| Basic Information | |
|---|---|
| Family ID | F055567 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKRLQFCLVVFAVLALTLSAFAQVQNGQFTGTVTDPTGAAIAN |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.27 % |
| % of genes near scaffold ends (potentially truncated) | 98.55 % |
| % of genes from short scaffolds (< 2000 bps) | 90.58 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.058 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.841 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.986 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.101 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.80% β-sheet: 2.82% Coil/Unstructured: 63.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF07593 | UnbV_ASPIC | 26.09 |
| PF13517 | FG-GAP_3 | 16.67 |
| PF14559 | TPR_19 | 1.45 |
| PF01326 | PPDK_N | 0.72 |
| PF08238 | Sel1 | 0.72 |
| PF02445 | NadA | 0.72 |
| PF04191 | PEMT | 0.72 |
| PF00370 | FGGY_N | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0379 | Quinolinate synthase | Coenzyme transport and metabolism [H] | 0.72 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.06 % |
| Unclassified | root | N/A | 15.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001180|JGI12695J13573_1010286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus roseus | 639 | Open in IMG/M |
| 3300004080|Ga0062385_10131164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1266 | Open in IMG/M |
| 3300004080|Ga0062385_10783362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 622 | Open in IMG/M |
| 3300004082|Ga0062384_101115729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 570 | Open in IMG/M |
| 3300004152|Ga0062386_100487035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1000 | Open in IMG/M |
| 3300004152|Ga0062386_101220571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus roseus | 625 | Open in IMG/M |
| 3300005181|Ga0066678_10657446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300005332|Ga0066388_102455839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300005334|Ga0068869_101419268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 615 | Open in IMG/M |
| 3300005337|Ga0070682_101504641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300005363|Ga0008090_11966758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300005447|Ga0066689_10115171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1561 | Open in IMG/M |
| 3300005575|Ga0066702_10462766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300005712|Ga0070764_11088994 | Not Available | 506 | Open in IMG/M |
| 3300005842|Ga0068858_100992119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 823 | Open in IMG/M |
| 3300005884|Ga0075291_1011751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 985 | Open in IMG/M |
| 3300006052|Ga0075029_101333463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300006797|Ga0066659_11686388 | Not Available | 534 | Open in IMG/M |
| 3300006800|Ga0066660_10901667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300006854|Ga0075425_102900699 | Not Available | 526 | Open in IMG/M |
| 3300009012|Ga0066710_104036963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300009029|Ga0066793_10825973 | Not Available | 526 | Open in IMG/M |
| 3300009089|Ga0099828_10151477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2049 | Open in IMG/M |
