| Basic Information | |
|---|---|
| Family ID | F055550 |
| Family Type | Metagenome |
| Number of Sequences | 138 |
| Average Sequence Length | 48 residues |
| Representative Sequence | KQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.74 % |
| % of genes near scaffold ends (potentially truncated) | 94.20 % |
| % of genes from short scaffolds (< 2000 bps) | 81.16 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (76.812 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (15.942 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.145 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.145 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.77% β-sheet: 0.00% Coil/Unstructured: 66.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF04860 | Phage_portal | 55.80 |
| PF01391 | Collagen | 7.25 |
| PF04586 | Peptidase_S78 | 2.90 |
| PF01844 | HNH | 1.45 |
| PF13641 | Glyco_tranf_2_3 | 0.72 |
| PF05135 | Phage_connect_1 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 2.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.03 % |
| Unclassified | root | N/A | 7.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002200|metazooDRAFT_1266460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300002306|B570J29618_1009971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300002408|B570J29032_109417889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 749 | Open in IMG/M |
| 3300002408|B570J29032_109780596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1299 | Open in IMG/M |
| 3300002835|B570J40625_101616960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300003411|JGI25911J50253_10163022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 633 | Open in IMG/M |
| 3300003490|JGI25926J51410_1056856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300004096|Ga0066177_10416625 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300004123|Ga0066181_10089433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
| 3300004128|Ga0066180_10350215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 584 | Open in IMG/M |
| 3300005525|Ga0068877_10207436 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300005527|Ga0068876_10013510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5293 | Open in IMG/M |
| 3300005527|Ga0068876_10084869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1897 | Open in IMG/M |
| 3300005584|Ga0049082_10090816 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300005662|Ga0078894_10199239 | All Organisms → Viruses → Predicted Viral | 1812 | Open in IMG/M |
| 3300005805|Ga0079957_1285994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 748 | Open in IMG/M |
| 3300006802|Ga0070749_10507160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300006805|Ga0075464_10803325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 585 | Open in IMG/M |
| 3300006863|Ga0075459_1024146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1014 | Open in IMG/M |
| 3300006863|Ga0075459_1054831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 673 | Open in IMG/M |
| 3300007363|Ga0075458_10124902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 799 | Open in IMG/M |
| 3300007363|Ga0075458_10265811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 521 | Open in IMG/M |
| 3300007516|Ga0105050_10536181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 688 | Open in IMG/M |
| 3300007559|Ga0102828_1137838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 608 | Open in IMG/M |
| 3300007627|Ga0102869_1142244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 648 | Open in IMG/M |
| 3300007642|Ga0102876_1158208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 605 | Open in IMG/M |
| 3300008055|Ga0108970_11052060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 831 | Open in IMG/M |
| 3300008108|Ga0114341_10013249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11027 | Open in IMG/M |
| 3300008110|Ga0114343_1166604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 682 | Open in IMG/M |
| 3300008111|Ga0114344_1007057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4770 | Open in IMG/M |
| 3300008111|Ga0114344_1007917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5558 | Open in IMG/M |
| 3300008116|Ga0114350_1098100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 932 | Open in IMG/M |
| 3300008262|Ga0114337_1010833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6159 | Open in IMG/M |
| 3300008263|Ga0114349_1006036 | All Organisms → cellular organisms → Bacteria | 11569 | Open in IMG/M |
| 3300008266|Ga0114363_1136770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 830 | Open in IMG/M |
| 3300008266|Ga0114363_1232197 | Not Available | 536 | Open in IMG/M |
| 3300008450|Ga0114880_1041809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1985 | Open in IMG/M |
| 3300009085|Ga0105103_10408350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 752 | Open in IMG/M |
| 3300009152|Ga0114980_10031443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3280 | Open in IMG/M |
| 3300009152|Ga0114980_10473496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 715 | Open in IMG/M |
| 3300009155|Ga0114968_10335923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 837 | Open in IMG/M |
