NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055702

Metagenome / Metatranscriptome Family F055702

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055702
Family Type Metagenome / Metatranscriptome
Number of Sequences 138
Average Sequence Length 42 residues
Representative Sequence PVDEIGCFAVEPIPASPFRLRYRTADGADVLTGWITL
Number of Associated Samples 123
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.68 %
% of genes near scaffold ends (potentially truncated) 91.30 %
% of genes from short scaffolds (< 2000 bps) 87.68 %
Associated GOLD sequencing projects 119
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.232 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.261 % of family members)
Environment Ontology (ENVO) Unclassified
(28.986 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.029 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 12.31%    Coil/Unstructured: 87.69%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF12770CHAT 50.00
PF01042Ribonuc_L-PSP 5.80
PF00892EamA 5.80
PF00180Iso_dh 5.07
PF00082Peptidase_S8 2.17
PF00155Aminotran_1_2 2.17
PF01494FAD_binding_3 1.45
PF11199DUF2891 1.45
PF00248Aldo_ket_red 0.72
PF07992Pyr_redox_2 0.72
PF13977TetR_C_6 0.72
PF00583Acetyltransf_1 0.72
PF02630SCO1-SenC 0.72
PF04542Sigma70_r2 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 5.80
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 2.90
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.45
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 1.45
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 1.45
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.72
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.72
COG1225PeroxiredoxinPosttranslational modification, protein turnover, chaperones [O] 0.72
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.72
COG1999Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC familyPosttranslational modification, protein turnover, chaperones [O] 0.72
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.23 %
UnclassifiedrootN/A13.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q02GOVFEAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia513Open in IMG/M
2170459015|G14TP7Y01AV99TNot Available584Open in IMG/M
2170459024|GZRSKLJ02I9EDGNot Available547Open in IMG/M
2189573002|GZIGXIF01D5TV7All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia521Open in IMG/M
2189573002|GZIGXIF02FQLECNot Available528Open in IMG/M
2189573004|GZGWRS402HYPDEAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300000956|JGI10216J12902_113275955Not Available1439Open in IMG/M
3300004082|Ga0062384_100264562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1050Open in IMG/M
3300004092|Ga0062389_102710255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia661Open in IMG/M
3300004092|Ga0062389_103089364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia623Open in IMG/M
3300004463|Ga0063356_102253495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia830Open in IMG/M
3300005179|Ga0066684_10952191All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005436|Ga0070713_102335025Not Available517Open in IMG/M
3300005438|Ga0070701_10043732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2293Open in IMG/M
3300005440|Ga0070705_100059856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2256Open in IMG/M
3300005563|Ga0068855_100359481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1602Open in IMG/M
