| Basic Information | |
|---|---|
| Family ID | F055566 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VEGSVDEMAELREHAAAQAALFNIGVEETETAEESTPGGRIGE |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 69.03 % |
| % of genes near scaffold ends (potentially truncated) | 26.81 % |
| % of genes from short scaffolds (< 2000 bps) | 66.67 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.449 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (24.638 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.884 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (75.362 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.62% β-sheet: 0.00% Coil/Unstructured: 63.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF01165 | Ribosomal_S21 | 47.83 |
| PF00076 | RRM_1 | 14.49 |
| PF00271 | Helicase_C | 10.87 |
| PF00313 | CSD | 2.90 |
| PF13451 | zf-trcl | 0.72 |
| PF17132 | Glyco_hydro_106 | 0.72 |
| PF13557 | Phenol_MetA_deg | 0.72 |
| PF04545 | Sigma70_r4 | 0.72 |
| PF13193 | AMP-binding_C | 0.72 |
| PF01740 | STAS | 0.72 |
| PF08450 | SGL | 0.72 |
| PF07676 | PD40 | 0.72 |
| PF01799 | Fer2_2 | 0.72 |
| PF05598 | DUF772 | 0.72 |
| PF13649 | Methyltransf_25 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 47.83 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.72 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.90 % |
| Unclassified | root | N/A | 47.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005332|Ga0066388_100667528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1652 | Open in IMG/M |
| 3300005537|Ga0070730_10448058 | Not Available | 832 | Open in IMG/M |
| 3300005538|Ga0070731_10556433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 764 | Open in IMG/M |
| 3300005541|Ga0070733_10355291 | Not Available | 972 | Open in IMG/M |
| 3300005764|Ga0066903_100069560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4489 | Open in IMG/M |
| 3300005764|Ga0066903_109113792 | Not Available | 502 | Open in IMG/M |
| 3300006797|Ga0066659_11709021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 531 | Open in IMG/M |
| 3300009826|Ga0123355_10670796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1202 | Open in IMG/M |
| 3300009826|Ga0123355_11121699 | Not Available | 815 | Open in IMG/M |
| 3300010043|Ga0126380_10902462 | Not Available | 734 | Open in IMG/M |
| 3300010046|Ga0126384_10462118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
| 3300010046|Ga0126384_11665988 | Not Available | 602 | Open in IMG/M |
| 3300010048|Ga0126373_10110565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 2556 | Open in IMG/M |
| 3300010048|Ga0126373_10211353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1887 | Open in IMG/M |
| 3300010048|Ga0126373_10451264 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300010048|Ga0126373_10853248 | Not Available | 974 | Open in IMG/M |
| 3300010048|Ga0126373_11536644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300010048|Ga0126373_11798549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 676 | Open in IMG/M |
| 3300010359|Ga0126376_10430202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1199 | Open in IMG/M |