| 3300009155|Ga0114968_10413483 | Not Available | 734 | Open in IMG/M |
| 3300009158|Ga0114977_10099698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1762 | Open in IMG/M |
| 3300009163|Ga0114970_10222118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1103 | Open in IMG/M |
| 3300009163|Ga0114970_10521099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 647 | Open in IMG/M |
| 3300009164|Ga0114975_10106662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1619 | Open in IMG/M |
| 3300009169|Ga0105097_10197285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1108 | Open in IMG/M |
| 3300009170|Ga0105096_10543637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 607 | Open in IMG/M |
| 3300009180|Ga0114979_10082259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1998 | Open in IMG/M |
| 3300009184|Ga0114976_10188916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1139 | Open in IMG/M |
| 3300010160|Ga0114967_10558770 | Not Available | 553 | Open in IMG/M |
| 3300010354|Ga0129333_10132490 | All Organisms → Viruses → Predicted Viral | 2292 | Open in IMG/M |
| 3300010354|Ga0129333_10724651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
| 3300010370|Ga0129336_10122480 | All Organisms → Viruses → Predicted Viral | 1515 | Open in IMG/M |
| 3300010370|Ga0129336_10296552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 900 | Open in IMG/M |
| 3300010370|Ga0129336_10627340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300010885|Ga0133913_11560521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1668 | Open in IMG/M |
| 3300010885|Ga0133913_13565746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1012 | Open in IMG/M |
| 3300013005|Ga0164292_11068136 | Not Available | 501 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10032065 | All Organisms → cellular organisms → Bacteria | 4558 | Open in IMG/M |
| 3300013372|Ga0177922_10247284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 689 | Open in IMG/M |
| 3300013372|Ga0177922_11102007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 884 | Open in IMG/M |
| 3300014050|Ga0119952_1130222 | Not Available | 557 | Open in IMG/M |
| 3300017722|Ga0181347_1140372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 665 | Open in IMG/M |
| 3300017723|Ga0181362_1124524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 504 | Open in IMG/M |
| 3300017774|Ga0181358_1256963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 547 | Open in IMG/M |
| 3300017778|Ga0181349_1068683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1363 | Open in IMG/M |
| 3300019784|Ga0181359_1060999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1444 | Open in IMG/M |
| 3300019784|Ga0181359_1076509 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300020190|Ga0194118_10063935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2361 | Open in IMG/M |
| 3300020530|Ga0208235_1023381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300020536|Ga0207939_1001798 | All Organisms → cellular organisms → Bacteria | 4923 | Open in IMG/M |
| 3300020539|Ga0207941_1021501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 948 | Open in IMG/M |
| 3300020557|Ga0208231_1042193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300020570|Ga0208465_1035461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 639 | Open in IMG/M |
| 3300021956|Ga0213922_1102470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 577 | Open in IMG/M |
| 3300021962|Ga0222713_10037287 | All Organisms → cellular organisms → Bacteria | 3837 | Open in IMG/M |
| 3300021963|Ga0222712_10549873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 674 | Open in IMG/M |
| 3300022407|Ga0181351_1206089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 652 | Open in IMG/M |
| 3300023174|Ga0214921_10085781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2455 | Open in IMG/M |
| 3300023179|Ga0214923_10197753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1189 | Open in IMG/M |
| 3300024262|Ga0210003_1110710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1232 | Open in IMG/M |
| 3300024346|Ga0244775_10466103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1034 | Open in IMG/M |
| 3300024346|Ga0244775_11001263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300025687|Ga0208019_1109192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
| 3300025896|Ga0208916_10210031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
| 3300025896|Ga0208916_10389956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 608 | Open in IMG/M |
| 3300027138|Ga0255064_1005955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2293 | Open in IMG/M |
| 3300027492|Ga0255093_1054773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300027631|Ga0208133_1105143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300027644|Ga0209356_1086502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
| 3300027707|Ga0209443_1114981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1007 | Open in IMG/M |
| 3300027733|Ga0209297_1092028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1309 | Open in IMG/M |
| 3300027734|Ga0209087_1012552 | All Organisms → cellular organisms → Bacteria | 4293 | Open in IMG/M |
| 3300027736|Ga0209190_1189219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300027744|Ga0209355_1046431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2123 | Open in IMG/M |
