NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F055593

Metagenome Family F055593

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055593
Family Type Metagenome
Number of Sequences 138
Average Sequence Length 52 residues
Representative Sequence AVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD
Number of Associated Samples 115
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.17 %
% of genes near scaffold ends (potentially truncated) 95.65 %
% of genes from short scaffolds (< 2000 bps) 91.30 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.826 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(20.290 % of family members)
Environment Ontology (ENVO) Unclassified
(31.884 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.348 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.33%    β-sheet: 0.00%    Coil/Unstructured: 82.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.16
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF11906DUF3426 8.70
PF05685Uma2 6.52
PF030614HBT 5.07
PF01451LMWPc 3.62
PF00343Phosphorylase 1.45
PF13460NAD_binding_10 1.45
PF13561adh_short_C2 1.45
PF01850PIN 1.45
PF00171Aldedh 1.45
PF13517FG-GAP_3 0.72
PF00378ECH_1 0.72
PF00012HSP70 0.72
PF13426PAS_9 0.72
PF00873ACR_tran 0.72
PF00106adh_short 0.72
PF08241Methyltransf_11 0.72
PF00535Glycos_transf_2 0.72
PF00883Peptidase_M17 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 6.52
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 1.45
COG0058Glucan phosphorylaseCarbohydrate transport and metabolism [G] 1.45
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 1.45
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 1.45
COG0260Leucyl aminopeptidaseAmino acid transport and metabolism [E] 0.72
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.83 %
UnclassifiedrootN/A2.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101952158All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium571Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101953107All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium990Open in IMG/M
3300000955|JGI1027J12803_103817542All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300004643|Ga0062591_101682427All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium643Open in IMG/M
3300004778|Ga0062383_10363376All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium706Open in IMG/M
3300005166|Ga0066674_10246588All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300005171|Ga0066677_10276292All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria958Open in IMG/M
3300005172|Ga0066683_10000287All Organisms → cellular organisms → Bacteria14508Open in IMG/M
3300005177|Ga0066690_10561222All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium764Open in IMG/M
3300005180|Ga0066685_10682767All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium705Open in IMG/M
3300005187|Ga0066675_10684836All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300005332|Ga0066388_103082734All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium851Open in IMG/M
3300005332|Ga0066388_103883498All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium762Open in IMG/M
3300005332|Ga0066388_108318965All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300005333|Ga0070677_10510722Not Available653Open in IMG/M
3300005335|Ga0070666_11043899All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium607Open in IMG/M
3300005338|Ga0068868_102113693All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300005441|Ga0070700_101427921All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium586Open in IMG/M
3300005447|Ga0066689_10836002All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium571Open in IMG/M
3300005451|Ga0066681_10962227All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300005457|Ga0070662_100898360All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium756Open in IMG/M