| 3300010359|Ga0126376_10563372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300010361|Ga0126378_12762946 | Not Available | 561 | Open in IMG/M |
| 3300010361|Ga0126378_12966313 | Not Available | 541 | Open in IMG/M |
| 3300010361|Ga0126378_13263285 | Not Available | 516 | Open in IMG/M |
| 3300010366|Ga0126379_10459259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300010366|Ga0126379_10826371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300010366|Ga0126379_11065348 | Not Available | 914 | Open in IMG/M |
| 3300010366|Ga0126379_11709142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 734 | Open in IMG/M |
| 3300010366|Ga0126379_11807879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 715 | Open in IMG/M |
| 3300010366|Ga0126379_12249704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 646 | Open in IMG/M |
| 3300010376|Ga0126381_100680088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1470 | Open in IMG/M |
| 3300010376|Ga0126381_102871362 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300010376|Ga0126381_104033617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300010376|Ga0126381_104055265 | Not Available | 569 | Open in IMG/M |
| 3300010398|Ga0126383_10221158 | Not Available | 1835 | Open in IMG/M |
| 3300010398|Ga0126383_13262460 | Not Available | 530 | Open in IMG/M |
| 3300011120|Ga0150983_10675235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3757 | Open in IMG/M |
| 3300016294|Ga0182041_12158172 | Not Available | 520 | Open in IMG/M |
| 3300016341|Ga0182035_11330720 | Not Available | 644 | Open in IMG/M |
| 3300016357|Ga0182032_10131259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1824 | Open in IMG/M |
| 3300016371|Ga0182034_11246326 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300016387|Ga0182040_10456872 | Not Available | 1013 | Open in IMG/M |
| 3300016404|Ga0182037_11335118 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300016422|Ga0182039_10590249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300016422|Ga0182039_11403781 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300016445|Ga0182038_11059572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300017924|Ga0187820_1073198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300017959|Ga0187779_10000902 | All Organisms → cellular organisms → Bacteria | 19209 | Open in IMG/M |
| 3300017959|Ga0187779_10094058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1799 | Open in IMG/M |
| 3300017959|Ga0187779_10883751 | Not Available | 614 | Open in IMG/M |
| 3300017961|Ga0187778_10025384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3620 | Open in IMG/M |
| 3300017961|Ga0187778_10326525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300017970|Ga0187783_10010964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6663 | Open in IMG/M |
| 3300017970|Ga0187783_10013822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5954 | Open in IMG/M |
| 3300017970|Ga0187783_10048581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3132 | Open in IMG/M |
| 3300017970|Ga0187783_10198862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1472 | Open in IMG/M |
| 3300017972|Ga0187781_10676299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300017972|Ga0187781_11131881 | Not Available | 575 | Open in IMG/M |
