| Basic Information | |
|---|---|
| Family ID | F055642 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSSRDLIERVRKALGDRYTVITAVGRGGNATLFGAFDAQG |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 61.59 % |
| % of genes near scaffold ends (potentially truncated) | 98.55 % |
| % of genes from short scaffolds (< 2000 bps) | 85.51 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.261 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.638 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.377 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.899 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.12% β-sheet: 23.53% Coil/Unstructured: 57.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF01661 | Macro | 31.88 |
| PF04389 | Peptidase_M28 | 4.35 |
| PF00144 | Beta-lactamase | 3.62 |
| PF00557 | Peptidase_M24 | 2.90 |
| PF12706 | Lactamase_B_2 | 2.90 |
| PF00300 | His_Phos_1 | 2.90 |
| PF00069 | Pkinase | 2.90 |
| PF12833 | HTH_18 | 2.17 |
| PF07705 | CARDB | 2.17 |
| PF01321 | Creatinase_N | 2.17 |
| PF11954 | DUF3471 | 1.45 |
| PF00313 | CSD | 0.72 |
| PF01344 | Kelch_1 | 0.72 |
| PF00753 | Lactamase_B | 0.72 |
| PF00015 | MCPsignal | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 31.88 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 11.59 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 3.62 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 3.62 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 3.62 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 2.17 |
| COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 1.45 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.99 % |
| Unclassified | root | N/A | 21.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZRSKLJ01D5DQ6 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
| 3300002561|JGI25384J37096_10050187 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1587 | Open in IMG/M |
| 3300002907|JGI25613J43889_10133565 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 634 | Open in IMG/M |
| 3300002908|JGI25382J43887_10040682 | All Organisms → cellular organisms → Bacteria | 2526 | Open in IMG/M |
| 3300002908|JGI25382J43887_10223174 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 888 | Open in IMG/M |
| 3300002908|JGI25382J43887_10387560 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005180|Ga0066685_10571915 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300005180|Ga0066685_11017502 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005439|Ga0070711_101780109 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 540 | Open in IMG/M |
| 3300005444|Ga0070694_101112317 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005450|Ga0066682_10099781 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1822 | Open in IMG/M |
| 3300005451|Ga0066681_10221251 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1139 | Open in IMG/M |
| 3300005518|Ga0070699_100664400 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 951 | Open in IMG/M |
| 3300005556|Ga0066707_10821575 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005557|Ga0066704_10653729 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 668 | Open in IMG/M |
| 3300005560|Ga0066670_10921240 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005586|Ga0066691_10328807 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 904 | Open in IMG/M |
| 3300005877|Ga0075296_1032778 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 505 | Open in IMG/M |
| 3300006046|Ga0066652_100301887 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
| 3300006755|Ga0079222_10026830 | All Organisms → cellular organisms → Bacteria | 2402 | Open in IMG/M |