3300005467|Ga0070706_100047427All Organisms → cellular organisms → Bacteria3964Open in IMG/M
3300005467|Ga0070706_100312805All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1465Open in IMG/M
3300005467|Ga0070706_100935786All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300005468|Ga0070707_100755216All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium936Open in IMG/M
3300005468|Ga0070707_102286781All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria508Open in IMG/M
3300005545|Ga0070695_101617003All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium541Open in IMG/M
3300005549|Ga0070704_100872021All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium808Open in IMG/M
3300005553|Ga0066695_10147925All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1462Open in IMG/M
3300005555|Ga0066692_10687477All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium635Open in IMG/M
3300005764|Ga0066903_104299261All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium761Open in IMG/M
3300005764|Ga0066903_105627427All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium659Open in IMG/M
3300005764|Ga0066903_106094492All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium631Open in IMG/M
3300006046|Ga0066652_102072379All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300006796|Ga0066665_10786365All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium751Open in IMG/M
3300006796|Ga0066665_11538214All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300006797|Ga0066659_10316794All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1197Open in IMG/M
3300006797|Ga0066659_11109547All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium661Open in IMG/M
3300006804|Ga0079221_11381835All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium559Open in IMG/M
3300006806|Ga0079220_10521090All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium819Open in IMG/M
3300006852|Ga0075433_11802091All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium526Open in IMG/M
3300006854|Ga0075425_100133082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2843Open in IMG/M
3300006903|Ga0075426_10748480All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium734Open in IMG/M
3300006904|Ga0075424_100489251All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1313Open in IMG/M
3300007255|Ga0099791_10453081All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium621Open in IMG/M
3300009012|Ga0066710_100113236All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3671Open in IMG/M
3300009038|Ga0099829_11079976All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium665Open in IMG/M
3300009087|Ga0105107_10901535All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300009089|Ga0099828_10240898All Organisms → cellular organisms → Bacteria1620Open in IMG/M
3300009094|Ga0111539_11458155All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium794Open in IMG/M
3300009101|Ga0105247_11050507All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300009137|Ga0066709_103936046All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium540Open in IMG/M
3300009137|Ga0066709_104207419All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300009792|Ga0126374_10869207All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium696Open in IMG/M
3300010043|Ga0126380_10447071All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium976Open in IMG/M
3300010046|Ga0126384_11089389All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium732Open in IMG/M
3300010046|Ga0126384_12360323All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300010304|Ga0134088_10315466All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium756Open in IMG/M
3300010304|Ga0134088_10357748All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium709Open in IMG/M