| 3300017974|Ga0187777_10228419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1259 | Open in IMG/M |
| 3300017975|Ga0187782_10261076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1303 | Open in IMG/M |
| 3300017975|Ga0187782_10282874 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
| 3300017975|Ga0187782_11318317 | Not Available | 566 | Open in IMG/M |
| 3300018062|Ga0187784_10001055 | All Organisms → cellular organisms → Bacteria | 21451 | Open in IMG/M |
| 3300018062|Ga0187784_10324476 | Not Available | 1249 | Open in IMG/M |
| 3300018062|Ga0187784_10486400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300018062|Ga0187784_11550553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 525 | Open in IMG/M |
| 3300018064|Ga0187773_11079333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 532 | Open in IMG/M |
| 3300018085|Ga0187772_11090958 | Not Available | 585 | Open in IMG/M |
| 3300018086|Ga0187769_10136047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1791 | Open in IMG/M |
| 3300018086|Ga0187769_10279176 | Not Available | 1246 | Open in IMG/M |
| 3300018086|Ga0187769_10581442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300018088|Ga0187771_10474154 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
| 3300018088|Ga0187771_10763076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 820 | Open in IMG/M |
| 3300018090|Ga0187770_10053043 | All Organisms → cellular organisms → Bacteria | 2925 | Open in IMG/M |
| 3300018090|Ga0187770_10354726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1147 | Open in IMG/M |
| 3300018090|Ga0187770_11228272 | Not Available | 606 | Open in IMG/M |
| 3300018482|Ga0066669_10396757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1166 | Open in IMG/M |
| 3300019275|Ga0187798_1102296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2014 | Open in IMG/M |
| 3300020582|Ga0210395_10864660 | Not Available | 673 | Open in IMG/M |
| 3300021178|Ga0210408_11002631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 646 | Open in IMG/M |
| 3300021361|Ga0213872_10043608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2043 | Open in IMG/M |
| 3300021560|Ga0126371_10114832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2706 | Open in IMG/M |
| 3300022522|Ga0242659_1015048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1131 | Open in IMG/M |
| 3300022527|Ga0242664_1043600 | Not Available | 798 | Open in IMG/M |
| 3300026322|Ga0209687_1244513 | Not Available | 556 | Open in IMG/M |
| 3300026325|Ga0209152_10007829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3788 | Open in IMG/M |
| 3300027045|Ga0207726_1010122 | Not Available | 1616 | Open in IMG/M |
| 3300027376|Ga0209004_1094456 | Not Available | 507 | Open in IMG/M |
| 3300027826|Ga0209060_10000722 | All Organisms → cellular organisms → Bacteria | 49449 | Open in IMG/M |
| 3300027842|Ga0209580_10145195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1166 | Open in IMG/M |
| 3300030760|Ga0265762_1002753 | All Organisms → cellular organisms → Bacteria | 3143 | Open in IMG/M |
| 3300031344|Ga0265316_10575015 | Not Available | 800 | Open in IMG/M |