3300005577|Ga0068857_100849417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia873Open in IMG/M
3300006604|Ga0074060_10826042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia582Open in IMG/M
3300006804|Ga0079221_10469385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia806Open in IMG/M
3300006954|Ga0079219_10333171All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300006954|Ga0079219_10346656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales951Open in IMG/M
3300009098|Ga0105245_11993039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300009176|Ga0105242_10265659Not Available1552Open in IMG/M
3300009665|Ga0116135_1040555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1606Open in IMG/M
3300009683|Ga0116224_10475395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria595Open in IMG/M
3300009700|Ga0116217_10010136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia7895Open in IMG/M
3300010048|Ga0126373_12210763Not Available611Open in IMG/M
3300010359|Ga0126376_10409221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1225Open in IMG/M
3300010360|Ga0126372_10283546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1444Open in IMG/M
3300010361|Ga0126378_10310982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1680Open in IMG/M
3300010396|Ga0134126_12632752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria546Open in IMG/M
3300011120|Ga0150983_10966177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia551Open in IMG/M
3300012207|Ga0137381_11444721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300012494|Ga0157341_1006684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia900Open in IMG/M
3300013102|Ga0157371_10566337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria843Open in IMG/M
3300013105|Ga0157369_10922799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria895Open in IMG/M
3300013832|Ga0120132_1120114Not Available563Open in IMG/M
3300014157|Ga0134078_10302101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia689Open in IMG/M
3300015372|Ga0132256_100122948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2564Open in IMG/M
3300015372|Ga0132256_100314703Not Available1652Open in IMG/M
3300015373|Ga0132257_100316591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1878Open in IMG/M
3300016319|Ga0182033_12152573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300016341|Ga0182035_11282453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae656Open in IMG/M
3300017792|Ga0163161_10192662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1568Open in IMG/M
3300017932|Ga0187814_10350667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria570Open in IMG/M
3300017933|Ga0187801_10359629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300017942|Ga0187808_10006000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium4607Open in IMG/M
3300017946|Ga0187879_10183132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1177Open in IMG/M
3300017955|Ga0187817_10010723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5250Open in IMG/M
3300017970|Ga0187783_10034155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae3769Open in IMG/M
3300017970|Ga0187783_11372475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300017972|Ga0187781_10554351Not Available827Open in IMG/M
3300017975|Ga0187782_10018021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5144Open in IMG/M
3300018032|Ga0187788_10286550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus sabuli663Open in IMG/M
