soil | LYPEVAAVCGLALAVFLGWEGERLQPDEIKIGVIVTISAAFLIRMVAVARGTKGWRFV |
| Ga0210408_108508982 | 3300021178 | Soil | MGWEGERLQPDEIKIGVIVTISAAFLIRMVAVARGMKGWRFV |
| Ga0213882_104117361 | 3300021362 | Exposed Rock | YPEIAAIWGLAFALFLEWEGERLQPEEIHWGVIVAILGCFLTRIAAIVRGWKGWPYA |
| Ga0210383_108678351 | 3300021407 | Soil | VWGLALAVFLGWEGDRLQPDEIKLGVVVVILGAFLTRLVAIARGAKGWRYV |
| Ga0210384_112175662 | 3300021432 | Soil | PEIAAVCGLALAVFLGWEGERLQPDEIKIGVIVTISAAFLIRMVAVARGMKGWRFV |
| Ga0210391_105375661 | 3300021433 | Soil | LGWEDDRLQPDEIKLGVVVVILGAFLTRLVAIARGAKGWRYV |
| Ga0210409_107925951 | 3300021559 | Soil | VFLGWEGERLQPDEIKIGVIVTISAAFLIRMVAVARGMKGWRFV |
| Ga0126371_104496603 | 3300021560 | Tropical Forest Soil | AIFLEWEGERLQPDEIKLGVIVTILGAFLTRMVAIARGIKGWRYV |
| Ga0126371_108399723 | 3300021560 | Tropical Forest Soil | EGERLQPDEIKLGVIVTILGVFLTRMVAIARGIKGWRYV |
| Ga0224564_11299291 | 3300024271 | Soil | WEGERLQPDEIKVGVIVTISAAFLIRMVAVARGMKGWRFV |
| Ga0207642_108127792 | 3300025899 | Miscanthus Rhizosphere | AVLSWEGERLQPDEIKIGVIVIIAAAFSIRMVAIARGMKGWRFV |
| Ga0207699_110502632 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GLAFAMFLQWEGGRLQPDEVRWGVIVTITGVFLTRVVAIVRGMKGWTYI |
| Ga0207693_102691591 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | IAGVWGLALAVFLGWEGDRLQPDEIKLGVVVVILGAFLTRLVAIARGAKGWRYV |
| Ga0207649_111127832 | 3300025920 | Corn Rhizosphere | EGERLQPDEIKIGVIVIIAAAFSIRMVAIARGMKGWRFV |
| Ga0207665_102917421 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | WGLALAVFLGWEGDRLQPDEIKLGVVVVILGAFLTRLVAIARGAKGWRYV |
| Ga0207661_103958701 | 3300025944 | Corn Rhizosphere | GARLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV |
| Ga0207677_105486641 | 3300026023 | Miscanthus Rhizosphere | LALAVLSWEGERLQPDEIKIGVIVIIAAAFSIRMVAIARGMKGWRFV |
| Ga0207639_114469811 | 3300026041 | Corn Rhizosphere | LFLEWEGERLQFDEIRAGVIVTIVGIFVTRIIAIMRDMKGWSYV |
| Ga0207675_1005144372 | 3300026118 | Switchgrass Rhizosphere | ARLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV |
| Ga0209647_11937181 | 3300026319 | Grasslands Soil | EGERLEPDEIRLGVIVTILGAFLTRMVAIARGMKGWRYV |
| Ga0208365_10251621 | 3300027070 | Forest Soil | LALAVFLGWEGERLQPDEIKIGVIVTISAAFLIRMAAVVRGTKGWRFV |
| Ga0208365_10264211 | 3300027070 | Forest Soil | SRDRRRFGLAFAVFLEWEGERLQPDEIRIAVIVTILGVFLTRIRAIARGMKGWRYI |
| Ga0209813_104667581 | 3300027866 | Populus Endosphere | EWEGERLEPDEIRLGVIVTILGVFLTRIFAIARGIKGWPYV |
| Ga0209465_104372542 | 3300027874 | Tropical Forest Soil | PEIAVVWGLALALFLEWEGERLQPDEITLAVIVTISGVFLTRMVAIARDIKGWRYV |
| Ga0209067_106178732 | 3300027898 | Watersheds | EIAAVCGLALAVFLGWEGERLQPDEIKIGVIVTISAAFLIRMAAVVRGTKGWRFV |
| Ga0209006_107790422 | 3300027908 | Forest Soil | VFLGWEGDRLQPDEIKLGVVVVILGAFLTRLVAIARGAKGWRYV |
| Ga0307285_100380023 | 3300028712 | Soil | PCSATTAWGLAFAIFLEWEGARLQPEEIRLGVIVTILGVFLTRIVAIARGAKGWSYV |
| Ga0307303_100316922 | 3300028713 | Soil | FLEWEGERLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV |
| Ga0307298_102416762 | 3300028717 | Soil | EGERLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV |
| Ga0307504_100810142 | 3300028792 | Soil | RLQPDEIKIGVIVTISVAFLIRMAAVARGMKGWRFV |
| Ga0307314_102905512 | 3300028872 | Soil | AIFLEWEGTRLQPEVIRLGVIVTILGVFLTRIVAIVRGAKGWSYV |
| Ga0307289_100788832 | 3300028875 | Soil | IFLEWEGERLQPEEIRLGVIVTILGVFLTRIVAIVRGAKGWSYV |
| Ga0307308_101949791 | 3300028884 | Soil | LALFLQWEGGRLQPEEILLAVIVTLLGAFLTRVVAIFRGMRGWAYA |
| Ga0308309_103526262 | 3300028906 | Soil | FLGWEGDRLQPDEIKLGVVVVILGAFLTRLVAIARGAKGWRYV |
| Ga0318538_103612141 | 3300031546 | Soil | LTLALFLEWEAERLEPDEIRLGVIVTILGAFLTRMVAITRGIKGWRYV |