3300010320|Ga0134109_10373932All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M
3300010325|Ga0134064_10410069All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300010333|Ga0134080_10261476All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium766Open in IMG/M
3300010333|Ga0134080_10557115All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300010335|Ga0134063_10327270All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium741Open in IMG/M
3300010359|Ga0126376_11722809All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium662Open in IMG/M
3300010361|Ga0126378_13451435All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300010362|Ga0126377_11977940All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium659Open in IMG/M
3300010362|Ga0126377_12742169All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium567Open in IMG/M
3300010397|Ga0134124_10022246All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium5208Open in IMG/M
3300010399|Ga0134127_11738804All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium699Open in IMG/M
3300010400|Ga0134122_10372076All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1252Open in IMG/M
3300010403|Ga0134123_10411320All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1244Open in IMG/M
3300012096|Ga0137389_10331287All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1293Open in IMG/M
3300012198|Ga0137364_10566238All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium855Open in IMG/M
3300012904|Ga0157282_10044237All Organisms → cellular organisms → Bacteria → Proteobacteria1059Open in IMG/M
3300012918|Ga0137396_10860449All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium666Open in IMG/M
3300012923|Ga0137359_11203652All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300012930|Ga0137407_10349006All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1362Open in IMG/M
3300012930|Ga0137407_11313889All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium687Open in IMG/M
3300012931|Ga0153915_12914753All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium558Open in IMG/M
3300012957|Ga0164303_10419681All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium832Open in IMG/M
3300012971|Ga0126369_11116141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium878Open in IMG/M
3300012972|Ga0134077_10038115All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1736Open in IMG/M
3300014154|Ga0134075_10552970All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium519Open in IMG/M
3300014264|Ga0075308_1129255Not Available565Open in IMG/M
3300014326|Ga0157380_11723825All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium684Open in IMG/M
3300015374|Ga0132255_105439780All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium539Open in IMG/M
3300016357|Ga0182032_11079658All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium688Open in IMG/M
3300017656|Ga0134112_10401892All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium566Open in IMG/M
3300017657|Ga0134074_1025151All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1976Open in IMG/M
3300017657|Ga0134074_1049647All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1418Open in IMG/M
3300017657|Ga0134074_1339954All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300018058|Ga0187766_10969997All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300018433|Ga0066667_11868465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300018482|Ga0066669_11892575All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300019360|Ga0187894_10172652All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1078Open in IMG/M
3300019458|Ga0187892_10490058All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium567Open in IMG/M
3300022563|Ga0212128_10676309All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium620Open in IMG/M