| 3300006791|Ga0066653_10739688 | Not Available | 512 | Open in IMG/M |
| 3300006794|Ga0066658_10017451 | All Organisms → cellular organisms → Bacteria | 2753 | Open in IMG/M |
| 3300006797|Ga0066659_10836366 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 765 | Open in IMG/M |
| 3300006844|Ga0075428_100277085 | All Organisms → cellular organisms → Bacteria | 1805 | Open in IMG/M |
| 3300007004|Ga0079218_13065320 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300009012|Ga0066710_103561141 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 588 | Open in IMG/M |
| 3300009162|Ga0075423_10058049 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3999 | Open in IMG/M |
| 3300009792|Ga0126374_10221056 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300010136|Ga0127447_1042416 | Not Available | 555 | Open in IMG/M |
| 3300010304|Ga0134088_10005899 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 5111 | Open in IMG/M |
| 3300010323|Ga0134086_10027165 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1865 | Open in IMG/M |
| 3300010325|Ga0134064_10063351 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1155 | Open in IMG/M |
| 3300010326|Ga0134065_10239093 | Not Available | 673 | Open in IMG/M |
| 3300010333|Ga0134080_10091489 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1242 | Open in IMG/M |
| 3300010333|Ga0134080_10221756 | Not Available | 826 | Open in IMG/M |
| 3300010333|Ga0134080_10423684 | Not Available | 619 | Open in IMG/M |
| 3300010335|Ga0134063_10319759 | Not Available | 749 | Open in IMG/M |
| 3300010336|Ga0134071_10084632 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1489 | Open in IMG/M |
| 3300010336|Ga0134071_10526646 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 612 | Open in IMG/M |
| 3300010337|Ga0134062_10596389 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 568 | Open in IMG/M |
| 3300010364|Ga0134066_10011201 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1812 | Open in IMG/M |
| 3300010364|Ga0134066_10122734 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 783 | Open in IMG/M |
| 3300010373|Ga0134128_12405221 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 580 | Open in IMG/M |
| 3300011269|Ga0137392_10427042 | Not Available | 1100 | Open in IMG/M |
| 3300011271|Ga0137393_10224781 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1589 | Open in IMG/M |
| 3300011417|Ga0137326_1003382 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4096 | Open in IMG/M |
| 3300012096|Ga0137389_10387864 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1192 | Open in IMG/M |
| 3300012203|Ga0137399_10202229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1613 | Open in IMG/M |
| 3300012203|Ga0137399_10497043 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1023 | Open in IMG/M |
| 3300012203|Ga0137399_11744527 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 511 | Open in IMG/M |
| 3300012206|Ga0137380_11583704 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012207|Ga0137381_10205616 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1707 | Open in IMG/M |
| 3300012209|Ga0137379_11526929 | Not Available | 568 | Open in IMG/M |
| 3300012210|Ga0137378_10089909 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2807 | Open in IMG/M |
| 3300012210|Ga0137378_11177684 | Not Available | 682 | Open in IMG/M |
| 3300012349|Ga0137387_11263161 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 518 | Open in IMG/M |
| 3300012353|Ga0137367_10753229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 677 | Open in IMG/M |
| 3300012354|Ga0137366_10017466 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 5617 | Open in IMG/M |