| 3300009089|Ga0099828_10515245 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300009090|Ga0099827_10832859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300009137|Ga0066709_103696098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300009147|Ga0114129_12624316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300009545|Ga0105237_12110312 | Not Available | 573 | Open in IMG/M |
| 3300010046|Ga0126384_12153921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300010048|Ga0126373_11043987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 883 | Open in IMG/M |
| 3300010303|Ga0134082_10155145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
| 3300010325|Ga0134064_10403066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300010339|Ga0074046_10001675 | All Organisms → cellular organisms → Bacteria | 19729 | Open in IMG/M |
| 3300010343|Ga0074044_10748689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300010360|Ga0126372_11855349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300010360|Ga0126372_12352026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300010373|Ga0134128_12242693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300010376|Ga0126381_100265868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2332 | Open in IMG/M |
| 3300010379|Ga0136449_101652649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
| 3300011270|Ga0137391_10850540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300011271|Ga0137393_10405751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1167 | Open in IMG/M |
| 3300011271|Ga0137393_11661711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300012189|Ga0137388_10042828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3619 | Open in IMG/M |
| 3300012198|Ga0137364_10484779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 929 | Open in IMG/M |
| 3300012201|Ga0137365_10574139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
| 3300012349|Ga0137387_11124338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300012360|Ga0137375_11372160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300012362|Ga0137361_11431025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300012505|Ga0157339_1056517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300012923|Ga0137359_10893371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300012927|Ga0137416_11298468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300012930|Ga0137407_10586168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1046 | Open in IMG/M |
| 3300012930|Ga0137407_11965518 | Not Available | 558 | Open in IMG/M |
| 3300012944|Ga0137410_11777741 | Not Available | 544 | Open in IMG/M |
| 3300012989|Ga0164305_10171790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1495 | Open in IMG/M |
| 3300014154|Ga0134075_10444161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300015241|Ga0137418_11242131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300015245|Ga0137409_10176098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1941 | Open in IMG/M |
| 3300015245|Ga0137409_10555369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300015371|Ga0132258_10111110 | All Organisms → cellular organisms → Bacteria | 6488 | Open in IMG/M |
| 3300015372|Ga0132256_100021334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5758 | Open in IMG/M |
| 3300015374|Ga0132255_102492710 | Not Available | 790 | Open in IMG/M |
| 3300017935|Ga0187848_10096686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1349 | Open in IMG/M |
| 3300017940|Ga0187853_10274380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300017943|Ga0187819_10747069 | Not Available | 550 | Open in IMG/M |