| 3300031546|Ga0318538_10450470 | Not Available | 697 | Open in IMG/M |
| 3300031681|Ga0318572_10215163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 1125 | Open in IMG/M |
| 3300031715|Ga0307476_10016212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4757 | Open in IMG/M |
| 3300031720|Ga0307469_12493151 | Not Available | 505 | Open in IMG/M |
| 3300031781|Ga0318547_10598572 | Not Available | 684 | Open in IMG/M |
| 3300031833|Ga0310917_10652134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 714 | Open in IMG/M |
| 3300031942|Ga0310916_11137035 | Not Available | 648 | Open in IMG/M |
| 3300031945|Ga0310913_11210515 | Not Available | 525 | Open in IMG/M |
| 3300031962|Ga0307479_11707222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 583 | Open in IMG/M |
| 3300032008|Ga0318562_10277520 | Not Available | 974 | Open in IMG/M |
| 3300032055|Ga0318575_10331521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 771 | Open in IMG/M |
| 3300032076|Ga0306924_10726731 | Not Available | 1113 | Open in IMG/M |
| 3300032076|Ga0306924_10800306 | Not Available | 1051 | Open in IMG/M |
| 3300032180|Ga0307471_100980894 | Not Available | 1012 | Open in IMG/M |
| 3300032261|Ga0306920_100144441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3543 | Open in IMG/M |
| 3300032261|Ga0306920_100382450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2093 | Open in IMG/M |
| 3300032783|Ga0335079_11533539 | Not Available | 657 | Open in IMG/M |
| 3300032828|Ga0335080_10634067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1120 | Open in IMG/M |
| 3300033158|Ga0335077_10100470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3393 | Open in IMG/M |
| 3300033289|Ga0310914_11523239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300033977|Ga0314861_0001895 | All Organisms → cellular organisms → Bacteria | 24568 | Open in IMG/M |
| 3300033977|Ga0314861_0191604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 24.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 21.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.17% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 2.17% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.45% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.72% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066388_1006675282 | 3300005332 | Tropical Forest Soil | VEGSVDEMAELREHAAAQAALFNIGVEETETADEARPRAASASDG* |
| Ga0070730_104480582 | 3300005537 | Surface Soil | VDEMAELREHAAAQAALFNIGAEETDTAEESAPDARVGE* |
| Ga0070731_105564331 | 3300005538 | Surface Soil | SDSVDEMAELREHAAAQAALFKIGAEETDTPEESAPDARVGE* |
| Ga0070731_106431853 | 3300005538 | Surface Soil | QEKPAEGGADEMAELREHAAAQAALFNLDTEDVGTADESTGDRAGE* |
| Ga0070733_103552913 | 3300005541 | Surface Soil | KQEKPAEASADEIAELREHAAAQAALFNIGVEDSETAEESTHDGRLGE* |
| Ga0066903_1000695603 | 3300005764 | Tropical Forest Soil | VDGSADEMAELREHAAAQAALFNIGVEKTEAPEESTPSDHSSE* |
| Ga0066903_1079493371 | 3300005764 | Tropical Forest Soil | MGGSEDEMAELRKHAAAQAALFNFGVEETETVRQSTSDERTDQ* |
| Ga0066903_1091137921 | 3300005764 | Tropical Forest Soil | TEGSVDEMAEPNEHAAAQAAPFNIGVEKTETAMESTPMAPSASDS* |