| 3300012355|Ga0137369_10236403 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1390 | Open in IMG/M |
| 3300012359|Ga0137385_11463503 | Not Available | 547 | Open in IMG/M |
| 3300012360|Ga0137375_10057782 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4180 | Open in IMG/M |
| 3300012362|Ga0137361_11176954 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 689 | Open in IMG/M |
| 3300012363|Ga0137390_10919805 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300012380|Ga0134047_1232568 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1181 | Open in IMG/M |
| 3300012403|Ga0134049_1289910 | Not Available | 713 | Open in IMG/M |
| 3300012582|Ga0137358_10231322 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1259 | Open in IMG/M |
| 3300012683|Ga0137398_10255822 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1167 | Open in IMG/M |
| 3300012685|Ga0137397_10278478 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1246 | Open in IMG/M |
| 3300012917|Ga0137395_10572294 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 815 | Open in IMG/M |
| 3300012918|Ga0137396_10407560 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1008 | Open in IMG/M |
| 3300012922|Ga0137394_10155269 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1948 | Open in IMG/M |
| 3300012922|Ga0137394_10497009 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1036 | Open in IMG/M |
| 3300012922|Ga0137394_11240584 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 609 | Open in IMG/M |
| 3300012930|Ga0137407_10441137 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300012972|Ga0134077_10400441 | Not Available | 593 | Open in IMG/M |
| 3300012975|Ga0134110_10248895 | Not Available | 756 | Open in IMG/M |
| 3300012977|Ga0134087_10764264 | All Organisms → cellular organisms → Archaea | 519 | Open in IMG/M |
| 3300014154|Ga0134075_10031556 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2154 | Open in IMG/M |
| 3300014154|Ga0134075_10108725 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300014154|Ga0134075_10412605 | Not Available | 597 | Open in IMG/M |
| 3300015200|Ga0173480_11016449 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 547 | Open in IMG/M |
| 3300015245|Ga0137409_10231178 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1651 | Open in IMG/M |
| 3300015245|Ga0137409_10845298 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 750 | Open in IMG/M |
| 3300015357|Ga0134072_10021299 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1619 | Open in IMG/M |
| 3300015358|Ga0134089_10084885 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1197 | Open in IMG/M |
| 3300015359|Ga0134085_10607380 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300015371|Ga0132258_10026820 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 12758 | Open in IMG/M |
| 3300015372|Ga0132256_101522270 | Not Available | 779 | Open in IMG/M |
| 3300015373|Ga0132257_100000542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 29401 | Open in IMG/M |
| 3300017656|Ga0134112_10012434 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2832 | Open in IMG/M |
| 3300017656|Ga0134112_10254430 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 698 | Open in IMG/M |
| 3300017659|Ga0134083_10500069 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300018054|Ga0184621_10021207 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2000 | Open in IMG/M |
| 3300018063|Ga0184637_10120574 | Not Available | 1617 | Open in IMG/M |
| 3300018074|Ga0184640_10429136 | Not Available | 591 | Open in IMG/M |