3300025903|Ga0207680_11080591All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300025910|Ga0207684_11020269All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium691Open in IMG/M
3300025910|Ga0207684_11615406All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria524Open in IMG/M
3300025915|Ga0207693_10393366All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1084Open in IMG/M
3300025922|Ga0207646_11395064All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria609Open in IMG/M
3300025922|Ga0207646_11757677All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300025940|Ga0207691_10959659All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium714Open in IMG/M
3300026075|Ga0207708_11740927All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium547Open in IMG/M
3300026088|Ga0207641_11956160All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium588Open in IMG/M
3300026298|Ga0209236_1051143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2059Open in IMG/M
3300026307|Ga0209469_1020423All Organisms → cellular organisms → Bacteria2331Open in IMG/M
3300026307|Ga0209469_1121747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium636Open in IMG/M
3300026314|Ga0209268_1021409All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2353Open in IMG/M
3300026326|Ga0209801_1270124All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium624Open in IMG/M
3300026328|Ga0209802_1017860All Organisms → cellular organisms → Bacteria3970Open in IMG/M
3300026335|Ga0209804_1324705All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium518Open in IMG/M
3300026523|Ga0209808_1262505All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium551Open in IMG/M
3300026524|Ga0209690_1093128All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1247Open in IMG/M
3300026528|Ga0209378_1011542All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium5307Open in IMG/M
3300026548|Ga0209161_10327855All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium704Open in IMG/M
3300027748|Ga0209689_1338522All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300027846|Ga0209180_10372922All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium811Open in IMG/M
3300027875|Ga0209283_10383976All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium917Open in IMG/M
3300028379|Ga0268266_10796581Not Available913Open in IMG/M
3300031538|Ga0310888_10898438All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium553Open in IMG/M
3300031544|Ga0318534_10794341All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300031720|Ga0307469_10771714All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium879Open in IMG/M
3300031720|Ga0307469_12523445All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300031740|Ga0307468_101560358All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300031835|Ga0318517_10296326All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium731Open in IMG/M
3300031880|Ga0318544_10321832All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium601Open in IMG/M
3300032076|Ga0306924_10881866All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium991Open in IMG/M
3300032180|Ga0307471_101484220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium836Open in IMG/M
3300032180|Ga0307471_102653821All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium635Open in IMG/M
3300032205|Ga0307472_102342832All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium541Open in IMG/M
3300032893|Ga0335069_10194094All Organisms → cellular organisms → Bacteria2479Open in IMG/M
3300033004|Ga0335084_10121549All Organisms → cellular organisms → Bacteria2715Open in IMG/M
3300033416|Ga0316622_100283992All Organisms → cellular organisms → Bacteria1812Open in IMG/M