| Ga0318538_108350911 | 3300031546 | Soil | IAVVWGLALALFLEWEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYA |
| Ga0318574_102147873 | 3300031680 | Soil | ALALFLEWEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYV |
| Ga0318560_101430793 | 3300031682 | Soil | LAFAAFLNWEGERLQADEVRIAVIVTILGVFLTRILAIARGLKAWRYI |
| Ga0318496_103482361 | 3300031713 | Soil | LEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYV |
| Ga0306918_101064693 | 3300031744 | Soil | LALALFLEWEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYV |
| Ga0318492_100770143 | 3300031748 | Soil | EWEGERLQPDEIKLGVIVTILGAFLTRMVAIARGIKGWRYV |
| Ga0307477_104916871 | 3300031753 | Hardwood Forest Soil | ALAVFLGWEGERLQPDEIKIGVIVTISTAFLIRMVAVARGTKGWRFV |
| Ga0318508_10363942 | 3300031780 | Soil | ALALFLEWEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYA |
| Ga0318547_104208481 | 3300031781 | Soil | GERLQPDEIKLGVIVTILGAFLTRMVAIARGIKGWRYV |
| Ga0318552_106840771 | 3300031782 | Soil | VWGLALASFLNWEGERLQADEVRIAVIVTILGVFLTRILAIARGLKAWRYI |
| Ga0318529_100802643 | 3300031792 | Soil | WGLALALFLEWEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWHYV |
| Ga0318523_101582593 | 3300031798 | Soil | EGERLQPDEIKLGVIVTILGAFLTRMIAIARGIKGWRYV |
| Ga0318497_108741452 | 3300031805 | Soil | LALFLEWEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYA |
| Ga0307473_100643481 | 3300031820 | Hardwood Forest Soil | YPEIAAVCGLALAVFLGWEGERLQPDEIKIGVIVTISAAFLIRMAAVVRGTKGWRFV |
| Ga0318517_102673161 | 3300031835 | Soil | LEWEGERLEPDEIRLGVIITILGAFLTRMVAIARGMKGWRYV |
| Ga0318511_101465833 | 3300031845 | Soil | VVWGLALALFLEWEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYV |
| Ga0318495_101412292 | 3300031860 | Soil | IAVVSGLALALFLEWEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYA |
| Ga0318522_102474022 | 3300031894 | Soil | VWGLALALFLEWEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYV |
| Ga0318520_109091782 | 3300031897 | Soil | SPSFGGLALALFLEWEGERLQPEEITVGVIVTILGAFLTRIVAIVRGMKGWQYI |
| Ga0306921_105151522 | 3300031912 | Soil | VWGLALAVFLGWESERLQPDEIRFGVIVVIVGAFLTRMVAIARGSKGWRYS |
| Ga0306921_119969122 | 3300031912 | Soil | ERLQPDEIWLGVVVTLAGAFLTRMAAVAFGLKGWPYG |
| Ga0310913_107328532 | 3300031945 | Soil | EGERLQPDEIKLGVIVTILGAFLTRMVAIARGIKGWRYV |
| Ga0318530_100938793 | 3300031959 | Soil | ALAIFLEWEGERLQPDEIKLGVIVTILGAFLTRMIAIARGIKGWRYV |
| Ga0318531_102122882 | 3300031981 | Soil | WEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYV |
| Ga0318507_102053592 | 3300032025 | Soil | EWEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYV |
| Ga0318545_102870642 | 3300032042 | Soil | LFLEWEGERLEPDEIRLAVIVTIMGAFLTRMAAIIRGMKGWRYI |
| Ga0318532_100553653 | 3300032051 | Soil | LALAIFLEWEGERLQPDEIKLGVIVTILGAFLTRMIAIARGIKGWRYV |
| Ga0318506_100550981 | 3300032052 | Soil | IAVVWGLALALFLEWEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWHYV |
| Ga0318575_105948872 | 3300032055 | Soil | FLEWEGERLQPEEITVGVIVTILGAFLTRIVAIVRGMKGWQYI |
| Ga0318513_105243471 | 3300032065 | Soil | EWEGERLQPDEIRIAVIVTILGVFLTRIAAIARGMKGWRYI |
| Ga0318518_107356762 | 3300032090 | Soil | PLCLFSEWEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYV |
| Ga0318577_106160021 | 3300032091 | Soil | ERLQPDEIKLGVIVTILGAFLTRMIAIARGIKGWRYV |
| Ga0306920_1000396388 | 3300032261 | Soil | GLALALFLEWEGERLQPEEITVGVIVTILGAFLTRIVAIVRGMKGWQYI |
| Ga0306920_1009536592 | 3300032261 | Soil | WEGERLEPDEIRLSVIVTILGVFLTRMVAIARGIKGWRYA |
| Ga0306920_1034428322 | 3300032261 | Soil | ERLKPDEIRLAVIVPIMGAFLTRMAAIIRGMKGWRYI |
| Ga0318519_110013001 | 3300033290 | Soil | AFLQWEGERLQSDEIRVAVIVTILGVFLTRIVAIARGMKGWRYI |
| Ga0326726_104899572 | 3300033433 | Peat Soil | LQPDEIKIGVIVTISAAFLIRMVAVARGTKGWRFV |
| ⦗Top⦘ |