| 3300018077|Ga0184633_10443361 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300018078|Ga0184612_10166976 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1149 | Open in IMG/M |
| 3300018468|Ga0066662_12180621 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300019255|Ga0184643_1365589 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4424 | Open in IMG/M |
| 3300020010|Ga0193749_1037696 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 935 | Open in IMG/M |
| 3300020015|Ga0193734_1046912 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 798 | Open in IMG/M |
| 3300021073|Ga0210378_10329342 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 571 | Open in IMG/M |
| 3300021086|Ga0179596_10629078 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 544 | Open in IMG/M |
| 3300022694|Ga0222623_10019207 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2546 | Open in IMG/M |
| 3300024310|Ga0247681_1058310 | Not Available | 599 | Open in IMG/M |
| 3300024330|Ga0137417_1189407 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1130 | Open in IMG/M |
| 3300025558|Ga0210139_1113746 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 555 | Open in IMG/M |
| 3300026298|Ga0209236_1301233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Nannocystaceae → Nannocystis → Nannocystis exedens | 518 | Open in IMG/M |
| 3300026301|Ga0209238_1269536 | Not Available | 510 | Open in IMG/M |
| 3300026307|Ga0209469_1102330 | Not Available | 782 | Open in IMG/M |
| 3300026307|Ga0209469_1150048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Nannocystaceae → Nannocystis → Nannocystis exedens | 514 | Open in IMG/M |
| 3300026310|Ga0209239_1104978 | Not Available | 1193 | Open in IMG/M |
| 3300026313|Ga0209761_1021963 | All Organisms → cellular organisms → Bacteria | 3976 | Open in IMG/M |
| 3300026325|Ga0209152_10169171 | Not Available | 822 | Open in IMG/M |
| 3300026331|Ga0209267_1016801 | All Organisms → cellular organisms → Bacteria | 3763 | Open in IMG/M |
| 3300026331|Ga0209267_1221532 | Not Available | 703 | Open in IMG/M |
| 3300026333|Ga0209158_1032480 | All Organisms → cellular organisms → Bacteria | 2246 | Open in IMG/M |
| 3300026333|Ga0209158_1138136 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300026334|Ga0209377_1058117 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1702 | Open in IMG/M |
| 3300026343|Ga0209159_1159746 | Not Available | 854 | Open in IMG/M |
| 3300026528|Ga0209378_1117763 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1146 | Open in IMG/M |
| 3300026542|Ga0209805_1109106 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1315 | Open in IMG/M |
| 3300026548|Ga0209161_10305188 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 764 | Open in IMG/M |
| 3300027882|Ga0209590_10602713 | Not Available | 706 | Open in IMG/M |
| 3300027882|Ga0209590_10878840 | Not Available | 565 | Open in IMG/M |
| 3300027950|Ga0209885_1034417 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 571 | Open in IMG/M |
| 3300028711|Ga0307293_10070880 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300028791|Ga0307290_10339496 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 550 | Open in IMG/M |
| 3300028828|Ga0307312_10617503 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 717 | Open in IMG/M |
| 3300031226|Ga0307497_10394782 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 659 | Open in IMG/M |
| 3300031716|Ga0310813_11215034 | Not Available | 694 | Open in IMG/M |
| 3300031720|Ga0307469_10993092 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 783 | Open in IMG/M |
| 3300031820|Ga0307473_11020804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 605 | Open in IMG/M |