3300018034|Ga0187863_10569525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300018037|Ga0187883_10758618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300018482|Ga0066669_10548119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1007Open in IMG/M
3300020016|Ga0193696_1143236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300021171|Ga0210405_10732155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria762Open in IMG/M
3300021374|Ga0213881_10037086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2051Open in IMG/M
3300021374|Ga0213881_10449967Not Available582Open in IMG/M
3300021401|Ga0210393_10655607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae857Open in IMG/M
3300021478|Ga0210402_10161700All Organisms → cellular organisms → Bacteria2044Open in IMG/M
3300021478|Ga0210402_10294940Not Available1500Open in IMG/M
3300021560|Ga0126371_10980094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria987Open in IMG/M
3300024219|Ga0247665_1056309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300025944|Ga0207661_10337910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1357Open in IMG/M
3300026088|Ga0207641_10691810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1003Open in IMG/M
3300026089|Ga0207648_10067320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3123Open in IMG/M
3300027029|Ga0208731_1017426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae762Open in IMG/M
3300027775|Ga0209177_10284249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia624Open in IMG/M
3300027787|Ga0209074_10238520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia701Open in IMG/M
3300027874|Ga0209465_10622585All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300028379|Ga0268266_11231698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia723Open in IMG/M
3300028742|Ga0302220_10340860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300028755|Ga0307316_10043155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1502Open in IMG/M
3300028759|Ga0302224_10090958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1169Open in IMG/M
3300028806|Ga0302221_10317889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria678Open in IMG/M
3300028877|Ga0302235_10398558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300029951|Ga0311371_10166510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3342Open in IMG/M
3300030509|Ga0302183_10329709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300030618|Ga0311354_10032827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6217Open in IMG/M
3300030739|Ga0302311_10387197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria988Open in IMG/M
3300030741|Ga0265459_12839245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300030981|Ga0102770_10023334Not Available662Open in IMG/M
3300031090|Ga0265760_10255046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300031093|Ga0308197_10082778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria912Open in IMG/M
3300031233|Ga0302307_10244655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria921Open in IMG/M
3300031545|Ga0318541_10738624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300031546|Ga0318538_10465582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria685Open in IMG/M
3300031549|Ga0318571_10324702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300031572|Ga0318515_10283237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia889Open in IMG/M