| Ga0075019_107669691 | 3300006086 | Watersheds | VDEMAELREHAAAQAALFNLGVEDSEPAEEPTPSGGNAH* |
| Ga0066659_117090213 | 3300006797 | Soil | KQEKPVESGVDEMAELREHAAAQAALFNIGVEETETAEESTSDRK* |
| Ga0123355_106707962 | 3300009826 | Termite Gut | MAELRENAAAQAELFNIGAEETKTAEESTSEGHIGQ* |
| Ga0123355_111216991 | 3300009826 | Termite Gut | VEGSVDEMAELRENAAAQAALFNIGVEETGTAEESTPDDRISE* |
| Ga0126380_109024622 | 3300010043 | Tropical Forest Soil | MAALRENAAAQAALFSITVKEAETAEESAPSGGRIGN* |
| Ga0126384_104621181 | 3300010046 | Tropical Forest Soil | MAELREHAAAQAALFNIGVKETKIADESTPNGRIGE* |
| Ga0126384_116659882 | 3300010046 | Tropical Forest Soil | VERSVDEMAELREHAAEQAALFNIGVEETETADESTPDDRIAE* |
| Ga0126373_101105653 | 3300010048 | Tropical Forest Soil | VEGSVDEMAELRQHAAAQAALFNVGVEETHAADESTPDGRIGE* |
| Ga0126373_102113531 | 3300010048 | Tropical Forest Soil | MAELHEHAAAQADLFNIGVEKTETAKVSAPDGHIGE* |
| Ga0126373_104512642 | 3300010048 | Tropical Forest Soil | VEGSTDEMAELREHAAAQAALFNIGVEKTESADESRPDDHIVE* |
| Ga0126373_107853792 | 3300010048 | Tropical Forest Soil | VEGSVDEMAELREHAAAQAAPFNIGVKETKIADEFMPK* |
| Ga0126373_108532482 | 3300010048 | Tropical Forest Soil | VEGSADEMAELHEHARAQAALFNLGGETEAAEESTAGDRIGE* |
| Ga0126373_108662413 | 3300010048 | Tropical Forest Soil | MEGSVDEMAELREHAAAQAALFNFGVEETETTQESTPDERTDE* |
| Ga0126373_115366442 | 3300010048 | Tropical Forest Soil | VEGSVDEMAELREHAAAQSALFNIGVEKTETADESTPDGRIGE* |
| Ga0126373_117985492 | 3300010048 | Tropical Forest Soil | VEGSVDEMAELREHAAAQAALFNIGPEESETADYSTPHGRMGE* |
| Ga0126376_104302021 | 3300010359 | Tropical Forest Soil | NQRKQEKPVEGSVDEMAELREHAAAQAALFNMGIEETETADEHTPDGRIGE* |
| Ga0126376_105633722 | 3300010359 | Tropical Forest Soil | MAELREHAAAQAALFNIGAEEDETAEDSTSSERVGE* |
| Ga0126372_111462312 | 3300010360 | Tropical Forest Soil | VEGSVDEMAELREHAAAQAALFNIEVEETEMAEELPGDL* |
| Ga0126378_127629461 | 3300010361 | Tropical Forest Soil | VEGSVDEMAELREHAAAQGALFNIGIEETESVDESTPDGRIGE* |
| Ga0126378_129663131 | 3300010361 | Tropical Forest Soil | VEGSVDEMAELREHAAAQAALFNIGTEETGSADESTPDGRTGE* |
| Ga0126378_132632852 | 3300010361 | Tropical Forest Soil | VEGTVDEMAKLREHAAEQAALFNIGMEETETAEESTPGGRIGE* |
| Ga0126379_103328903 | 3300010366 | Tropical Forest Soil | VEGSVDEMAELREHAAAQAAPFNIGVKETKIADKFMPK* |
| Ga0126379_104592592 | 3300010366 | Tropical Forest Soil | MAALRENAAAQAALFSITVKEAETAEESAPSGRSATDS* |
| Ga0126379_108263711 | 3300010366 | Tropical Forest Soil | MAELREHAAAQGALFNIGMEETESVDESTSDGRIGE* |
| Ga0126379_110653482 | 3300010366 | Tropical Forest Soil | VEGSVDEMVKLREHAAAQAALFNIGAEETESADESTPEGRIGE* |
| Ga0126379_117091421 | 3300010366 | Tropical Forest Soil | KQEKPVEGSVDEMAELREHAAAQAALFNIGPEESETADDSTPHGRMGE* |
| Ga0126379_118078792 | 3300010366 | Tropical Forest Soil | MAELREHAAAQAALFNIGVEETEAAKESTPGSRVSE* |
| Ga0126379_122497042 | 3300010366 | Tropical Forest Soil | VEGSVDEMAELREHAAEQAALFNIGVEETETAEESTRSGRIGE* |
| Ga0126381_1006800883 | 3300010376 | Tropical Forest Soil | VEVGVDEMAELREHAAAQAALFNVFVEETESADESTHGGRIDE* |
| Ga0126381_1028713622 | 3300010376 | Tropical Forest Soil | VEGNVDEMAEPHEHAAAQAALFNIGVEETESADESTPDGRIGE* |
| Ga0126381_1040336171 | 3300010376 | Tropical Forest Soil | VEGSVDEMAELREHAAAQAALFNIGVKETKIADESTPNGRIGE* |