| 3300032180|Ga0307471_101011013 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300032205|Ga0307472_101098648 | Not Available | 752 | Open in IMG/M |
| 3300033407|Ga0214472_11345956 | Not Available | 616 | Open in IMG/M |
| 3300033417|Ga0214471_10064136 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3007 | Open in IMG/M |
| 3300033500|Ga0326730_1021634 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 20.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.39% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.80% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.17% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.45% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.72% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.72% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.72% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005877 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_404 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025558 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027950 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_06020960 | 2170459024 | Grass Soil | VARDLIGRVREALGARYNVITSVGRGGNATLFGAYDQQGQKVAI |
| JGI25384J37096_100501872 | 3300002561 | Grasslands Soil | VARDLIGRVRQALGDRYTVITAVGRGGNAMLYGAFDKDGRK |
| JGI25613J43889_101335651 | 3300002907 | Grasslands Soil | MARELIGRVRQALGDRYNVITAVGRGGNATLYGALDKDGRK |
| JGI25382J43887_100406821 | 3300002908 | Grasslands Soil | VAGRDLIERVRKALGDRYNVITAVGRGGTAAIFGAYDAAGRKVAIKVL |
| JGI25382J43887_102231742 | 3300002908 | Grasslands Soil | MSTRDLIERVRKALGDRYNVITAVGRGGNACIFGAYDQAGQM* |
| JGI25382J43887_103875603 | 3300002908 | Grasslands Soil | VPGRELIERVRQALGDRYTVITAVGRGGNASIFGAHDPSGHQVAIK |
| Ga0066685_105719151 | 3300005180 | Soil | VPGRELIERVRQALGDRYTVITAVGRGGNASIFGAHDASGH |
| Ga0066685_110175021 | 3300005180 | Soil | VPGRELIERVRQALGDRYTVITAVGRGGNASIFGAHDPSG |
| Ga0070711_1017801092 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGRDLIERVRNALRDRYSVIAAVGRGGNASIFAGRDPSG |
| Ga0070694_1011123172 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MARDLIGRVRQALGDRYNVITQVGRGGNATLYGAYDKEGRKVA |
| Ga0066682_100997812 | 3300005450 | Soil | MAGRDILDRVRKALGDHYDVITAVGRGGAASIFGAYDKSGQRVAI |
| Ga0066681_102212511 | 3300005451 | Soil | MARPEILDRVRKALGDRYDVITAVGRGGTASIFGAYDKSG |
| Ga0070699_1006644001 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MARDLIGRVRQALGDRYNVITAVGRGGNATLYGAFDKDGRK |
| Ga0066707_108215751 | 3300005556 | Soil | MPGRDLIERVRKALGDRYTVLAAVGRGGNASIFAGRDPT |
| Ga0066704_106537292 | 3300005557 | Soil | VAGRDLIERVRKALGDRYNVITAVGRGGTAAIFGAYDAAGRKVAI |
| Ga0066670_109212402 | 3300005560 | Soil | MSSHDLIERVRKALADRYTVITAVGRGGNASIFGAYDQA |
| Ga0066691_103288071 | 3300005586 | Soil | MARPEILDRVRKALGNRYDVITAVGRGGTASIFGAYDKS |
| Ga0075296_10327782 | 3300005877 | Rice Paddy Soil | MPRRDLIERVRKALGDRYEIVTAVGRGGNASIFGAFDKARNR |
| Ga0066652_1003018874 | 3300006046 | Soil | VPGRELIERVRQALGDRYTVITAVGRGGNASIFGAH |
| Ga0079222_100268305 | 3300006755 | Agricultural Soil | MPGRDLIDRVRKALEDRYTDITPVGRGGNASIFGAHRADGT |
| Ga0066653_107396881 | 3300006791 | Soil | MPGRDLIERVRKALGDRYTVVTAAGRGGNASIFAGLDVAGEKVA |
| Ga0066658_100174515 | 3300006794 | Soil | MPGRDLIERVRKALRDRYSVTAAVGRGGNACIFSGRDASGADVAI |
| Ga0066659_108363661 | 3300006797 | Soil | MGRQDLIERVRKALGDRYTVITAVGRGGNASIFGAYDRAGQRVAIK |
| Ga0075428_1002770851 | 3300006844 | Populus Rhizosphere | MARLDLIERVRKALGDRYEVITAVGRGGNASIFGAFDKSG |
| Ga0079218_130653202 | 3300007004 | Agricultural Soil | MTGRDLLSRIKAALGDRYTVVATVGRGGNAMVYGAYDRTGHKVA |
| Ga0066710_1035611411 | 3300009012 | Grasslands Soil | LRSGTAYCGAVARDLIGRVRQALGDRYTVITAVGRGGNATPYGAFDKDGRRVAITVL |