3300033487|Ga0316630_11897469All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300033513|Ga0316628_100350130All Organisms → cellular organisms → Bacteria → Proteobacteria1859Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil20.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.14%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil9.42%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.35%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.35%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.35%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.62%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.62%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.17%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.45%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.45%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.72%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.72%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.72%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.72%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.72%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.72%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.72%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014264Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rdEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300022563OV2_combined assemblyEnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10195215813300000364SoilGEYFYTAACGYHFVKDGXDYSXVXPNFVIGVNDKTNRAALGGRYQSSFIERNWDPNYFSLRTLTRMTD*
INPhiseqgaiiFebDRAFT_10195310723300000364SoilVNDKTNRAALGGRYQXSFIERXWXPXYFSLRTLTRMTD*
JGI1027J12803_10381754213300000955SoilMCGYHFVKNDETFSAVFPNLVVGVNDKTNRAAIGGRYQSSFLEQNWDPSYFSLRTLTHMTD*
Ga0062591_10168242713300004643SoilNRGGEYFYTAMCAYHFVKNDETYHAVFPNFVVGVNDKTNRAALGGRYQESFIERKWDPAYFSLRTLTRMTD*
Ga0062383_1036337623300004778Wetland SedimentEYFYTAMCGYHFVKNDENYHAVFPSLVLGVNDKTNRAALGGRYQESFIERKWDPGYFSLRTLTRMTD*
Ga0066674_1024658833300005166SoilDETFSAVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD*
Ga0066677_1027629233300005171SoilAGEYFYTAACGYHFVKNDETFSAVFPSLVIGVNDKINRAAIGGRYQSSFIERNWDPSYFSLRTLTHMSD*
Ga0066683_1000028713300005172SoilVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD*
Ga0066690_1056122233300005177SoilAVFPSLVIGVNDKINRAAIGGRYQSSFIERSWDASYFSLRTLTHMSD*
Ga0066685_1068276723300005180SoilHFVKNDETFSAVFPNLVIGVNDKINRAALGGRYQSSFIERNWDPGYFSLRTLTHMSD*
Ga0066675_1068483633300005187SoilFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD*
Ga0066388_10308273433300005332Tropical Forest SoilFVIGVNDKTNRAALGGRYQSSFIERNWDPNYFSLRTLTRMTD*
Ga0066388_10388349833300005332Tropical Forest SoilPNFVIGVNDKTNRAALGGRYQSSFIERNWDPNYFSLRTLTRMTD*
Ga0066388_10831896523300005332Tropical Forest SoilKNDDTFSAVFPNLVVGVNDKTNRAALGGRYQSSFLEQNWDPSYFSLRTLTHMTD*
Ga0070677_1051072213300005333Miscanthus RhizosphereGVNDKTNRAALGGRYQSSFIERNWDPNYFSLRTLTRMTD*
Ga0070666_1104389923300005335Switchgrass RhizosphereGEYFYTAMCAYHFVKNDETYHAVFPNFVVGVNDKTNRAALGGRYQESFIEHKWDPAYFSLRTLTRMTD*
Ga0068868_10211369313300005338Miscanthus RhizosphereVFPNFVVGVNDKTNRAALGGRYQESFIERKWDPAYFSLRTLTRMTD*
Ga0070700_10142792113300005441Corn, Switchgrass And Miscanthus RhizospherePSMVLGVNDKNNRAALGGRYQTSFIERNWDPKYFSIRTLTRMTD*
Ga0066689_1083600213300005447SoilCGYHFVKNDETFSAVFPNLVIGVNDKTNRAALGGRFQSSFLEQHWDPAYFSLRTITHMTD
Ga0066681_1096222723300005451SoilMCGYHFVKNDETFSAVFPNLVVGVNDKTNRAALGGRFQSSFLEQHWDPGYFSLRTITHMTD*
Ga0070662_10089836013300005457Corn RhizosphereMCAYHFVKNDETYHAVFPNFVVGVNDKTNRAALGGRYQESFIEHKWDPAYFSLRTLTRMTD*
Ga0070706_10004742713300005467Corn, Switchgrass And Miscanthus RhizosphereGVNDKTNRAALGGRFQNSFLEQSWDPSYFSLRTLTHMSD*
Ga0070706_10031280513300005467Corn, Switchgrass And Miscanthus RhizosphereNRAGEYFYTAACGYHFVKNDDTFSAVFPSLVIGVNDKINRAAIGGRYQSSFIERNWDPNYFSLRTLTHMSD*
Ga0070706_10093578623300005467Corn, Switchgrass And Miscanthus RhizosphereCGYHFVKNDETFSAVFPSLVIGVNDKINRAAIGGRYQSSFIERNWDPSYFSLRTLTHMSD