| Ga0126381_1040552652 | 3300010376 | Tropical Forest Soil | VEGNVDEMAELREHAAAQAALFNVGVEETESADKSTHDGRIDD* |
| Ga0126383_102211581 | 3300010398 | Tropical Forest Soil | KPVDGSADEMAELREHAAAQAALFNIGVEKTEAPEESTPSDHSSE* |
| Ga0126383_132624601 | 3300010398 | Tropical Forest Soil | RQDKPVGGSVGDMSELHEHAAAQAGLFNIGVEETETANESTPDDRIGE* |
| Ga0150983_106752354 | 3300011120 | Forest Soil | VEGGADEMAELREHAAAQAALFNIGVEENETAEETTPDERMSQ* |
| Ga0150985_1176004011 | 3300012212 | Avena Fatua Rhizosphere | ADSNVDEMAELREHAAAQAALFNVGFEDSEESSADDSE* |
| Ga0134110_103708932 | 3300012975 | Grasslands Soil | VDEMAELREHAAAQAALFNVGVEDSDESSADDSE* |
| Ga0182036_109889301 | 3300016270 | Soil | GGSVDEMAELREHAAAQAALFNLGAEEADTAEEASPSGRISE |
| Ga0182041_121581721 | 3300016294 | Soil | VEGTVDEMAALREHAAAQAALFNISVEEAETAEESTPGGRI |
| Ga0182033_116050881 | 3300016319 | Soil | QRRQEKPAESSIDEMAELREHSAAQAALLNLGAEDAVTKEKSTGGDQIGE |
| Ga0182035_113307202 | 3300016341 | Soil | VDETAELNEHAAAQAAPFNIGVEKTETAMESTPDGRIGD |
| Ga0182032_101312594 | 3300016357 | Soil | VEGSVDEMAELREHAAAQAALFNLGVEETEAGDESTPDGRIGD |
| Ga0182034_112463263 | 3300016371 | Soil | VEGSVDEMAELREHAAAQAALFNIEVEKTETAEESTPDGRIGE |
| Ga0182040_104568723 | 3300016387 | Soil | MAELREHAAAQAALFNIGMEETEMAEESPGGRIGE |
| Ga0182037_113351181 | 3300016404 | Soil | NQRRQDKPVEGSVDEMAELREHAAAQAALFNIEVEKTETAEESTPDGRIGE |
| Ga0182039_105902492 | 3300016422 | Soil | VEGSVDEMAELREHAAAQAALFNIGPEETEAADDSTPHGRMSE |
| Ga0182039_114037813 | 3300016422 | Soil | EGSVDEMAELREHAAAQAALFNIEVEKTETAEESTPDGRIGE |
| Ga0182038_110595722 | 3300016445 | Soil | QEKPVEGSVDEMAELREHAAAQAALFNIGPEETEAADDSTPHGRMSE |
| Ga0187820_10731982 | 3300017924 | Freshwater Sediment | VEGSVDEMAELREHAAAQAALFNIGVDETETVEESRRDD |
| Ga0187809_101884092 | 3300017937 | Freshwater Sediment | RKNLRKQDQPASDSVDEMAALREHAAAQAALFNIGAEESDTAEESGPDVRVGE |
| Ga0187779_1000090227 | 3300017959 | Tropical Peatland | VEGSVDEMAELRECAAAQAALFNIGVEETEAADESTPDSRIGE |
| Ga0187779_100940583 | 3300017959 | Tropical Peatland | VEGSVDEMAELREHAAAQAALFNIGVEETETAEESTSGGRIGD |
| Ga0187779_108837512 | 3300017959 | Tropical Peatland | MAELREHAAAQAALFNIGPEESETADDSTPHGRMGE |
| Ga0187778_100253842 | 3300017961 | Tropical Peatland | VEGSVDEMAELHEHAAAQAALFNIGVEETEADESTPDGRIGE |
| Ga0187778_103265252 | 3300017961 | Tropical Peatland | VEGSVDEMAELREHAAAQAALFNFGVEETEAADESTLYGRIGE |
| Ga0187783_100109644 | 3300017970 | Tropical Peatland | VEGSVDEMAELREHAAAQAALFNIGVEETEADDSTLDDRIGE |
| Ga0187783_100138229 | 3300017970 | Tropical Peatland | VEGSVDEMAELREHAAAQAALFNIGGKQTETAEESMPAGRIDE |
| Ga0187783_100485812 | 3300017970 | Tropical Peatland | VAGSVDEMAELREHAAAQAALFNIGVEETETADDSTPDGRIGE |
| Ga0187783_101988623 | 3300017970 | Tropical Peatland | VEGSVDEMAELREHAAAQAALFNIGVEETETADDSTPNGRIGE |
| Ga0187781_103248612 | 3300017972 | Tropical Peatland | VEGSVDEMAELREHAAAQAALFNVGVEETESADESIR |
| Ga0187781_106762992 | 3300017972 | Tropical Peatland | VEGSVDEMAELREHAAAQAALFNIGVEETEPTDESTPDGRIGE |
| Ga0187781_111318811 | 3300017972 | Tropical Peatland | SVDEMAELHEHAAAQAALFNIDVEKTETADESTPGGRIGE |
| Ga0187777_102284193 | 3300017974 | Tropical Peatland | RRQEKPVEGSVDEMAELREHAAAQAALFNIGVEETETAEESTSGGRIGD |