| 3300017955|Ga0187817_11126627 | Not Available | 504 | Open in IMG/M |
| 3300018006|Ga0187804_10405198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300018012|Ga0187810_10364007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300018037|Ga0187883_10009750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5490 | Open in IMG/M |
| 3300018037|Ga0187883_10678355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300018085|Ga0187772_11192557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300018468|Ga0066662_10282519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1381 | Open in IMG/M |
| 3300019882|Ga0193713_1201175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300019890|Ga0193728_1175244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
| 3300021420|Ga0210394_11768875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300021432|Ga0210384_10537381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1052 | Open in IMG/M |
| 3300021476|Ga0187846_10290698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300021477|Ga0210398_10141600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1955 | Open in IMG/M |
| 3300021559|Ga0210409_11113977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300021559|Ga0210409_11445544 | Not Available | 563 | Open in IMG/M |
| 3300025474|Ga0208479_1101858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300025480|Ga0208688_1021736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1637 | Open in IMG/M |
| 3300025619|Ga0207926_1043724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1272 | Open in IMG/M |
| 3300025914|Ga0207671_10342541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1185 | Open in IMG/M |
| 3300025923|Ga0207681_10197501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1543 | Open in IMG/M |
| 3300026023|Ga0207677_10155325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1771 | Open in IMG/M |
| 3300026089|Ga0207648_12008434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300026317|Ga0209154_1184330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
| 3300026317|Ga0209154_1235311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300026322|Ga0209687_1296706 | Not Available | 512 | Open in IMG/M |
| 3300026354|Ga0257180_1042811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300026469|Ga0257169_1020031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 943 | Open in IMG/M |
| 3300026536|Ga0209058_1104888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1422 | Open in IMG/M |
| 3300026547|Ga0209156_10455717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300026557|Ga0179587_10638841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300027590|Ga0209116_1071567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300027610|Ga0209528_1001593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4513 | Open in IMG/M |
| 3300027678|Ga0209011_1060955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
| 3300027729|Ga0209248_10129772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300027729|Ga0209248_10215036 | Not Available | 565 | Open in IMG/M |
| 3300027846|Ga0209180_10282112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
| 3300027846|Ga0209180_10405451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300027875|Ga0209283_10572243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300027875|Ga0209283_10735750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300027882|Ga0209590_10667674 | Not Available | 666 | Open in IMG/M |