Ga0070707_10075521613300005468Corn, Switchgrass And Miscanthus RhizosphereGVNDKINRAAIGGRYQSSFIERNWDPNYFSLRTLTHMSD*
Ga0070707_10228678123300005468Corn, Switchgrass And Miscanthus RhizosphereNDDTFSAVFPSLVIGVNDKINRAAIGGRYQSSFIERNWDPSYFSLRTLTHMSD*
Ga0070695_10161700313300005545Corn, Switchgrass And Miscanthus RhizosphereVAQNLVIGVNDKTNRAALGGRYDSQFLEQKWDPSYFSLRTLTHMTD*
Ga0070704_10087202113300005549Corn, Switchgrass And Miscanthus RhizosphereAMCAYHFVKNDETFHAIFPNFVVGVNDKTNRAALGGRYQESFIERKWDPGYFSLRTLTRMTD*
Ga0066695_1014792533300005553SoilVIGVNDKINRAAIGGRYQSSFIERNWDPSYFSLRTLTHMSD*
Ga0066692_1068747723300005555SoilYHFVKNDETFSAVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD*
Ga0066903_10429926113300005764Tropical Forest SoilYSTVSPNFVIGVNDKTNRAALGGRYQSSFIERNWDPNYFSLKTLTHMTE*
Ga0066903_10562742713300005764Tropical Forest SoilVYPNFVIGVNDKTNRAALGGRYQSSFIERNWDPNYFSLRTLTHMTD*
Ga0066903_10609449213300005764Tropical Forest SoilVIGVNDKINRAALGGRYQSSFVERNWDPGYFSLRTLTHMSD*
Ga0066652_10207237913300006046SoilVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD*
Ga0066665_1078636533300006796SoilKNDETFSAVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD*
Ga0066665_1153821413300006796SoilAVFPSLVIGVNDKINRAAIGGRYQSSFIERNWDPSYFSLRTLTHMSD*
Ga0066659_1031679413300006797SoilINRAAIGGRYQSSFIERNWDPSYFSLRTLTHMSD*
Ga0066659_1110954733300006797SoilVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD*
Ga0079221_1138183523300006804Agricultural SoilVNDKTNRAALGGRFQSSFIEQNWDPSYFSLRTLTHMTD*
Ga0079220_1052109033300006806Agricultural SoilAGEYFYTAMCGYHFVKNDETFSAVFPNLVVGVNDKTNRAALGGRFQSSFLEQNWDPSYFSLRTLTHMTD*
Ga0075433_1180209113300006852Populus RhizosphereLVVGVNDKTNRAALGGRYQSSFLEQNWDPSYFSLRTLTHMTD*
Ga0075425_10013308213300006854Populus RhizosphereFYTAMCGYHFVKNDDTFSAVFPNLVVGVNDKTNRAALGGRYQSSFLEQNWDPSYFSLRTLTHMTD*
Ga0075426_1074848013300006903Populus RhizosphereCGYHFVKNDETFSAVFPSLVIGVNDKINRAAIGGRYQSSFIERNWDPNYFSLRTLTHMSD
Ga0075424_10048925113300006904Populus RhizosphereGVNDKTNRAALGGRFQSSFLEQHWDPSYFSLRTITHMTD*
Ga0099791_1045308123300007255Vadose Zone SoilVNDKTNRAALGGRFQSSFLEQHWDPGYFSLRTITHMTD*
Ga0066710_10011323613300009012Grasslands SoilNLVVGVNDKTNRAALGGRFQSSFLEQHWDPGYFSLRTITHMTD
Ga0099829_1107997613300009038Vadose Zone SoilTFSAVFPNLVVGVNDKTNRAALGGRFQSSFLEQSWDPSYFSLRTLTHMTD*
Ga0105107_1090153513300009087Freshwater SedimentPNLVIGVNDKTNRAALGGRYQSSFVERKWDPGYFSLRTLTRLTD*
Ga0099828_1024089813300009089Vadose Zone SoilGEYFYTAMCGYHFVKNDETFSAVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD*
Ga0111539_1145815533300009094Populus RhizosphereGYHFVKNDEKYSAVFPNLVVGVNDKTNRAALGGRYQSSFIEQNWDPTYFTLRTITHMTD*
Ga0105247_1105050713300009101Switchgrass RhizosphereGVNDKTNRAALGGRYSSQFFESQWPEDYFSLRTLTHLSD*
Ga0066709_10393604613300009137Grasslands SoilTFSAVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD*
Ga0066709_10420741913300009137Grasslands SoilETFSAVFPNLVVGVNDKTNRAALGGRFQNSFLEQSWDPSYFSLRTLSHMTD*
Ga0126374_1086920713300009792Tropical Forest SoilCGYHFVKDGENYSSVYPNFVIGVNDKTNRAALGGRYQSSFIERNWDPNYFSLRTLTHMTD
Ga0126380_1044707133300010043Tropical Forest SoilYPNFVIGVNDKTNRAALGGRYQSSFIERNWDPNYFSLRTLTHMTD*
Ga0126384_1108938913300010046Tropical Forest SoilGENYSSVYPNFVIGVNDKTNRAALGGRYQSSFIERNWDPNYFSLRTLTHMTD*
Ga0126384_1236032313300010046Tropical Forest SoilGTFSAVAPNLVVGVNDKTNRAALGGRYSAQFFEFKWPDDYFTLRTLTHLSD*
Ga0134088_1031546613300010304Grasslands SoilDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD*
Ga0134088_1035774813300010304Grasslands SoilLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD*
Ga0134109_1037393223300010320Grasslands SoilVKNDETFSAVFPSLVIGVNDKINRAAIGGRYQSSFIERNWDPSYFSLRTLTHMSD*
Ga0134064_1041006923300010325Grasslands SoilVVGVNDKTNRAALVGRFQSSFLEQHWDPGYFSLRTITHMTD*
Ga0134080_1026147633300010333Grasslands SoilGYHFVKNDETFSAVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD*