| Ga0075423_100580494 | 3300009162 | Populus Rhizosphere | MARELIGRIQKALGDRYTVITAVGRGGNASIFGAFDQRGEKV |
| Ga0126374_102210562 | 3300009792 | Tropical Forest Soil | MPRRDLIERVRKALGDRYEVITAVGRGGNASIFGAFDKAGNRVAS* |
| Ga0127447_10424161 | 3300010136 | Grasslands Soil | VRELLGTRYTAITAVARGGNATLFGAYDQQGQQVA |
| Ga0134088_100058994 | 3300010304 | Grasslands Soil | MARELIGRVRQALGDRYNVITAVGRGGNATLYGAFDRDGR |
| Ga0134086_100271651 | 3300010323 | Grasslands Soil | MPSRDLIERVRKALGDRYTVITAVGRGGNACIFGAYDQVGQ |
| Ga0134064_100633512 | 3300010325 | Grasslands Soil | MARELIGRVRQALGDRYNVITAVGRGGNATLYGALDKD |
| Ga0134065_102390931 | 3300010326 | Grasslands Soil | MPGRDLIERVRRALGDRYTVLAAVGRGGNASIFAARDSS |
| Ga0134080_100914891 | 3300010333 | Grasslands Soil | MPSRDLIERVRKALGDRYTVITAVGRGGNASIFGAYDQAGQRVAIKV |
| Ga0134080_102217562 | 3300010333 | Grasslands Soil | MAGRDLIERVRKALGDRYTVLTAVGRGGNASIFAG |
| Ga0134080_104236841 | 3300010333 | Grasslands Soil | MPGRDLIERVRKALGDRYTVLTAVGRGGNASIFAGR |
| Ga0134063_103197592 | 3300010335 | Grasslands Soil | MPGRDLIERVRKALGDRYTVLAAVGRGGNASIFAGRDPTGAQVAI |
| Ga0134071_100846323 | 3300010336 | Grasslands Soil | MPRRDLIERVRKALGDRYTVLNAVGRGGNASIFAGQDH |
| Ga0134071_105266461 | 3300010336 | Grasslands Soil | MARELIGRVRQALGDRYNVITAVGRGGNATLYGAFDRDGRKVA |
| Ga0134062_105963891 | 3300010337 | Grasslands Soil | MSSRDLIERVRKALGDRYTVITAVGRGGNATLFGAFDARGQKVAIK |
| Ga0134066_100112014 | 3300010364 | Grasslands Soil | MPRRDLIERVRKALGDRYTVLNAVGRGGNASIFAGQDHSGTFVAIK |
| Ga0134066_101227341 | 3300010364 | Grasslands Soil | MPGRDLIERVRKALRDRYSVIAAVGRGGNACIFSGRDASGADVAIK |
| Ga0134128_124052212 | 3300010373 | Terrestrial Soil | MARELIGRIQKALGDRYTVITEVGRGGNATLYGAYDRDGRKVAI |
| Ga0137392_104270422 | 3300011269 | Vadose Zone Soil | VARDLIGRVRQALGARYTIITAVGRGGNATLYGAFDKDGRKVAIKVL |
| Ga0137393_102247814 | 3300011271 | Vadose Zone Soil | MPARDLIERVRKALGDRYTVLSAVGRGGNASIFAAK |
| Ga0137326_10033823 | 3300011417 | Soil | VARDLIERVRKALGDRYTVITAIGRGGNATLFGAFDPQAKKVAIKV |
| Ga0137389_103878641 | 3300012096 | Vadose Zone Soil | MARELIGRVRQALGDRYNVITAVGRGGNATLYGAF |
| Ga0137399_102022292 | 3300012203 | Vadose Zone Soil | MSSRDLIERVRKALGDRYTVITAVGRGGNATLFGAFDPQGQKVAI |
| Ga0137399_104970432 | 3300012203 | Vadose Zone Soil | MARDLIGRVRQALGDRYTAITPVGRGGNATLFGAFDKDGR |
| Ga0137399_117445272 | 3300012203 | Vadose Zone Soil | MARDLIGRVRQALGDRYTAITPVGRGGNATLFGAFDKDGRRVAIKV |
| Ga0137380_115837041 | 3300012206 | Vadose Zone Soil | LIGRVREALGARYTVITEVGRGGNATLYGAYDRDGRK |
| Ga0137381_102056161 | 3300012207 | Vadose Zone Soil | MTRDLIGRVRQALGDRYTVITAVGRGGNATLFGAF |
| Ga0137379_115269291 | 3300012209 | Vadose Zone Soil | MPGRDLIERVRKALGDRYTVLTAVGRGGNASIFAGRDPTGAQ |
| Ga0137378_100899093 | 3300012210 | Vadose Zone Soil | MTRDLIGRVREALGARYTVITEVGRGGNATLYGAYDRDGRKVAIKVLH |
| Ga0137378_111776841 | 3300012210 | Vadose Zone Soil | MPGRDLIERVRKALGDRYTVLTAVGRGGNASIFAG |
| Ga0137387_112631612 | 3300012349 | Vadose Zone Soil | LIGRVRQALGDRYTVITAVGRGGNAMLYGAFDKDGRKV |
| Ga0137367_107532291 | 3300012353 | Vadose Zone Soil | MARELIGRVREALGDRYTVITEVGRGGNATLFGAFDKDGRKVA |
| Ga0137366_100174664 | 3300012354 | Vadose Zone Soil | MARELIGRVRQALGDRYNVITAVGRGGNATLYGAFDRD |
| Ga0137369_102364031 | 3300012355 | Vadose Zone Soil | VVLAHDLIERVRKALGDRYTVITAVGRGGNATLFGAYDPQGQRVVGAEQR |
| Ga0137385_114635032 | 3300012359 | Vadose Zone Soil | MAGRDLIERVRKALGSRYTDITPVGRGGNASIFGAHLPDGAD |
| Ga0137375_100577821 | 3300012360 | Vadose Zone Soil | MSRDLIGRVRQALGDRYTVITAVGRGGNATLFGAFDKDGQ |
| Ga0137361_111769541 | 3300012362 | Vadose Zone Soil | VARDLIGRVRQALGDRYTVITAVGRGGNATLYGAFDKDGRR |
| Ga0137390_109198052 | 3300012363 | Vadose Zone Soil | MARELIGRVRQALGDRYNVITAVGRGGNATLYGAFDKDGR |