3300031572|Ga0318515_10302791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria857Open in IMG/M
3300031640|Ga0318555_10423003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia722Open in IMG/M
3300031679|Ga0318561_10287931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria898Open in IMG/M
3300031680|Ga0318574_10844736All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300031681|Ga0318572_10658180Not Available624Open in IMG/M
3300031708|Ga0310686_110698668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria863Open in IMG/M
3300031713|Ga0318496_10508301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia666Open in IMG/M
3300031719|Ga0306917_10314547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1212Open in IMG/M
3300031719|Ga0306917_10508538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria946Open in IMG/M
3300031719|Ga0306917_10793018Not Available743Open in IMG/M
3300031736|Ga0318501_10401863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae740Open in IMG/M
3300031747|Ga0318502_10182908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1208Open in IMG/M
3300031751|Ga0318494_10188953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus1170Open in IMG/M
3300031765|Ga0318554_10597797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300031765|Ga0318554_10833473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales515Open in IMG/M
3300031770|Ga0318521_10329179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria903Open in IMG/M
3300031778|Ga0318498_10083047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1446Open in IMG/M
3300031778|Ga0318498_10451722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia568Open in IMG/M
3300031794|Ga0318503_10168640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria708Open in IMG/M
3300031795|Ga0318557_10287088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia755Open in IMG/M
3300031846|Ga0318512_10513774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300031860|Ga0318495_10067094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1597Open in IMG/M
3300031860|Ga0318495_10251817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria790Open in IMG/M
3300031912|Ga0306921_10772068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1100Open in IMG/M
3300031946|Ga0310910_10318269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1226Open in IMG/M
3300031947|Ga0310909_11308457All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300032001|Ga0306922_11604300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria647Open in IMG/M
3300032008|Ga0318562_10775872Not Available549Open in IMG/M
3300032059|Ga0318533_10469290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria922Open in IMG/M
3300032064|Ga0318510_10475402All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300032065|Ga0318513_10198588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia966Open in IMG/M
3300032066|Ga0318514_10750159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300032261|Ga0306920_101143782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1127Open in IMG/M
3300032770|Ga0335085_10208453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2387Open in IMG/M
3300032770|Ga0335085_10722361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Kocuria → unclassified Kocuria → Kocuria sp. UCD-OTCP1105Open in IMG/M
3300032828|Ga0335080_10578391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1184Open in IMG/M