| 3300027756|Ga0209444_10105756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1142 | Open in IMG/M |
| 3300027764|Ga0209134_10262039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 591 | Open in IMG/M |
| 3300027782|Ga0209500_10132875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1191 | Open in IMG/M |
| 3300027785|Ga0209246_10272967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300027797|Ga0209107_10533343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 517 | Open in IMG/M |
| 3300027899|Ga0209668_10559170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 762 | Open in IMG/M |
| 3300027963|Ga0209400_1025216 | All Organisms → cellular organisms → Bacteria | 3396 | Open in IMG/M |
| 3300027963|Ga0209400_1245841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300027969|Ga0209191_1097660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1257 | Open in IMG/M |
| 3300027973|Ga0209298_10066999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1628 | Open in IMG/M |
| 3300027973|Ga0209298_10271248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 670 | Open in IMG/M |
| 3300028025|Ga0247723_1000358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31485 | Open in IMG/M |
| 3300028025|Ga0247723_1008519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4218 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1156064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
| 3300031758|Ga0315907_10007594 | All Organisms → cellular organisms → Bacteria | 11282 | Open in IMG/M |
| 3300031758|Ga0315907_10382429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1138 | Open in IMG/M |
| 3300031857|Ga0315909_10329907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1125 | Open in IMG/M |
| 3300031951|Ga0315904_10091869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3216 | Open in IMG/M |
| 3300031951|Ga0315904_11018303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300031963|Ga0315901_10278936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1396 | Open in IMG/M |
| 3300031963|Ga0315901_10729525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300032092|Ga0315905_10631652 | Not Available | 962 | Open in IMG/M |
| 3300032093|Ga0315902_10508417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1045 | Open in IMG/M |
| 3300032116|Ga0315903_10408336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1103 | Open in IMG/M |
| 3300033981|Ga0334982_0190215 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300033996|Ga0334979_0165767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1325 | Open in IMG/M |
| 3300034012|Ga0334986_0016951 | All Organisms → cellular organisms → Bacteria | 5039 | Open in IMG/M |
| 3300034019|Ga0334998_0385743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
| 3300034020|Ga0335002_0324922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
| 3300034061|Ga0334987_0170518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1567 | Open in IMG/M |
| 3300034061|Ga0334987_0631099 | Not Available | 627 | Open in IMG/M |
| 3300034062|Ga0334995_0069297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2784 | Open in IMG/M |
| 3300034071|Ga0335028_0173499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1355 | Open in IMG/M |
| 3300034101|Ga0335027_0652080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 632 | Open in IMG/M |
| 3300034106|Ga0335036_0438861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 829 | Open in IMG/M |
| 3300034106|Ga0335036_0750442 | Not Available | 571 | Open in IMG/M |
| 3300034106|Ga0335036_0892114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 505 | Open in IMG/M |
| 3300034107|Ga0335037_0073025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1856 | Open in IMG/M |
| 3300034112|Ga0335066_0595938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 572 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.22% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 15.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.94% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.25% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.25% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.62% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.17% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.17% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.17% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.17% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.45% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.45% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.45% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.72% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.72% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.72% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.72% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.72% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.72% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002200 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - APR 2013 | Environmental | Open in IMG/M |