| Ga0134047_12325682 | 3300012380 | Grasslands Soil | MTRDLIGRVRQALGGRYTVITAVGGGGNATLFGAFDKDGQRVAI |
| Ga0134049_12899101 | 3300012403 | Grasslands Soil | MPGRDLIERVRKALGDRYTVLTAVCRGGNASIFAGPDPT |
| Ga0137358_102313221 | 3300012582 | Vadose Zone Soil | MARELIGRVRQALGDRYNVITAVGRGGNATLYGAFDKDGRKVAIKVL |
| Ga0137398_102558222 | 3300012683 | Vadose Zone Soil | MPGRDLIERVRKALGDRYTVLSAVGRGGNASIFSGRDPSGA |
| Ga0137397_102784781 | 3300012685 | Vadose Zone Soil | MARDLIGRVCKALGDRYTAITPVGRGGNATLFGAFDKDGRRVAIKVL |
| Ga0137395_105722941 | 3300012917 | Vadose Zone Soil | MMQRDLLARVRQLLGDRYTAITAVGRGGNASIFGAQEASGRQVAIKV |
| Ga0137396_104075602 | 3300012918 | Vadose Zone Soil | MTGRDLIERVRKALGDRYTVLTAVGRGGNASIFAAKD |
| Ga0137394_101552694 | 3300012922 | Vadose Zone Soil | MPARDLIERVRKALGDRYTVLAAVGRGGNASIFAAKD |
| Ga0137394_104970092 | 3300012922 | Vadose Zone Soil | MARDLIGRVRQALGDRYTAITPVGRGGNATLFGAF |
| Ga0137394_112405841 | 3300012922 | Vadose Zone Soil | MPGRDLIERVRKALGDRYTVLAAVGRGGNASIFAAKDSSG |
| Ga0137407_104411373 | 3300012930 | Vadose Zone Soil | MPARDLIERVRKALGDRYTVLAAVGRGGNASIFAA |
| Ga0134077_104004412 | 3300012972 | Grasslands Soil | MAGRDLIERVRKALGSRYTDITPVGRGGNASIFGAHLP |
| Ga0134110_102488951 | 3300012975 | Grasslands Soil | MPTRDLIERVRKALGDRYTVITAVGRGGNACIFGAYDQAGQKVAI |
| Ga0134087_107642642 | 3300012977 | Grasslands Soil | MSSHDLIERVRKALGDRYTVITAVGRGGNASIFGAYDQS |
| Ga0134075_100315565 | 3300014154 | Grasslands Soil | MPGRELIERVREALRDRYTVISAIGRGGNAAIFGA |
| Ga0134075_101087251 | 3300014154 | Grasslands Soil | MPGRDLIERVRQALGDRYTAITAVGRGGNASIFRAYDDAGADVAIKV |
| Ga0134075_104126052 | 3300014154 | Grasslands Soil | MARPEILDRVRKALGDRYQVITAVGRGGNASIFGAYDSGGQ |
| Ga0173480_110164492 | 3300015200 | Soil | VARDLIKRVQEALGARYHVITAIGRGGNATLFGAFDPQGGKVAIKVLHPE |
| Ga0137409_102311782 | 3300015245 | Vadose Zone Soil | MARDLIGRLRQALGDRYNVITAVGRGGNATLYGAFDKDGRRVAI |
| Ga0137409_108452981 | 3300015245 | Vadose Zone Soil | MPGRDLIERVRKALGDRYTVLAAVGRGGNASIFAAKDSSGA |
| Ga0134072_100212991 | 3300015357 | Grasslands Soil | MSSRDLIERVRKALGDRYTVITAVGRGGNASIFGAYDQAGQRVAIKV |
| Ga0134089_100848851 | 3300015358 | Grasslands Soil | VARDLIGRVRQALGDRYNVITEVGRGGNATLYGAFDKDQR |
| Ga0134085_106073801 | 3300015359 | Grasslands Soil | MAGRDILDRVRKALGDHYDVITAVGRGGAASIFGA |
| Ga0132258_1002682011 | 3300015371 | Arabidopsis Rhizosphere | MARELINRVRQALSERYNVITEVARGGNATLYGALDKEGHKVAIKVL |
| Ga0132256_1015222701 | 3300015372 | Arabidopsis Rhizosphere | LPRRDLIERVRKALGDRYEVITAVGRGGNASIFGAFDKAGNR |
| Ga0132257_10000054227 | 3300015373 | Arabidopsis Rhizosphere | MARELINRVRQALSERYNVITEVARGGNATLYGALDKEGHKVAIKVLH |
| Ga0134112_100124341 | 3300017656 | Grasslands Soil | MPARDLIERVRKALGDRYTVLNAVGRGGNASIFAAKDASGAH |
| Ga0134112_102544301 | 3300017656 | Grasslands Soil | MPARDLIERVRKALGDRYTVLAAVGRGGNASIFAAKDSS |
| Ga0134083_105000691 | 3300017659 | Grasslands Soil | MPGRDLIERVRQALGDRYTAITAVGRGGNASIFRAYDDAGADVAIK |
| Ga0184621_100212072 | 3300018054 | Groundwater Sediment | MSSRDLIERVRKALGDRYTVITAVARGGNATLFGAFDAQGQKVAIKVL |
| Ga0184637_101205744 | 3300018063 | Groundwater Sediment | MLRRDLIERVRKALGDRYEVITAVGRGGNASIFGAFDRAG |
| Ga0184640_104291362 | 3300018074 | Groundwater Sediment | MLRRDLIERVRKALGDRYEVITAVGRGGNASIFGAF |
| Ga0184633_104433612 | 3300018077 | Groundwater Sediment | VVLARDLIGRVRQALGDRYTVITAVGRGGNATLFGAFDKDNQKVAI |
| Ga0184612_101669761 | 3300018078 | Groundwater Sediment | VREALGGRYNVITAVGRGGNATLFGALDAQGQKVAIK |
| Ga0066662_121806212 | 3300018468 | Grasslands Soil | VPGRELIERVRQALGDRYTVITAVGRGGNASIFGAHD |
| Ga0184643_13655891 | 3300019255 | Groundwater Sediment | VVLAHDLIERVRKALGERYTVITAVGRGGNATLFGAYDPQ |