Ga0134080_1055711523300010333Grasslands SoilFSAVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD*
Ga0134063_1032727033300010335Grasslands SoilCGYHFVKNDDTFSAVFPSLVIGVNDKINRAAIGGRYQSSFIERNWDPSYFSLRTLTHMSD
Ga0126376_1172280913300010359Tropical Forest SoilFVKNDETWHSVYPNLVIGVNDKINRAVLGGHDQSSFVERNLDPGYFSLRTLTHMSD*
Ga0126378_1345143523300010361Tropical Forest SoilPNFVIGVNDKTNRAALGGRYQSSFIERNWDPNYFSLRTLTHMTD*
Ga0126377_1197794033300010362Tropical Forest SoilFPNLVVGVNDKTNRAALGGRFQSSFIEQNWDPSYFSLRTLTHMTD*
Ga0126377_1274216913300010362Tropical Forest SoilVYPNFVIGVNDKTNRAALGGRYQSSFIERNWDPNYFSLRTLTRMTD*
Ga0134124_1002224613300010397Terrestrial SoilVNDKTNRAALGGRYQESFVERKWDPAYFSLRTLTRMTD*
Ga0134127_1173880413300010399Terrestrial SoilRAGEYFYTAMCAYHFVKNDETYHAVFPNFVVGVNDKTNRAALGGRYQESFIEHKWDPAYFSLRTLTRMTD*
Ga0134122_1037207633300010400Terrestrial SoilVVGVNDKTNRAALGGRFTSSFLEQKWDPSYFSLRTLTHMTD*
Ga0134123_1041132043300010403Terrestrial SoilPNLVAGVNDKTNRAALGGRYQSSFIEQNWDPPYFTLRTITHMTD*
Ga0137389_1033128743300012096Vadose Zone SoilVKNDETFSAVFPNLVVGVNDKTNRAALGGRFQNSFLEQSWDPSYFSLRTLTHMSD*
Ga0137364_1056623833300012198Vadose Zone SoilEYFYTAACGYHFVKNDDTFSAVFPSLVIGVNDKINRAAIGGRYQSSFIERNWDPSYFSLRTLTHMSD*
Ga0157282_1004423713300012904SoilFSAVAPNLVVGVNDKTNRAALGGRYSSQFFESQWPEDYFSLRTLTHLSD*
Ga0137396_1086044933300012918Vadose Zone SoilNLVVGVNDKTNRSALGGRYQSSFLEQNWDPAYFTLRTLTHMTD*
Ga0137359_1120365233300012923Vadose Zone SoilLVVGVNDKTNRAAIGGRFQSSFLEQTWDPSYFSLRTLTHMTD*
Ga0137407_1034900613300012930Vadose Zone SoilNDETFSAVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD*
Ga0137407_1131388923300012930Vadose Zone SoilEYFYTAMCGYHFVKNDETFSAVFPNLVVGVNDKTNRAALGGRFQSSFLEQHWDPGYFSLRTITHMTD*
Ga0153915_1291475313300012931Freshwater WetlandsGEYFYTAMCGYHFAKNDADTYSAVFQSLVVGVNDKINRAAIGGRYGNAFLEQRWDPSHFSLRTITHMTD*
Ga0164303_1041968133300012957SoilAGEYFYTAMCGYHFVKNDETFSAVFPNLVVGVNDRTNRAAPGGRYQSSFLEQSWDPSYVSLRTLTHMTD*
Ga0126369_1111614113300012971Tropical Forest SoilACGYHFVKDGEDFSTVSPNFVIGVNDKTNRAALGGRYQSSFVERNWDPNYFSLKTLTHMTE*
Ga0134077_1003811543300012972Grasslands SoilAVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD*
Ga0134075_1055297013300014154Grasslands SoilNRGGEYFYTAMCGYHFVKNDETFSAVFPNLVIGVNDKTNRAALGGRFQSSFLEQHWDPAYFSLRTITHMTD*
Ga0075308_112925513300014264Natural And Restored WetlandsWSKNGAGTFTAVTPNLVMGVNDKSNRAGLGGRFLSQFIERNFDPQYFSLRTLTRLTD*
Ga0157380_1172382523300014326Switchgrass RhizosphereYFYTAMCAYHFVKNDETFHAVFPNFVVGVNDKTNRAALGGRYQESFIERKWDPAYFSLRTLTRMTD*
Ga0132255_10543978023300015374Arabidopsis RhizosphereCGYHFVQGDDYSAVYPNFVIGVNDKTNRAALGGRYQSSFIERNWDPNYFSLRTLTRMTD*
Ga0182032_1107965833300016357SoilETYSSVYPNFVIGVNDKTNRAALGGRYQSSFIERNWDPNYFSLRTLTHMTD
Ga0134112_1040189223300017656Grasslands SoilAVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD
Ga0134074_102515143300017657Grasslands SoilETFSAVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD
Ga0134074_104964713300017657Grasslands SoilNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD
Ga0134074_133995423300017657Grasslands SoilGVNDKTNRAALGGRFQSSFLEQHWDPGYFSLRTITHMTD
Ga0187766_1096999713300018058Tropical PeatlandVNDKTNRSALGGRYQSSFLEQHWDPSYFSLRTIAHMTD
Ga0066667_1186846513300018433Grasslands SoilVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD
Ga0066669_1189257523300018482Grasslands SoilYHFVKNDDTFSAVFPSLVIGVNDKINRAAIGGRYQSSFIERNWDPSYFSLRTLTHMSD
Ga0187894_1017265233300019360Microbial Mat On RocksVNDKTNRAALGGRYQSSFIERKWDPAYFSLRTITRMTD
Ga0187892_1049005823300019458Bio-OozeNDKTNRAALGGRYQTSFVERKWDTSYFSLRTITRLTD
Ga0212128_1067630913300022563Thermal SpringsACGYHFVKNDESFSASFPSMVIGVNDKSNRAALGGRYQTSFIERNWDPKYFSIRTLTRMT
Ga0207680_1108059123300025903Switchgrass RhizosphereHFVKNDETYHAVFPNFVVGVNDKTNRAALGGRYQESFIEHKWDPAYFSLRTLTRMTD
Ga0207684_1102026913300025910Corn, Switchgrass And Miscanthus RhizosphereFYTAACGYHFVKNDDTFSAVFPSLVIGVNDKINRAAIGGRYQSSFIERNWDPNYFSLRTLTHMSD