3300032892|Ga0335081_10374918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1842Open in IMG/M
3300032893|Ga0335069_10417387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1572Open in IMG/M
3300032954|Ga0335083_10877608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii714Open in IMG/M
3300033134|Ga0335073_11692647Not Available598Open in IMG/M
3300033158|Ga0335077_10069983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4194Open in IMG/M
3300033158|Ga0335077_11733693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300033289|Ga0310914_11129664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria685Open in IMG/M
3300033290|Ga0318519_10833103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia568Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.26%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.52%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.62%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.62%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.62%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.90%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil2.90%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.17%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.17%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.17%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.45%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock1.45%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.45%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.45%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.45%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.72%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.72%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.72%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.72%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.72%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.72%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459015Litter degradation PV4EngineeredOpen in IMG/M
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012494Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610Host-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024219Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027029Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030981Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_066414202170459005Grass SoilAGVDSLGWFAIHPTPASPFRLRYRTSDGTDVLTGWITL
4PV_013114702170459015Switchgrass, Maize And Mischanthus LitterVDEIGCFSVDQIPDSPFRLRCRAADGTDVLTGWITI
FD1_043904902170459024Grass SoilVDEIGCFSVDPIPEHPVPGCDCRSADGIDVLTGWITI
FE1_002729702189573002Grass SoilVAAAVGVDSLGWFAIHPIPASPFRLRYRTTDGTDVLTGWITL
FE1_083223302189573002Grass SoilLETYTKAGLTTSPVDESGYFAVEPIPANPFRLRFHTSDGTDVVTGWVTL
FG2_084013302189573004Grass SoilGTSTETTVDEIGCFAVDPTPASPFRLRFRAADGTDVLTGWITL
JGI10216J12902_11327595513300000956SoilTTAVDEIGCFAVDPKPENSFRLRCRTADGTDVLTGWINL*
JGIcombinedJ26739_10102261723300002245Forest SoilEIDVTGCFSIEPIPESPFRLRCRTTDGLDVVTGWVTL*
Ga0062384_10026456213300004082Bog Forest SoilAAGVTTLPVDEIGGFVLDPKPASPFRLRFRALDGTDVLTGWVTL*
Ga0062389_10271025523300004092Bog Forest SoilTRAGATTTTPVDEIGCFAVDPIPASPFRLRYRTEGGTDVLTGWITL*
Ga0062389_10308936413300004092Bog Forest SoilGTIATTPVDEIGCFAVEPIPANPFRLRYRTGNDTDVLTGWITL*
Ga0063356_10225349513300004463Arabidopsis Thaliana RhizosphereGTRVTPVDEIGFFTVDPKPDGSFRLRCRTPDGADVMTGWINL*
Ga0066684_1095219123300005179SoilTVATVQADEVGCFLIRPVPAGPFRLRCRTADGSDILTGSITL*