| 3300027894|Ga0209068_10588657 | Not Available | 647 | Open in IMG/M |
| 3300027911|Ga0209698_10037059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4400 | Open in IMG/M |
| 3300027911|Ga0209698_10139947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1992 | Open in IMG/M |
| 3300028047|Ga0209526_10309946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1066 | Open in IMG/M |
| 3300028047|Ga0209526_10501671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
| 3300028047|Ga0209526_10636635 | Not Available | 679 | Open in IMG/M |
| 3300028047|Ga0209526_10680982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300028380|Ga0268265_10361843 | Not Available | 1328 | Open in IMG/M |
| 3300028380|Ga0268265_11321189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300028560|Ga0302144_10252257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300028673|Ga0257175_1063215 | Not Available | 693 | Open in IMG/M |
| 3300028678|Ga0302165_10011673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2495 | Open in IMG/M |
| 3300028868|Ga0302163_10134878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300029636|Ga0222749_10173578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1063 | Open in IMG/M |
| 3300029907|Ga0311329_10077444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2811 | Open in IMG/M |
| 3300029917|Ga0311326_10018194 | All Organisms → cellular organisms → Bacteria | 4327 | Open in IMG/M |
| 3300030503|Ga0311370_11097648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300030520|Ga0311372_12688039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300030707|Ga0310038_10183237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
| 3300030991|Ga0073994_12370637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300030991|Ga0073994_12394392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300031344|Ga0265316_10342600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
| 3300031740|Ga0307468_101884551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300031740|Ga0307468_102372443 | Not Available | 517 | Open in IMG/M |
| 3300031823|Ga0307478_11113200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300032160|Ga0311301_11540442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300032160|Ga0311301_11583127 | Not Available | 799 | Open in IMG/M |
| 3300032829|Ga0335070_11191353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300032955|Ga0335076_11741761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300033433|Ga0326726_12221319 | Not Available | 533 | Open in IMG/M |
| 3300033486|Ga0316624_11341929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300034124|Ga0370483_0056647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1243 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.80% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.62% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.90% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.90% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.17% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.17% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.45% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.45% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.45% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.45% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.72% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.72% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.72% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025619 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028678 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2 | Environmental | Open in IMG/M |