| Ga0187782_102610763 | 3300017975 | Tropical Peatland | VEGTVDEMAELREHAAAQAALFNIGVEETETADESTPDGRIGE |
| Ga0187782_102828743 | 3300017975 | Tropical Peatland | VAGSADEMAELREHAAAQAALFNIGAEEAEADESTPDGRIGE |
| Ga0187782_113183172 | 3300017975 | Tropical Peatland | VEGSVDEMAELREHAAAQAALFNIGVEETETADDSKPDGRIGE |
| Ga0187784_1000105525 | 3300018062 | Tropical Peatland | VDGSVDEMAELREHAAAQAALFNIGVEETETAEESTPSDRIGE |
| Ga0187784_103244761 | 3300018062 | Tropical Peatland | RNQRRHEKPVESSVDEMAELREHAAAQAALFNIGREETKTAQESDPDDRRGK |
| Ga0187784_104864002 | 3300018062 | Tropical Peatland | MAELRQHAAAQAALFNIGVEETETAEESTPHGRFGE |
| Ga0187784_115505532 | 3300018062 | Tropical Peatland | VDEMAELRQHAAAQAALFNIGVEETETPDESTPDGRFGE |
| Ga0187773_110793332 | 3300018064 | Tropical Peatland | VVGSADEMAELLEHAAAQAALFNIGVEETETAEEPTPGGKSAGA |
| Ga0187772_110909581 | 3300018085 | Tropical Peatland | DEMAELREHAAAQAALFNIGVEETESADESTPDGRIGE |
| Ga0187769_101360472 | 3300018086 | Tropical Peatland | VECSGDEMAELRAHAAAQAALFNIGVEETETANESMPDGRAGE |
| Ga0187769_102791761 | 3300018086 | Tropical Peatland | VDEMAELREHAAAQAALFNIGVEETETAEESTPSDRIGE |
| Ga0187769_105814421 | 3300018086 | Tropical Peatland | RQEKPVQGSVDEMAELREHAAAQAALFNIGLEETENADESTPDGRIGE |
| Ga0187771_104741542 | 3300018088 | Tropical Peatland | VQGSVDEMAELREHAAAQAALFNIGVEETEPAEESTPGGRIGE |
| Ga0187771_107630762 | 3300018088 | Tropical Peatland | VEGSVDEMAELREHAAAQAALFNVGVEETEAAEESTPDGRFGE |
| Ga0187770_100530434 | 3300018090 | Tropical Peatland | VEGTVDEMAELREHAAAQAALFNIGVEETETPDESTPDGRFGE |
| Ga0187770_103547262 | 3300018090 | Tropical Peatland | VEGSVDEMAELREHAAAQAALFNIGVEETEAADESTPDGRIGE |
| Ga0187770_112282722 | 3300018090 | Tropical Peatland | VEGSVDEMAELREHAAAQAALFNIGVEETESADESSPDSRIGE |
| Ga0066662_106290961 | 3300018468 | Grasslands Soil | VDSNIDEMAELREHAAAQAALFNVGVEDSDESSADDSE |
| Ga0066669_103967573 | 3300018482 | Grasslands Soil | PVESGVDEMAELREHAAAQAALFNIGVEETETAEESTSDRK |
| Ga0187798_11022963 | 3300019275 | Peatland | GSVDEMAELREHAAAQAALFNIGVEETEPVEESTPGGRIGE |
| Ga0210395_108646601 | 3300020582 | Soil | VVGSVDETAALREHAAAQAALFNFTAGDAETAAESTPGGCLATDS |
| Ga0210408_110026313 | 3300021178 | Soil | MAELREHAAAQAALFNIGVEDTEAAEESTADGRGE |
| Ga0213872_100436082 | 3300021361 | Rhizosphere | VEGSVDEMAELREHAAAQAALFNIGVEETGTAEESTPDGRIRE |
| Ga0210386_104359641 | 3300021406 | Soil | LDEMAELREHAAAQAALFNLGVEDPGPADDPMPRTGNRTQS |
| Ga0126371_101148321 | 3300021560 | Tropical Forest Soil | RKQERPVEGSVDEMAELREHAAAQAALFNIGPEESETADYSTPHGRMGE |
| Ga0126371_105613382 | 3300021560 | Tropical Forest Soil | VEGSVDEMAELREHAAAQAAPFNIGVKETKIADEFMPK |
| Ga0126371_114523161 | 3300021560 | Tropical Forest Soil | QEKPVGGSVDEMAELRKHAAAQAALFNFGVEETETVRQSTSDERTDQ |
| Ga0126371_121200392 | 3300021560 | Tropical Forest Soil | QRKQEKPVGGSVDEMAELRKHAAAQAALFNLGGEETETAQESNRDERTDE |
| Ga0242659_10150481 | 3300022522 | Soil | VEGGADEMAELREHAAAQAALFNIGVEENETAEETTPDERMSQ |
| Ga0242664_10436003 | 3300022527 | Soil | VEGGADEMAELREHAAAQAALFNIGVEETETAEESTPDERMSQ |
| Ga0209687_12445131 | 3300026322 | Soil | RKQEKPVESNEDEMAELREHAAAQAALFNHGVDDAGSSDDSTPDGGVGR |
| Ga0209152_100078294 | 3300026325 | Soil | KQEKPVESGVDEMAELREHAAAQAALFNIGVEETETAEESTSDRK |
| Ga0207726_10101222 | 3300027045 | Tropical Forest Soil | VDETAELREHAAAQAALFNVGVEETETAEESTPDGRIGE |