Ga0070713_10233502523300005436Corn, Switchgrass And Miscanthus RhizosphereITTGVSTSPVDQIGYFAVKPIPASPFRLRFRTTDGIDVLTSWITL*
Ga0070701_1004373213300005438Corn, Switchgrass And Miscanthus RhizosphereGAGASTETMVDEIGCFAVDPTPASPFRLRFRAADGTDVLTGWITL*
Ga0070705_10005985613300005440Corn, Switchgrass And Miscanthus RhizosphereAQTGAGASTETTVDEIGCFAVDPTPASPFRLRFQAADGTDVLTGWITL*
Ga0068855_10035948113300005563Corn RhizosphereGAGASTETTVDEIGCFAVDPTPASPFRLRFRAVDGTDVLTGWITL*
Ga0068857_10084941723300005577Corn RhizosphereAGASTETMVDEIGCFAVDPTPASPFRLRFRAADGTDVLTGWITL*
Ga0070763_1081522923300005610SoilTDEIGCFSIQPIPPGPFRLRCRVAADIDVLTGWVTL*
Ga0074060_1082604223300006604SoilAEVDEIGRFTLDPSPDGPFRLRGRTADGADLLTRWITL*
Ga0079221_1046938513300006804Agricultural SoilVDEIGCFAVDPTPASPFRLRFRAADGTDVLTGWITL*
Ga0079219_1033317113300006954Agricultural SoilEVDEIGCFSVEPIPASPFRLRSSASDGTHVLTGWITI*
Ga0079219_1034665633300006954Agricultural SoilTVGVDSLGWFPIHPIPASPFRLRYHTSDGTDVLTGWITL*
Ga0105245_1199303913300009098Miscanthus RhizosphereTGAGASTETTVDEIGCFAVDPIPASPFRLRFRAADGTDVLTGWVTL*
Ga0105242_1026565923300009176Miscanthus RhizosphereTTVDEIGFFTVDPKPDGSFRLRCRTPDGADVMTGWINL*
Ga0116135_104055513300009665PeatlandSSPLDEIGCFTVTPIPASPFRLRCHTEDGTDVLTGWITM*
Ga0116224_1047539513300009683Peatlands SoilVDEIGCFAVDPIPDSPFRLRCRMADGTDVVTGWITL*
Ga0116217_1001013673300009700Peatlands SoilETHTRAGVTTLLVDEIGSFAVEPLPASPFRLRFLTTGGIDVVTGWITL*
Ga0126373_1221076313300010048Tropical Forest SoilRAGTLEAQTGAGASTETTVDEIGCFAVEPIPASPFRLRFRAADGLDVLTGWVTL*
Ga0126376_1040922113300010359Tropical Forest SoilVIDEAGGFSLGPLPASPFRLRCRTADGGDIVTGWITL*
Ga0126372_1028354623300010360Tropical Forest SoilDEIGCFVVEPIPDSPFRLRCRTDDGADMLTGWITL*
Ga0126378_1031098213300010361Tropical Forest SoilGLATLPVDESGYFAVEPIPASPFRLRFRTADGADVVTGWITL*
Ga0134126_1263275213300010396Terrestrial SoilDEIGCFAVDPTPASPFRLRFRAADGTDVLTGWITL*
Ga0150983_1096617723300011120Forest SoilVTTLAVDEIGGFVLDPKPASPFRLRFLALDGTDVLTGWVTL*
Ga0137381_1144472123300012207Vadose Zone SoilTTEVDEIGCFSVDPIPDSPFRLRGCASDGTHVLTGWITI*
Ga0157341_100668413300012494Arabidopsis RhizosphereASTETTVDEIGCFAVDPTPASPFRLRFRAADGTDVLTGWITL*
Ga0157371_1056633713300013102Corn RhizosphereEIGCFAVDPTPASPFRLRFRAADGTDVLTGWITL*
Ga0157369_1092279913300013105Corn RhizosphereQTGAGASTETTVDEIGCFAVDPTPASPFRLRFRAVDGTDVLTGWITL*
Ga0120132_112011423300013832PermafrostVDEIGCFSVDPIPDSPFRLRSGASDGTHVLTGWITI*
Ga0134078_1030210113300014157Grasslands SoilPSTETTVDEIGCFAVDPTPASPFRLHFRAVDGTDVLTGWITL*
Ga0132256_10012294813300015372Arabidopsis RhizosphereQTGAGASTESTVDEIGCFAVDPELASPFRLRFRAADGTDVLTGWITL*
Ga0132256_10031470333300015372Arabidopsis RhizosphereDEIGFFTVDPKPDGSFRLRCRTPDGADVMTGWINL*
Ga0132257_10031659113300015373Arabidopsis RhizosphereETTVDEIGCFAVDPTPASPFRLRFRAADGTDVLTGWITL*
Ga0182033_1215257313300016319SoilMSTTEVDEIGCFSVDPIPDSPFRLRCRSADGTDVLTGWVTI
Ga0182035_1128245313300016341SoilVTTAPVDEIGSFAVDPIPASPFRLRFRTTGGIDVLTGWITL
Ga0163161_1019266223300017792Switchgrass RhizosphereGAGASTETTVDEIGCFAVDPTPASPFRLRFRAADGTDVLTGWVTL
Ga0187814_1035066723300017932Freshwater SedimentAPVAERGCLSVDPSPSSAFRLRCRMEDGSDVLTGWLTL
Ga0187801_1035962923300017933Freshwater SedimentDEIGCFVVTPIPASPFRLRCRTEDGADVLTGWITL
Ga0187808_1000600013300017942Freshwater SedimentTSAGASTTTPVDEIGCFSVVPKPAGQFRLRCRTTDGTDVLTGWTTV
Ga0187879_1018313223300017946PeatlandSSPVNEIGCFAVTPIPVGPFRLRCHTEDGTDVLTRWITV
Ga0187817_1001072363300017955Freshwater SedimentAGTVETHTRAGVATSLVDEIGSFAVEPIPANPFRLRFRTTGGIDLVTGWITL