| 3300028868 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12695J13573_10102861 | 3300001180 | Forest Soil | MKRLQFCLAVFAVLALTLSAFAQVQNGQFDGTVTDPTGAAIANAKVTSPTPRPA* |
| Ga0062385_101311641 | 3300004080 | Bog Forest Soil | MKRLQFCLVVFAVLALSFSAFAQVQFSQITGTVVDPTGAAIANAKVAVTNTAIDLHLY |
| Ga0062385_107833621 | 3300004080 | Bog Forest Soil | MKRLQFCLAVFAVLALSLTAFAQIQNGQLTGDISDPSGAAI |
| Ga0062384_1011157291 | 3300004082 | Bog Forest Soil | MKRLQFCLAVFAVLALTSSAFAQVQFSQFTGTVVDQTGATIANAKVT |
| Ga0062386_1004870352 | 3300004152 | Bog Forest Soil | MKRLQFCLVVFAVLALTFSAFAQVQFGQFTGTVTDPTGAAITNAKV |
| Ga0062386_1012205711 | 3300004152 | Bog Forest Soil | MKRLQFCLAVFAVLALTFSAFAQVQNGQFDGTVTDPTGAAIGNAKVEVSNPAT |
| Ga0066684_108750291 | 3300005179 | Soil | MRKLCLCAVSCCFLMFALSAVGQVQNGQFTGTVTDPSGAAIAGAKVMVTN |
| Ga0066678_106574461 | 3300005181 | Soil | MKNLQLCLVFVSLVFASSNGLAQIQNGQFTGTVSDPTGAAIPNAR |
| Ga0066388_1024558391 | 3300005332 | Tropical Forest Soil | MRRLQFCLAMFALLALACSAFAQVQNGQFEGTVTDPTGAAIANA |
| Ga0068869_1014192681 | 3300005334 | Miscanthus Rhizosphere | MKRLQFCLVLLCTLMLALGAFAQVQNGQFTGEVTDPSGAAIANAKV |
| Ga0070682_1015046412 | 3300005337 | Corn Rhizosphere | MKRLQFCLVLLCTLMLALGAFAQVQNGQFTGEITDPSGAAIANAK |
| Ga0008090_119667581 | 3300005363 | Tropical Rainforest Soil | MAMKKLLFLLISLALLAGVAAAQVQNGQFTGTVFDPSGAAIPNAK |
| Ga0066689_101151711 | 3300005447 | Soil | MKKLQFCLVFFSLLIMVVSAAAQVQNGQFTGTITDPSGAAIANAKVTAV |
| Ga0066702_104627662 | 3300005575 | Soil | MKRLQFCLAVFAVLALTFSAFAQVQNGQFTGTVTDPT |
| Ga0070764_110889942 | 3300005712 | Soil | MKRLQFCLVVLAVLALTFSAMAQVTSSQFTGTVLDP |
| Ga0068858_1009921191 | 3300005842 | Switchgrass Rhizosphere | MKKLQFFLLFVSLLTLSLSAFAQIQNGQFTGTVVDPSGAAIANAKVTV |
| Ga0075291_10117511 | 3300005884 | Rice Paddy Soil | MKNLLISLCVLTFSLCAVAQVQNGEFTGVVTDPTGAAIHDA |
| Ga0075029_1013334632 | 3300006052 | Watersheds | MKRLQFCLVVFAVLALTFSAFAQVQFGQFTGTVTDPSGAAIANAKVSVNNPAIDLNL |
| Ga0066659_116863881 | 3300006797 | Soil | MKKLQSCLAVVCCSLLLVLSAAAQVQNGQFQGTVTD |
| Ga0066660_109016671 | 3300006800 | Soil | MKKLQFCLVFLCLLLLALSAAAQVQNGQFTGVVTDTSGAAMANAKVTATN |
| Ga0075425_1029006992 | 3300006854 | Populus Rhizosphere | MRRLQFCLAVFALLALTFSAFAQVQNGQLTGIVTDPSGAAIANAK |
| Ga0066710_1040369631 | 3300009012 | Grasslands Soil | MKKVYSYLVVCSLLLLVLSAAAQVQNGQFTGTVTDPTGAAIAGA |
| Ga0066793_108259731 | 3300009029 | Prmafrost Soil | MKRLQFCLVVLAVLALTCSAFAQVQNGQFSGTVLD |
| Ga0099828_101514772 | 3300009089 | Vadose Zone Soil | MKKLQFCLVFLFPLLLALSAAGQVQNGTFTGTVTDPSG |
| Ga0099828_105152452 | 3300009089 | Vadose Zone Soil | MKRLQFCLAVFAVLALTFSAFAQVQNGQFTGTVTDPTGAAIANAKV |
| Ga0099827_108328592 | 3300009090 | Vadose Zone Soil | MKKLQFCLVFLCLLLLALSAAAQVQNGQFTGVVTDPSGAAIANAKVTVN |
| Ga0066709_1036960981 | 3300009137 | Grasslands Soil | MKKLQFCLVFLCLLLLALSAAAQVQNGQFTGVVTDPSGAA |
| Ga0114129_126243161 | 3300009147 | Populus Rhizosphere | MKKLQFCLVFVSVFVLALSAIAQIQNGQFSGTVTDPSGAALAEA |
| Ga0105237_121103121 | 3300009545 | Corn Rhizosphere | MTKLRFCLSFLCVFVLVAGALAQVQNGQFTGTVTDPSGAAI |
| Ga0126384_121539211 | 3300010046 | Tropical Forest Soil | MKKLQLCLVLISVFLLALGAFAQVQNGQFTGVVTDPSGAAIPNA |
| Ga0126373_110439871 | 3300010048 | Tropical Forest Soil | MAMKKLLFLLISLVLVAEVATAQVQNGQFNGTVLDPSGAAIPNAKVTL |