| Ga0209004_10944561 | 3300027376 | Forest Soil | GGVDEMAELREHAAAQAALFNIGVEDNEAAEESTADGSVGE |
| Ga0209060_1000072226 | 3300027826 | Surface Soil | MRKQDKPAPGSVDEMAELREHAAAQAALFNIGAEETDTEESGPDGRIGE |
| Ga0209580_101451951 | 3300027842 | Surface Soil | VESGVDEMAELREHAAAQAALFNIGVEDTEGAEDSTADGRGE |
| Ga0265762_10027531 | 3300030760 | Soil | AEGSVDEMAELREHAAAQAALFNIGADDTETAEESTPHGRGE |
| Ga0265316_105750153 | 3300031344 | Rhizosphere | VEGSVDEMAELREHAAAQKALFNIGVEETDTVEESLPHGRLGD |
| Ga0318538_104504701 | 3300031546 | Soil | VDEIAELHEHAAAQADLFNIGAEKTETVKESTPDGRIGARDS |
| Ga0310915_100789683 | 3300031573 | Soil | VDEMAELREHAAAHAALFNLGAEEADTAEEASPSGRISE |
| Ga0318572_102151631 | 3300031681 | Soil | VDEIAELHEHAAAQADLFNIGVEKTETAKESAPDSHIGE |
| Ga0307476_100162123 | 3300031715 | Hardwood Forest Soil | VEGGADEMAELREHAAAQAALFNIGVEETETAEETTPDERMSQ |
| Ga0307469_124931512 | 3300031720 | Hardwood Forest Soil | VEGSVDEMAELREHAAAQAALFNIGVEDSETVEESTPDGRIGE |
| Ga0318546_106435933 | 3300031771 | Soil | VDEMAELREHAAAQAALFNLGAEEADTADEDSPSGRISE |
| Ga0318547_105985723 | 3300031781 | Soil | QERPVEGSVDEMAELREHAAAQAALFNIGMEETEMAEESPGGRIGE |
| Ga0310917_104937512 | 3300031833 | Soil | QQKALGGSVDEMAELREHAAAHAALFNLGAEEADTAEEASPSGRISE |
| Ga0310917_106521342 | 3300031833 | Soil | KPVEGSVDETAELREHAAEQAALFNIGVEETETAEESTGSGRIGE |
| Ga0310916_111370352 | 3300031942 | Soil | VEGSVDEMAELREHAAAQAALFNIGVEETETPEESTPGGRIDE |
| Ga0310913_112105152 | 3300031945 | Soil | NPVESSVDEMAELREHAAAQAALFNIGVEETETPEESTPGGRIDE |
| Ga0307479_117072222 | 3300031962 | Hardwood Forest Soil | EMAELREHAAAQAALFNIGVEDTEAAEESTADGRGE |
| Ga0318562_102775201 | 3300032008 | Soil | VDEIAELHEHAAAQVDLFNIGAEKTETVKESTPDGRIGARDS |
| Ga0318575_103315211 | 3300032055 | Soil | MAELHEHAATQAELFNIGVEKTETAKESTPDGCIGE |
| Ga0306924_107267311 | 3300032076 | Soil | VEEIAELHEHAAAQADLFNIGAEKTETVKESTPDGRIGARDS |
| Ga0306924_108003062 | 3300032076 | Soil | GSVDEIAELHEHAAAQADLFNIGAEKTETVKESTPDGRIGARDS |
| Ga0307471_1009808942 | 3300032180 | Hardwood Forest Soil | VEGSVDEMAELREHAAAQAALFNIGVEDTETVDESTPDGRIGE |
| Ga0306920_1001444419 | 3300032261 | Soil | VEGSVDEMAELREHAAEQAALFNIGVEETETAEESTGSGRIGE |
| Ga0306920_1003824502 | 3300032261 | Soil | VEGSVDEMAELREHAAAQAALFNIGVEETESTEESTPGGHIGE |
| Ga0335085_115363922 | 3300032770 | Soil | EPVPGSVDEMAELRRHAAEQAALFNVGATEVDTSEEFTSGDQSSD |
| Ga0335079_115335392 | 3300032783 | Soil | VDEMAELREHAAAQAALFNIGAEETDTPVESAPDGRVGK |
| Ga0335080_106340672 | 3300032828 | Soil | MAALREHAAAQAALFNIGAEESDTAEESGPDGRVGE |
| Ga0335084_116779372 | 3300033004 | Soil | QPAPGSADELAELREYAAAQAALFNVGAEEADTAEEAAPGGRVGQ |
| Ga0335077_101004702 | 3300033158 | Soil | VEGSVDEMAELREHAAAQAALFNIGVEETETAEESTPGGRIGE |
| Ga0335077_118396421 | 3300033158 | Soil | QDQPAPGSADELAELREHAAAQAALFNVGAEEVDTAEEAAPDGRFGQ |
| Ga0310914_107801971 | 3300033289 | Soil | VDEMAELREHAAAQAALFNLGAEEADTADEDSPSG |
| Ga0310914_115232392 | 3300033289 | Soil | VEGSVDEMAELREHAAEQAALFNIGVEETETAEES |
| Ga0314861_0001895_6664_6795 | 3300033977 | Peatland | VEGSVDDMAELREHAAAQAALFNFGVEETEAADESTPYGRIGE |
| Ga0314861_0191604_441_572 | 3300033977 | Peatland | VEGSVDEMAELSEHAAAQAALFNIGVEETEAADESTPDGRIRE |
| ⦗Top⦘ |