Ga0187783_1003415533300017970Tropical PeatlandLPVDDDIGSFVIEPIPASPFRLRCRMADGADVLTGWITLCPPT
Ga0187783_1137247513300017970Tropical PeatlandASPVDEIGCFAVDPIPASPFRLRYRTTDGTDVLTGWITL
Ga0187781_1055435133300017972Tropical PeatlandIPPGPGTLETHTATGVTTSPVDEIGCFTIEPIPPSPFRLRFRTTNTIDVLTGWITL
Ga0187782_1001802113300017975Tropical PeatlandPVDEIGCFVVEPKPASPFRLRFRATDGTDVLTGWVTL
Ga0187788_1028655023300018032Tropical PeatlandAGTLETYTKAGLTSSPVDESGYFAVEPIPDGSFRLRFHTSDGADVVTGWITL
Ga0187863_1056952523300018034PeatlandDEIGCFAIDPIPDGPFRLRCRTAAGSDVLTGWITL
Ga0187883_1075861813300018037PeatlandTTTPVDEIGCFAIDPIPDGPFRLRCRTADDTDVLTGWITL
Ga0066669_1054811923300018482Grasslands SoilDRLGWFPIHPIPASPFRLRYRTSGGTDVLTGWITL
Ga0193696_114323623300020016SoilTVDEIGLFTVDPKPDGSFRLRCRTPDGADVMTGWINL
Ga0210405_1073215523300021171SoilTSSPVDEIGCFVVDPIPSSPFRLRCRTEDGADVLTGWITL
Ga0213881_1003708623300021374Exposed RockDEVGCFAVEPIPATPFRLRARTADGADVMTGWVVL
Ga0213881_1044996713300021374Exposed RockTTEVDEVGCFAVEPIPATPFRLRARTADGADVMTGWVVL
Ga0210393_1065560713300021401SoilSTTEVDEIGCFSVETIPDCPFRLRCRTADGTDVLTGWITI
Ga0210402_1016170053300021478SoilTTEADEVGCFLIRPIPDSPFRLRFRTADGSDILTGSITL
Ga0210402_1029494023300021478SoilDALFVQVMPPQAGILETHTKAGLTTSPGDESGYFAVQPIPDSRFRLRFHTAGGTDVVTGWITL
Ga0126371_1098009433300021560Tropical Forest SoilYTKTGLATLPVDESGYFAVEPIPASPFRLRFRTADGADVVTGWITL
Ga0247665_105630913300024219SoilDSLGWFAIHPIPASPFRLRYRTTDGTDVLTGWITL
Ga0207661_1033791023300025944Corn RhizosphereVDEIGCFSVEPIPASPFRLRSNASDGTHVLTGWITI
Ga0207641_1069181013300026088Switchgrass RhizosphereSTETMVDEIGCFAVDPTPASPFRLRFRAADGTDVLTGWITL
Ga0207648_1006732013300026089Miscanthus RhizosphereSTETTVDEIGCFAVDPTPASPFRLRFRAVDGTDVLTGWITL
Ga0208731_101742613300027029Forest SoilLEVQTMAGTIATTPVDEIGCFAVEPIPASPFRLRCRTGHDTDVLTGWVTL
Ga0209177_1028424913300027775Agricultural SoilIQTRDRVAAAVGVDSLGWFAIHPIPASPFRLRYRTTDGTDVLTGWITL
Ga0209074_1023852023300027787Agricultural SoilTETTVDEIGCFAVDPTPASPFRLRFRAADGTDVLTGWITL
Ga0209465_1062258513300027874Tropical Forest SoilVETYTKAGLTTSPVDESGFFTVEPIPASAFRLRFHTVGGADVVTGWITL
Ga0268266_1123169823300028379Switchgrass RhizosphereDEIGCFSVDPIPESPFRLRCHTADGTHVLTGWITI
Ga0302220_1034086023300028742PalsaSPVDEIGCFSVAPIPASPFRLRCRTEDGADVLTGWITL
Ga0307316_1004315513300028755SoilVTPVDEIGFFTVDPKPHGSFRLRCRTPDGADVMTGWINL
Ga0302224_1009095813300028759PalsaDEIGCFAVTPIPASPFRLRCRTEDGTDVLTGWITL
Ga0302221_1031788913300028806PalsaVDEIGCFAVEPIPASPFRLRYRTADGADVLTGWITL
Ga0302235_1039855813300028877PalsaDEIGCFVIQPVPVGPFRLRCPTGAGIDVLTSWITL
Ga0311371_1016651043300029951PalsaTPVDEIGCFAIDPIPDGPFRLRCRTADDTDVLTGWITL
Ga0302183_1032970923300030509PalsaTLETQTRAGTTISTPVDEIGCFAVEPIPASPFRLRYRTADGADVLTGWITL
Ga0311354_1003282713300030618PalsaSSPVDEIGSFAVTPIPASPFRLRCRTEAGTDVLTRWITL
Ga0302311_1038719723300030739PalsaPVDEIGCFAVEPIPASPFRLRYRTADGADVLTGWITL
Ga0265459_1283924523300030741SoilFSIFCFAIDPIPDSPFRLRCRMASGVDVLTGWITL
Ga0102770_1002333423300030981SoilDEIGCFSVDPIPDSPFRLRSRASDGTHVLTGWITI
Ga0265760_1025504613300031090SoilAGTLETHTKAGVTTSPVNEIGCFALDPKPASPFRLRFRTTDGVDVVTGWITL
Ga0308197_1008277823300031093SoilVDEIGFFTVDPKPDGSFRLRCRTPDGADVMTGWINL
Ga0302307_1024465513300031233PalsaPVDEIGSFAVTPIPASPFRLRCRTEAGTDVLTRWITL
Ga0318541_1073862413300031545SoilTYTRTGLATLPVDESGYFAVEPIPASPFRLRFRTGGGADVVTGWITL
Ga0318538_1046558223300031546SoilDEVGCFLVEPIPNGPFRLRCLMNDGADVLTGWITL
Ga0318571_1032470213300031549SoilAGVTSSPVDEIGCFVVDPIPSSPFRLRCRTKDGADVLTGWITL
Ga0318515_1028323723300031572SoilDDIGCFAVEPKPESPFRMRLRTEGQPDVLTGWLTL
Ga0318515_1030279123300031572SoilVAATVGVDSLGWFPIHPIPASPFRLRYHTSDGTDVLTGWITL