| Ga0134082_101551451 | 3300010303 | Grasslands Soil | MKKLQFCLVAISILLVALGAFAQVQNGQFTGIVTDPS |
| Ga0134064_104030661 | 3300010325 | Grasslands Soil | MKKLQFCLVAISMLLVALGAFAQVQNGQFTGTVTDPSGAA |
| Ga0074046_1000167517 | 3300010339 | Bog Forest Soil | MKRLQFCLVVFAVLALAFSAFAQVENGQFSGTVTDQTGAAIANAK |
| Ga0074044_107486891 | 3300010343 | Bog Forest Soil | MKRLQFCLVVFAVLALTFSAFAQVENGQFTGTVLDPTGAA |
| Ga0126372_118553492 | 3300010360 | Tropical Forest Soil | MKKLQFFLVTFSVILLVLAAAGQVQNGQFSGVVTDPSGAAIADAKVTVTNVG |
| Ga0126372_123520261 | 3300010360 | Tropical Forest Soil | MRRLQFCLAVFALLALTCSAFAQVQNGQITGTVTDPTGA |
| Ga0134128_122426931 | 3300010373 | Terrestrial Soil | MNKLRFCLVCFSLLVLVLGAAAQVQNGSFTGTVADPSGAAIANAKVTVTNM |
| Ga0126381_1002658682 | 3300010376 | Tropical Forest Soil | MKKFQSWGMVFCLVVLTVTAVGQIQNGQFAGTVTDPSGAA |
| Ga0136449_1016526492 | 3300010379 | Peatlands Soil | MKRLQFCLVVFAVLALTFSAFAQVENGQFSGTVTDQTGAAIANA |
| Ga0137391_108505402 | 3300011270 | Vadose Zone Soil | MKRLQFCLAVFAVLALTFGASAQVQNGQFTGTVTDPTGA |
| Ga0137393_104057512 | 3300011271 | Vadose Zone Soil | MKRLQFCLAVFAVLALTFSAFAQVQNGQFDGAVTDPTGAA |
| Ga0137393_116617111 | 3300011271 | Vadose Zone Soil | MKKLQFCLALLSLLVLAPGAFAQVQNGQFNGTVTDPSG |
| Ga0137388_100428281 | 3300012189 | Vadose Zone Soil | MKRLQFCLAVFAVLALSVSAFSQMQNGQFSGTVLDPTGAAVANAK |
| Ga0137364_104847792 | 3300012198 | Vadose Zone Soil | MKKSQCCLVLFSFLLLVLTAAAQVQNGQFTGAVTDQTGAAIPNA |
| Ga0137365_105741392 | 3300012201 | Vadose Zone Soil | MKKFQCCLVLFSSLLLILSAAAQVQNGQFTGTVTDQ |
| Ga0137387_111243381 | 3300012349 | Vadose Zone Soil | MKKLQFCLVLSVIVLTVCASAQIQNGQFTGTVTDPSGAAIPN |
| Ga0137375_113721601 | 3300012360 | Vadose Zone Soil | MKRLQFCLVLFCTLMLALGAFAQVQNGQFTGEVTDPSGAAIANAKV |
| Ga0137361_114310251 | 3300012362 | Vadose Zone Soil | MKKLQFCLVLFSLFVLVVSAAAQVTNGQFVGTITDPSGAA |
| Ga0157339_10565172 | 3300012505 | Arabidopsis Rhizosphere | MKRLQFCLVLLCTLMLALGAFAQVQNGQFTGEITDPSGAAIANAKVTVVN |
| Ga0137359_108933711 | 3300012923 | Vadose Zone Soil | MKKLQLCLISLCILTLTLTAAAQVQNGQFTGVVTDPSGAAIANAKVTVTNL |
| Ga0137416_112984682 | 3300012927 | Vadose Zone Soil | MKRLQFCLAVFAVLALTFSAFAQVQNGQFTGTVTDPTGAAIANA |
| Ga0137407_105861681 | 3300012930 | Vadose Zone Soil | MKKLQFCLVFFSLFVLVLSAAAQVQNGQFAGTITDPSGAAIANAKVT |
| Ga0137407_119655181 | 3300012930 | Vadose Zone Soil | MRRLQFCLAVFALLALTCSAFAQVQNGQITGTVTDPSGAAIPN |
| Ga0137410_117777411 | 3300012944 | Vadose Zone Soil | MRRLQFCLAVFSLLALTMSAVAQVQNGQITGTVTDPSGAAIA |
| Ga0164305_101717901 | 3300012989 | Soil | MKKLQLILLSLSLLALSLGAFAQIQNGQFTGTVTDPSGAA |
| Ga0134075_104441611 | 3300014154 | Grasslands Soil | MKKLQFCLVAISMLLLALGAVAQVQNGQFTGVVTDPSGAAIPNAK |
| Ga0137418_112421311 | 3300015241 | Vadose Zone Soil | MKKLQFCLVFFSVLVLVLSAAAQVQNGQFTGTITDPSGAA |
| Ga0137409_101760981 | 3300015245 | Vadose Zone Soil | MRRLQFCLAVFALLALTMSAVAQVQNGQITGTVTAPSGAAIANA |
| Ga0137409_105553691 | 3300015245 | Vadose Zone Soil | MRRLQFCLAVFALLALTLSAFAQVQNGQITGTVTDPSGAAIA |
| Ga0132258_101111107 | 3300015371 | Arabidopsis Rhizosphere | MNKLRFCLVCFSLLVLVLGAAAQVQNGSFTGTVADPSGA |
| Ga0132256_1000213346 | 3300015372 | Arabidopsis Rhizosphere | MKRLQFCLVLLCTLMLALGAFAQVQNGQFTGEITDPSG |
| Ga0132255_1024927101 | 3300015374 | Arabidopsis Rhizosphere | MNKLRFCLVYFSLLVLVLGAAAQVQNGTFTGTVADPSGAAIANAK |
| Ga0187848_100966862 | 3300017935 | Peatland | MKRLQFCLAVFAVLALTCSVFAQVQFSQFTGTVLDPTSAAI |
| Ga0187853_102743802 | 3300017940 | Peatland | MRRLQFCLAVFAVLALSFSALAQVQNGQFAGTVTDPSGAAIA |
| Ga0187819_107470691 | 3300017943 | Freshwater Sediment | MKRLQFCLVVFAVLALTFSAFAQVQNGEFSGTVTDQTGAA |