| Ga0193749_10376961 | 3300020010 | Soil | MSSRDLIERVRKALGDRYTVITAVGRGGNATLFGAFDPQGQKVAIK |
| Ga0193734_10469121 | 3300020015 | Soil | MSSRDLIERVRKALGDRYTVITAVGRGGNATLFGAFDPQGQ |
| Ga0210378_103293422 | 3300021073 | Groundwater Sediment | VARDLLKRVQEALGARYNVITAVGRGGNATLFGAVDS |
| Ga0179596_106290781 | 3300021086 | Vadose Zone Soil | VARDLIGRVRQALGDRYTVITAVGRGGNATLYGAYDKDGRQV |
| Ga0222623_100192072 | 3300022694 | Groundwater Sediment | MSSRDLIERVRKALGDRYTVITAVGRGGNATLFGA |
| Ga0247681_10583102 | 3300024310 | Soil | MPRRDLIERVRKALGDRYEVITAVGRGGNASIFGAFDKAGNRV |
| Ga0137417_11894072 | 3300024330 | Vadose Zone Soil | MARELIGRVRQALGDRYNVITAVGRGGNATLYGALDKDGRKVA |
| Ga0210139_11137461 | 3300025558 | Natural And Restored Wetlands | MPERELIDRVRKALGDRYTVITSIGRGGNACIFGAYDQSGQRVA |
| Ga0209236_13012332 | 3300026298 | Grasslands Soil | MPGRDLIERVRKALGDRYTVLTAVGRGGNASIFAARDSSGTHVAI |
| Ga0209238_12695362 | 3300026301 | Grasslands Soil | MTTRDLIERVRKALGDRYTVITAVGRGGNACIFGAYD |
| Ga0209469_11023302 | 3300026307 | Soil | MPGRELIERVREALRDRYTVISAIGRGGNAAIFGAAD |
| Ga0209469_11500482 | 3300026307 | Soil | MPGRDLIERVRKALGDRYTVLTAVGRGGNASIFAARD |
| Ga0209239_11049783 | 3300026310 | Grasslands Soil | VPGRELIERVRQALGDRYTVITAVGRGGNASIFGAHDPSGH |
| Ga0209761_10219631 | 3300026313 | Grasslands Soil | MPARDLIERVRKALGDRYTVLNAVGRGGNASIFAAKDAS |
| Ga0209152_101691711 | 3300026325 | Soil | MPGRDLIERVRKALGDRYTVLTAVGRGGNASIFAGRDPTGAQVAIKVL |
| Ga0209267_10168011 | 3300026331 | Soil | MSTRDLIERVRKALGDRYNVITAVGRGGNACIFGAYDQAGQKVAIKV |
| Ga0209267_12215322 | 3300026331 | Soil | MSGRDLIERVRKALRDRYSVIAAVGRGGNACIFAGRDTSGADVA |
| Ga0209158_10324801 | 3300026333 | Soil | MPGRDLIERVRKALGDRYTVLAAVGRGGNASIFAGRDPTGA |
| Ga0209158_11381361 | 3300026333 | Soil | MARPEILDRVRKALGDRYDVITAVGRGGTASIFGAYDK |
| Ga0209377_10581171 | 3300026334 | Soil | MPGRDLIERVRKALGDRYTVLTAVGRGGNASIFAARDS |
| Ga0209159_11597463 | 3300026343 | Soil | MAGRDLIERVRKALGDRYTVLTAVGRGGNASIFAGRDPTGAQV |
| Ga0209378_11177634 | 3300026528 | Soil | MPGRDLIERVRKALGDRYTVLTAVGRGGNASIFAGRDPTGA |
| Ga0209805_11091061 | 3300026542 | Soil | MPGRDLIERVRKALGDRYTVLTAVGRGGNASIFAA |
| Ga0209161_103051881 | 3300026548 | Soil | MARELIGRVRQALGDRYNVITAVGRGGNATLYGAFDMDGRRVAI |
| Ga0209590_106027131 | 3300027882 | Vadose Zone Soil | MPGRDLIERVRKALGDRYTVLSAVGRGGNASIFSGRDP |
| Ga0209590_108788401 | 3300027882 | Vadose Zone Soil | MSSRDMIERVRKALGDRYTVITAVGRGGNASIFGA |
| Ga0209885_10344171 | 3300027950 | Groundwater Sand | VARDLLKRVQEALGARYNVITAVGRGGNATLFGAFDSQGHK |
| Ga0307293_100708801 | 3300028711 | Soil | VVLAHDLIERVRKALGDRYTVITAVGRGGNATLFGAFDPQGQRVA |
| Ga0307290_103394961 | 3300028791 | Soil | MSSRDLIERVRKALGDRYTVITAVGRGGNATLFGAFDAQG |
| Ga0307312_106175031 | 3300028828 | Soil | MSSRDLIERVRKALGDRYTVITAVGRGGNATLFGAFDPQGQRVAIKVL |
| Ga0307497_103947821 | 3300031226 | Soil | MARELIGRVRQALASRYDVIKEVARGGNATLYGALDK |
| Ga0310813_112150342 | 3300031716 | Soil | LPRRDLIDRVRKALGDRYEVITAVGRGGNASIVGAFDKAGNR |
| Ga0307469_109930923 | 3300031720 | Hardwood Forest Soil | MPGRELIERVREALGGRYRVITAIGRGGNAAIFGASDEAGRPVAIKVL |
| Ga0307473_110208041 | 3300031820 | Hardwood Forest Soil | MPRRDLIERVRKALGDRYEVITAVGRGGNASIFGAFDKA |
| Ga0307471_1010110132 | 3300032180 | Hardwood Forest Soil | MARLDLIERVRKALGDRYEVITAVGRGGNASIFGAFDKSGNRVAIK |
| Ga0307472_1010986481 | 3300032205 | Hardwood Forest Soil | MPGRDLIERVRKALGDRYTVLTAVGRGGNASIFAGRDPSG |
| Ga0214472_113459562 | 3300033407 | Soil | MSRRDLIERVRKALGDRYEVITAVGRGGNASIFGAFDRAGNRVAIK |
| Ga0214471_100641363 | 3300033417 | Soil | MAQDLIERVRAVLGHRYTVITAVGRGGNASIFGAFDRNGGKVAIKVLH |
| Ga0326730_10216343 | 3300033500 | Peat Soil | MPRRDLIERVRKALGDRYEVITAVGRGGNASIFGAFDKDR |
| ⦗Top⦘ |