Ga0318555_1042300323300031640SoilTYTKAGLTSSPVDESGYFAVEPIPAGSFRLRFHTSGGADVVTGWITL
Ga0318561_1028793123300031679SoilVSTSPVDEIGYFAVKPIPASPFRLRFRTADGIDVVTGWITL
Ga0318574_1084473613300031680SoilPGDESGYFAVEPIPDSPFRLRFQTTGETDVVTGWITL
Ga0318572_1065818013300031681SoilDESGYFAVEPIPASPFRLRFQTAGGGVDVVTGWITL
Ga0310686_11069866823300031708SoilLGQIIPPRAGTVETHITAGVSTSPVDQIRYFAVKPMPASPFRLRFRTTDGIDVLTDWITL
Ga0318496_1050830113300031713SoilDESGYFAVEPIPAGSFRLRFHTSGGADVVTGWITL
Ga0306917_1031454733300031719SoilTLETYTKAGLTSSPVDESGYFAVEPIPAGSFRLRFHTSGGADVVTGWITL
Ga0306917_1050853813300031719SoilAAATVPVDKLGWFPVNPIPASPFRLQYHATDGIDVLTGWITL
Ga0306917_1079301823300031719SoilQVIPPQAGTLETHTKAGLTTSRVDESGYFAVEPIPASPFRLRFQTADGGVDVVTGWITL
Ga0318501_1040186333300031736SoilDEIGSFAVDPIPASPFRLRFRTTGGIDVLTGWITL
Ga0318502_1018290823300031747SoilPQRGTAEVQSLAGHTSTVEVDEIGCFAVAPKPDSPFRMRLRTEGQPDVLTGWLTL
Ga0318494_1018895333300031751SoilVETHTTAGVTTAPVDEIGSFAVDPIPASPFRLRFRTTGGIDVLTGWITL
Ga0318554_1059779723300031765SoilITTGPIDEIGCFTVDPIPASPFRLRFRTSEGVDVVTGWITL
Ga0318554_1083347323300031765SoilKAGLTISPVDEIGCFVVEPVPAGPFRLRFRLADGIDVMTGWITP
Ga0318521_1032917933300031770SoilDGVAATVGVDSLGWFPIHPIPASPFRLRYHTADGTDVLTGWINL
Ga0318498_1008304713300031778SoilPPQAGTLETYTKAGLTSSPVDESGYFAVEPIPAGSFRLRFHTSGGADVVTGWITL
Ga0318498_1045172213300031778SoilFQAVAATVGVDSLGWFPIHPIPASPFRLRYHTADGTDVLTGWINL
Ga0318503_1016864013300031794SoilTLPVDESGYFAVEPIPASPFRLRFRTGGGADVVTGWITL
Ga0318557_1028708823300031795SoilDESGYFAVEPIPPNPFRLRFRTSDGADVVTGWITL
Ga0318512_1051377423300031846SoilVTSSPVDEIGCFVVDPIPSSPFRLRCRTKDGADVLTGWITL
Ga0318495_1006709423300031860SoilTTAGVTCSPVDEIGCFVVDPIPSSPFRLRCRTADGADVLTGWITL
Ga0318495_1025181713300031860SoilPVDEIGCFVVEPIPSSPFRLRCRTEDGADVLTGWITL
Ga0306921_1077206823300031912SoilAGVTCSPVDEIGCFVVDPIPSSPFRLRCRTADGADVLTGWITL
Ga0310910_1031826913300031946SoilATVPVDKLGWFPVNPIPASPFRLQYHATDGIDVLTGWITL
Ga0310909_1130845713300031947SoilSLLGQIIPPRAGTVETHVTAGVSTSPVDEIGYFAVKPIPASPFRLRFRTADGIDVVTGWITL
Ga0306922_1160430023300032001SoilKTGGITTGPIDEVGCFTVDPIPASPFRLRFRTSEGVDVVTGWITL
Ga0318562_1077587223300032008SoilPPQAGTLETYTRTGLATLPVDESGYFAVEPIPASPFRLRFRTGGGADVVTGWITL
Ga0318533_1046929013300032059SoilQIIPPRAGTLEVHTTAGVTSTPVDEIGCFTVEPIPASPFRLRFQTAGGGVDVVTGWITL
Ga0318510_1047540213300032064SoilETHVTAGVSTSPVDEIGYFAVKPIPASPFRLRFRTADGIDVVTGWITL
Ga0318513_1019858823300032065SoilTKAGLTSSPVDESGYFAVEPIPAGSFRLRFHTSGGADVVTGWITL
Ga0318514_1075015913300032066SoilVTSSPADEVGCFVVEPIPNGPFRLRCRMNDGADVLTGWITL
Ga0306920_10114378223300032261SoilVDEIGCFVVEPVPAGPFRLRFRLADGIDVMTGWITP
Ga0335085_1020845333300032770SoilVDSLGWFPVHPIPASPFRLRYHTPDGTDVLTGWITL
Ga0335085_1072236113300032770SoilAGLTTSPVDESGYFAVEPIPPNPFRLRFHTSDGADVVTGWITL
Ga0335080_1057839133300032828SoilTYTKAGLTTSPVDESGYFAVEPIPPNPFRLRFHTSDGADVVTGWITL
Ga0335081_1037491843300032892SoilTAAVAVDSLGWFPIHPIPASPFRLRYHADGTDVLTGWITL
Ga0335069_1041738733300032893SoilTSRVDESGYFAVEPIPASPFRLRFQTAGGVDVVTGWITL
Ga0335083_1087760813300032954SoilEVDEIGCFSVDPIPDCPFRLRCRTADGTDVLTGWITI
Ga0335073_1169264713300033134SoilMPPQAGILETHTKARLTSSPGDESGYFAVQPIPDSPFRLRFHATGGPDVVTGWITL
Ga0335077_1006998313300033158SoilGILETHTKAGLTTSPTDESGYFAVDPIPDSPFRLRFHTTGGTDVVTGWITL
Ga0335077_1173369313300033158SoilVDKIGCFAVDPIPDSPFRLRCRMASGADVLTGWITL
Ga0310914_1112966413300033289SoilGVAATVGVDSLGWFPIHPIPASPFRLRYHTADGTDVLTGWINL
Ga0318519_1083310323300033290SoilAGTLETYTKAGLTSSPVDESGYFAVEPIPAGSFRLRFHTSGGADVVTGWITL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.