| Ga0187817_111266273 | 3300017955 | Freshwater Sediment | MKRLQLCLAVFAVLALSFSAFAQVENGQFAGTVTDP |
| Ga0187804_104051982 | 3300018006 | Freshwater Sediment | MKRLQFCLAVFAVLALTCSAFAQIQFGQFTGTVLDPTGAAIA |
| Ga0187810_103640071 | 3300018012 | Freshwater Sediment | MRKLQFCLVVFAVLALTCSLFAQVQNGQFEGTVTDPTGAAIANAK |
| Ga0187883_100097501 | 3300018037 | Peatland | MRRLQFCLAVFAVLALSFSASAQIQFGQFTGTVTDPTSAAIANAKIVVTNPATD |
| Ga0187883_106783551 | 3300018037 | Peatland | MKRLQFCLVVFAVLALTVSAIAQVQNGQFTGTVTDPTGAVV |
| Ga0187772_111925571 | 3300018085 | Tropical Peatland | MKKLQFYLAVFAVIVLSFSAFAQVQNGQFAGTVTDPTGAAIANAKVTVKN |
| Ga0066662_102825193 | 3300018468 | Grasslands Soil | MKKLQFCLVFLFLLLLALSAAAQVQNGTFTGTVTDPSGA |
| Ga0193713_12011751 | 3300019882 | Soil | MRKLQFCLAVFALLALTMSAFAQVQYGQITGTVTDPSGAAIANAKVT |
| Ga0193728_11752441 | 3300019890 | Soil | MKKLQSCLVIFSFMLLVFSAAAQVQNGQLSGDVTD |
| Ga0210394_117688751 | 3300021420 | Soil | MKRLQFCLAVFAVLALTFNAFAQVQNAQFTGTVSDPTGAAIANAKVTVSNP |
| Ga0210384_105373812 | 3300021432 | Soil | MRKLQLCFLLFSLVASSMGSFAQIQNGQFTGIVTDPSGAAIANAK |
| Ga0187846_102906981 | 3300021476 | Biofilm | MKKLQFCFALLCVLVLALGAFAQVQFGQFSGVVTDPSGAAIPNAKVTVT |
| Ga0210398_101416001 | 3300021477 | Soil | MRRLQFCLAVFAVLALTFSASAQVQFALLAGTVLDP |
| Ga0210409_111139772 | 3300021559 | Soil | MKNLRFCLVCLSVLLLALGGFAQIQNGQFTGTVTDPSGAAIA |
| Ga0210409_114455441 | 3300021559 | Soil | MKKLSFFFLLLSSLLILSLGAFAQVQNGQFAGTVNDP |
| Ga0208479_11018581 | 3300025474 | Arctic Peat Soil | MKRLQFCLVVFAVLALTFSAFAQVQFGQFTGTVTDPTGAAIANAKVAVSNPA |
| Ga0208688_10217362 | 3300025480 | Peatland | MKRLQFCLAVFAVLALSFSAFAQVQFGQFSGTVLDPTG |
| Ga0207926_10437241 | 3300025619 | Arctic Peat Soil | MKRLQFCLVVFAVLALTFSAFAQVQFGQFTGTVTDPTGAAIANAKV |
| Ga0207671_103425412 | 3300025914 | Corn Rhizosphere | MKKLHLILLSLSLLALSLGAFAQIQNGQFTGTVTDPSGAAISN |
| Ga0207681_101975011 | 3300025923 | Switchgrass Rhizosphere | MKKLHLILLSLSLLALSLGAFAQIQNGQFTGTVTDPSGA |
| Ga0207677_101553251 | 3300026023 | Miscanthus Rhizosphere | MKRLQFCLVLLCTLMLALGAFAQVQNGQFTGEITDPSGAAIANAKVTVV |
| Ga0207648_120084341 | 3300026089 | Miscanthus Rhizosphere | MKKLQLILLSLSLLALSLGAFAQIQNGQFTGTVTDPSGAAI |
| Ga0209154_11843302 | 3300026317 | Soil | MKRLQFCLAVFAVLFLALSAFAQVQNGQFEGTVTDPTGAAI |
| Ga0209154_12353111 | 3300026317 | Soil | MKKLQFCLVAISMLLVALGAFAQVQNGQFTGTVTDPSGAAIPNA |
| Ga0209687_12967061 | 3300026322 | Soil | MTKLRFCLSFLCVFVLVAGALAQVQNGQFTGTVTDPSGAAIANAKVT |
| Ga0257180_10428111 | 3300026354 | Soil | MKKLQFCLVYFSLLVLVLGAAAQVQNGQFTGTVADPSGAAIANSRVTVTNMG |
| Ga0257169_10200311 | 3300026469 | Soil | MKRLQFCLAVFAVLALTFSAVAQVQNGQFTGTVSDPT |
| Ga0209058_11048881 | 3300026536 | Soil | MKKLQFCLVAISILLVALGAFAQVQNGQFTGIVTDPSGAAIPN |
| Ga0209156_104557171 | 3300026547 | Soil | MKKLQFCLVAASVLVLALSAFAQIQNGQFTGTITDPSG |
| Ga0179587_106388412 | 3300026557 | Vadose Zone Soil | MRNLRFCLIFVFVVLLSTLTFAQVQNGQFAGTVTD |
| Ga0209116_10715671 | 3300027590 | Forest Soil | MKKSQFCLVLLCGLVLTLAAGAQIQNGQFEGTVTDQSGAAI |
| Ga0209528_10015936 | 3300027610 | Forest Soil | MFAVLTLTFSAFAQVQNGQFTGTVTDPTGAAIANAKVTVSNPAIDLNLS |
| Ga0209011_10609552 | 3300027678 | Forest Soil | MKRLQFCLAVFAVLALTFSAFAQVQNGQFTGTVTDPTGAAIAN |
| Ga0209248_101297723 | 3300027729 | Bog Forest Soil | MKRLQFCLVVFAALALTFSAFAQVQFGQFTGTVTDPTGAAIPNAKIQ |
| Ga0209248_102150361 | 3300027729 | Bog Forest Soil | MKRLQFCLVFAVLALTFSAFAQEESGQFSGTVLDPTGAAV |
| Ga0209180_102821122 | 3300027846 | Vadose Zone Soil | MKKLQFCLVFFSLLIMVVSAAAQVQNGQFTGTITDPSGAAIANAKVTA |