Ga0207684_1161540623300025910Corn, Switchgrass And Miscanthus RhizosphereKNDDTFSAVFPSLVIGVNDKINRAAIGGRYQSSFIERNWDPSYFSLRTLTHMSD
Ga0207693_1039336613300025915Corn, Switchgrass And Miscanthus RhizosphereVSPNFVIGVNDKTNRAALGGRYQSSFIERNWDPNYFSLKTLTHMTD
Ga0207646_1139506423300025922Corn, Switchgrass And Miscanthus RhizosphereMVIGVNDKINRAALGGRYQSSFIERNWDPSYFSLRTLTHMSD
Ga0207646_1175767713300025922Corn, Switchgrass And Miscanthus RhizosphereFSAVFASLVISVNDKINRAAIGGRYQSSFIERNWDPNYFSLRTLTHMSD
Ga0207691_1095965933300025940Miscanthus RhizosphereNFVVGVNDKTNRAALGGRYQESFIEHKWDPAYFSLRTLTRMTD
Ga0207708_1174092713300026075Corn, Switchgrass And Miscanthus RhizosphereVGVNDKTNRAALGGRYQESFIEHKWDPAYFSLRTLTRMTD
Ga0207641_1195616023300026088Switchgrass RhizosphereEYFYTAMCAYHFVKNDETYHAVFPNFVVGVNDKTNRAALGGRYQESFIEHKWDPAYFSLRTLTRMTD
Ga0209236_105114313300026298Grasslands SoilVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD
Ga0209469_102042313300026307SoilAMCGYHFVKYDETFSAVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD
Ga0209469_112174713300026307SoilFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD
Ga0209268_102140953300026314SoilGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD
Ga0209801_127012413300026326SoilNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD
Ga0209802_101786083300026328SoilSAVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD
Ga0209804_132470523300026335SoilHFVKNDETFSAVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD
Ga0209808_126250523300026523SoilAGEYFYTAACGYHFVKNDDTFSAVFPSLVIGVNDKINRAAIGGRYQSSFIERNWDPSYFSLRTLTHMSD
Ga0209690_109312813300026524SoilLVVGVNDKTNRAALGGRFQSSFLEQSWDPSYFSLRTLTHMTD
Ga0209378_101154213300026528SoilYHFVKNDETFSAVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD
Ga0209161_1032785533300026548SoilGYHFVKNDDTFSAVFPSLVIGVNDKINRAAIGGRYQSSFIERNWDPSYFSLRTLTHMSD
Ga0209689_133852223300027748SoilVKNDDTFSAVFPSLVIGVNDKINRAAIGGRYQSSFIERNWDPSYFSLRTLTHMSD
Ga0209180_1037292233300027846Vadose Zone SoilYFYTAMCGYHFVKNDETFSAVFPNLVVGVNDKTNRAALGGRFQNSFLEQSWDPSYFSLRTLTHMSD
Ga0209283_1038397613300027875Vadose Zone SoilYFYTAMCGYHFVKNDETFSAVFPNLVVGVNDKTNRAALGGRYQSSFLEQSWDPSYFSLRTLTHMTD
Ga0268266_1079658123300028379Switchgrass RhizosphereHFVKNQDETYSAVFPNLVIGVNDKTNRAALGGRYQSSFIERNWDPNYFSLRTLTRMTD
Ga0310888_1089843823300031538SoilKNNRAALGGRYQTSFIERNWDPKYFSIRTLTRMTD
Ga0318534_1079434113300031544SoilENDKTNRAALGGRYQSSFIERNWDPNYFSLRTLTHMTD
Ga0307469_1077171433300031720Hardwood Forest SoilAMCGYHFVKNDETYHSVSPDLVVGVNDKSNRAALGGRYQESFIEKKWDPSYFSLRTLTRMTD
Ga0307469_1252344523300031720Hardwood Forest SoilETFSAVFPNLVVGVNDKTNRAALGGRFQSSFLEQSWDPSYFSLRTLTHMTD
Ga0307468_10156035813300031740Hardwood Forest SoilDLVIGVNDKTNRAALGGRYDSQYLEQKWDPSHFSLRTLSHLTD
Ga0318517_1029632633300031835SoilNDKTNRAALGGRYQSSFIERNWDPNYFSLRTLTHMTD
Ga0318544_1032183223300031880SoilACGYHFVKDGDTYSAVYPNFVIGVNDKTNRAALGGRYQSSFIERNWDPNYFSLRTLTHMT
Ga0306924_1088186613300032076SoilTVSASFPSMVLGTNDKINRAALGGRYQSSFIERNWDQSYFSLRTISHMTD
Ga0307471_10148422013300032180Hardwood Forest SoilFVKNDETFSAVFPNLVVGVNDKTNRAALGGRYQNSFLEQSWDPSYFSLRTLTHMTD
Ga0307471_10265382123300032180Hardwood Forest SoilETFSAVFPNLVVGVNDKTNRAALGGRFQNSFLEQHWDPAYFSLRTIAHMTD
Ga0307472_10234283213300032205Hardwood Forest SoilYTAMCGYHFVKNDETYHAVFPNLVVGVNDKTNRAALGGRYQESFIEKNWDPSYFSLRTLTRMTD
Ga0335069_1019409443300032893SoilPSMVLGTNDKINRAALGGRYQSSFIERNWDQTYFSLRTISHMTD
Ga0335084_1012154913300033004SoilLGTNDKINRSALGGRYQSSFIERNWDQTYFSLRTISHMTD
Ga0316622_10028399243300033416SoilVPEPEPFGVNDATSRAVLGSRYQSSFIERNRDPNWFSLRMLTRMTD
Ga0316630_1189746913300033487SoilYFYNAMCAYHWSKNADGTLTAVTPNMVVGVNDKTNRAALGGRYQTSFIERNWDPKYFSIRTLTRMTD
Ga0316628_10035013013300033513SoilAGEYFYTAMCGYHFVKNDETYHSVFPSMVVGVNDKTNRAALGGRYQESFIERKWDPGYFSLRTLTRMTD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.