| Ga0209180_104054512 | 3300027846 | Vadose Zone Soil | MKRLQFCLVLLSLLALSLGAFAQIQNGQFTGTVTDP |
| Ga0209283_105722431 | 3300027875 | Vadose Zone Soil | MKKLQFCLVALFLLLMTLSVSAQVQNGQFTGVVTDPSGASIPNAKV |
| Ga0209283_107357501 | 3300027875 | Vadose Zone Soil | MKKLQFCLVFLCLSLLALSAAGQVQNGQFTGVVTDPSGAAI |
| Ga0209590_106676741 | 3300027882 | Vadose Zone Soil | MKKLQFCLVALFLLLMTLSVSAQVQNGQFTGVVTDP |
| Ga0209068_105886572 | 3300027894 | Watersheds | MNKLRFCLVYFSLLVLVLGAAAQVQNGTFTGTVADPSGAAIASAKVTVTS |
| Ga0209698_100370595 | 3300027911 | Watersheds | MRRLQFCLVVFAVLTLSFSVFAQVENGQFTGTVTDP |
| Ga0209698_101399472 | 3300027911 | Watersheds | MKRLQFCLAVFAVLALSFSAFAQVQNGQFTGTVTDPTGAT |
| Ga0209526_103099461 | 3300028047 | Forest Soil | MKRLQFCLAMFAVLTLTFSAFAQVQNGQFTGTVTDPTGAAIANAKVTV |
| Ga0209526_105016711 | 3300028047 | Forest Soil | MKKLQFCLVAFSLLVLAIGSAAQIQNGQFSGTVTDP |
| Ga0209526_106366352 | 3300028047 | Forest Soil | MRKLQLCLLSLSLLALSLEAVAQIQNGAFTGTVTDPSGAAVANA |
| Ga0209526_106809821 | 3300028047 | Forest Soil | MKNSRFCLMLLSLLALSLAAFAQIQNGQFTGTVTDPSG |
| Ga0268265_103618431 | 3300028380 | Switchgrass Rhizosphere | MKKLHLILLSLSLLALSLGAFAQIQNGQFTGTVTDPSGAAIS |
| Ga0268265_113211891 | 3300028380 | Switchgrass Rhizosphere | MKRLQFCLVLLCTLMLALGAFAQVQNGQFTGEITDPSGAAI |
| Ga0302144_102522571 | 3300028560 | Bog | MKRLQFCLVVFAVLALTVSAIAQVQNGQFTGTVTDPTGAAIANAKVT |
| Ga0257175_10632151 | 3300028673 | Soil | MRRLQFCLAVFALLALTCSVFAQVQNGQITGTVTDP |
| Ga0302165_100116731 | 3300028678 | Fen | MKRLQFCLAVFALLALTCSAFAQIQNGQFTGTVTDPTGAA |
| Ga0302163_101348781 | 3300028868 | Fen | MRRLQFCLVVFTVLALSLSAFAQVQNGQFTGTITDPSGAAIA |
| Ga0222749_101735781 | 3300029636 | Soil | MKNLRFCLVCLSVLLLALGGFAQIQNGQFTGTVTDPSGAAI |
| Ga0311329_100774441 | 3300029907 | Bog | MKRLQFCLVVFAVLALTLSAFAQVQNGQFTGTVTDPTGAAIANA |
| Ga0311326_100181945 | 3300029917 | Bog | MKRLQFCLVVFAVLALTLSAFAQVQNGQFTGTVTDPTGAAIAN |
| Ga0311370_110976482 | 3300030503 | Palsa | MKRLQFCLAVFAVLALASSAFAQVQFSQFTGTVTDQTGAAIASAKVTAKNPATDLSL |
| Ga0311372_126880391 | 3300030520 | Palsa | MKRLQFCLAVFAVLALSVSAFAQVQFGQFTGTVTDQTGAAIANAK |
| Ga0310038_101832372 | 3300030707 | Peatlands Soil | MKRLQFCLAVFAVLALSFSVFAQVQNSQFTGTVTDPTGAAIANAKIIVT |
| Ga0073994_123706371 | 3300030991 | Soil | MKRLQFCLAVFAVLALTVSAFSQVQNGQFAGTVTDPTGAAVPN |
| Ga0073994_123943921 | 3300030991 | Soil | MKRLQFCLAVFAVLALTFSAFAQVQNGQFTGTVSDPTGA |
| Ga0265316_103426001 | 3300031344 | Rhizosphere | MRRLQFCLALFAVLALSLSAFAQVQNGQFAGTVTDPTGAAIANA |
| Ga0307468_1018845512 | 3300031740 | Hardwood Forest Soil | MKRLQFCLVLLCTLMLALGAFAQVQNGQFTGEITDPSGAAIANAKVT |
| Ga0307468_1023724431 | 3300031740 | Hardwood Forest Soil | MKRLQFCLVLLSLVALSLSASAQLTNGQFTGTVTDP |
| Ga0307478_111132002 | 3300031823 | Hardwood Forest Soil | MKKLQFCLVLFSVLLLALGAIAQIQNGQFDGTVTDPSGAAIP |
| Ga0311301_115404421 | 3300032160 | Peatlands Soil | MKRLQFCLVVFAVLALTFSAFAQVENGQFSGTVTDQTGAAIANAK |
| Ga0311301_115831271 | 3300032160 | Peatlands Soil | MKRLQFCLVVFAVLALTFSAFAQVQFSQFAGTVLDPTGASIANAKVTVTNPATALRLSAT |
| Ga0335070_111913533 | 3300032829 | Soil | MRRLQFCLAVFAVLALSFSAFAQVQNGQFTGTVTDPS |
| Ga0335076_117417611 | 3300032955 | Soil | MKKLRFCLSLCFVFALALGALAQIQNGQFTGTVTDPSGAAIPNAQITVTN |
| Ga0326726_122213191 | 3300033433 | Peat Soil | MRRLQFCLAAILVVVALGLCASAQVQNGQFTGNVTDPS |
| Ga0316624_113419291 | 3300033486 | Soil | MKRLQFCLVVFAVLALTFSAFAQVQNGQFSGTVLDPTGAAVAGAKITVTSP |
| Ga0370483_0056647_2_121 | 3300034124 | Untreated Peat Soil | MKRLQFCLVVFAVLALTVSAIAQVQNGQFAGTVTDPTGAA |
| ⦗Top⦘ |