| 3300002306 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004123 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020557 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027492 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| metazooDRAFT_12664603 | 3300002200 | Lake | RRKVDAAVAAIFGYDRATQPPPPKAPVAKFFSIQV* |
| B570J29618_10099713 | 3300002306 | Freshwater | ANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPAPKEPVAKYFSIQV* |
| B570J29032_1094178893 | 3300002408 | Freshwater | RHVANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV* |
| B570J29032_1097805961 | 3300002408 | Freshwater | RLARHITNCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV |
| B570J40625_1016169601 | 3300002835 | Freshwater | VTKQSSRGVMVSKSNSKRKIDAAVAAIFGYDRATAAPEPKAPVPKFFSLNL* |
| JGI25911J50253_101630222 | 3300003411 | Freshwater Lake | SSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPLTRYFTIQV* |
| JGI25926J51410_10568563 | 3300003490 | Freshwater Lake | KASSKRKVDAAVASIFGYDRATQPAEPKKPVARFFSLEL* |
| Ga0066177_104166251 | 3300004096 | Freshwater Lake | ISNCVTKQSSRGVMVAKASSKRKVDAAVASIFGYDRATQPAEPKKPVARFFSLEL* |
| Ga0066181_100894334 | 3300004123 | Freshwater Lake | AKASSRRKVDAAVASIFGYDRATQPPEPKEPVARYFSIQV* |
| Ga0066180_103502152 | 3300004128 | Freshwater Lake | KQSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPLTRYFTIQV* |
| Ga0068877_102074363 | 3300005525 | Freshwater Lake | VMVAKASSRRKVDAAVASIFGYDRATQPAPPKPPTARYFSIQV* |
| Ga0068876_100135101 | 3300005527 | Freshwater Lake | ANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAKPPPPVARYFSIQV* |
| Ga0068876_100848691 | 3300005527 | Freshwater Lake | ANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV* |
| Ga0049082_100908163 | 3300005584 | Freshwater Lentic | KQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPVVKYFSIQV* |
| Ga0078894_101992391 | 3300005662 | Freshwater Lake | DERLARHIANTVTKTSSRGIMVAKATNKRKIDAAVAAIFGYDRATAPKPPKQPVARFHSI |
| Ga0079957_12859943 | 3300005805 | Lake | VMVSKASSRRKIDAAVAAIFGYDRATAAPEPKPPVTRFFSIQA* |
| Ga0070749_105071601 | 3300006802 | Aqueous | TSSRGIMVAKATNKRKIDAAVAAIFGYDRATAPKPPKQPTARIHFV* |
| Ga0075464_108033251 | 3300006805 | Aqueous | KASSRRKVDAAVAAIFGYDRATQPPEPKAPVTRYFSVQV* |
| Ga0075459_10241461 | 3300006863 | Aqueous | VTKTSSRGIMVAKATNKRKIDAAVAAIFGYDRATAPKPPKQPVARFHSI* |
| Ga0075459_10548313 | 3300006863 | Aqueous | VMVAKASARRKVDAAVAAIFGYDRATQPPPPKQPVARFFSIQV* |
| Ga0075458_101249021 | 3300007363 | Aqueous | NCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV* |
| Ga0075458_102658113 | 3300007363 | Aqueous | KASARRKVDAAVAAIFGYDRATQPPPPKQPVARFFSIQV* |
| Ga0105050_105361812 | 3300007516 | Freshwater | TSSRGTMVAKANNKRKIDSAVAAIFGYDRATQPAAPKKPIARFYSS* |
| Ga0102828_11378381 | 3300007559 | Estuarine | SSRGVMVAKASSKRKVDAAVAAIFGYDRATQPAEPKPPVARFFSVQL* |
| Ga0102869_11422443 | 3300007627 | Estuarine | VAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV* |
| Ga0102876_11582083 | 3300007642 | Estuarine | GVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARYFSIQV* |
| Ga0108970_110520601 | 3300008055 | Estuary | ITNCVTKQSSRGVRVAKASSKRKVDAAVAAIFGYDRATQPPEPKPPVARFFSVQL* |
| Ga0114341_100132491 | 3300008108 | Freshwater, Plankton | NCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV* |
| Ga0114343_11666043 | 3300008110 | Freshwater, Plankton | IANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV* |
| Ga0114344_10070571 | 3300008111 | Freshwater, Plankton | KQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV* |
| Ga0114344_10079171 | 3300008111 | Freshwater, Plankton | KQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPPPVARYFSIQV* |
| Ga0114350_10981001 | 3300008116 | Freshwater, Plankton | VAKASSGRKVDAAVASIFGYDRATQPAEPTPPVARFFSIQV* |
| Ga0114841_11176161 | 3300008259 | Freshwater, Plankton | AKATNKRKIDAAVAAIFGYDRATAPKPKPVVPRIHFV* |
| Ga0114337_10108331 | 3300008262 | Freshwater, Plankton | CVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV* |
| Ga0114349_10060363 | 3300008263 | Freshwater, Plankton | MNNCVTKQSSRGVMVSKSNSKRKIDAAVASIFGYDRATSAPEAKAPVPKFFSLNL* |
| Ga0114363_11367703 | 3300008266 | Freshwater, Plankton | HIANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAPPKPPTPRYFSIQV* |
| Ga0114363_12321971 | 3300008266 | Freshwater, Plankton | VAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV* |
| Ga0114880_10418093 | 3300008450 | Freshwater Lake | RHIANCVTKQSSRGVMVAKASSKRKVDAAVAAIFGYDRATQPAEPKKPVARFFSLDLGAK |
| Ga0105103_104083501 | 3300009085 | Freshwater Sediment | VAKASSRRKVDAAVASIFGYDRATQPPEPKAPVSKYFSIQV* |
| Ga0114980_100314436 | 3300009152 | Freshwater Lake | KQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV* |
| Ga0114980_104734963 | 3300009152 | Freshwater Lake | VMVAKASSKRKVDAAVASIFGYDRATRPPEPKAPVTRFFSIDI* |
| Ga0114968_103359233 | 3300009155 | Freshwater Lake | MARHIANCVTKQSSRGVMVAKASSKRKVDAAVAAIFGYDRATQPAEPKKPVARFFSLDLGAK* |
| Ga0114968_104134833 | 3300009155 | Freshwater Lake | SRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV* |
| Ga0114977_100996984 | 3300009158 | Freshwater Lake | GVMVAKASSKRKVDAAVAAIFGYDRATQPAEPKPPVARFFSVQL* |
| Ga0114970_102221181 | 3300009163 | Freshwater Lake | NCVTKQSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPLTRYFTIQV* |
| Ga0114970_105210991 | 3300009163 | Freshwater Lake | NCVTKQSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPITRYFSVQV* |
| Ga0114975_101066621 | 3300009164 | Freshwater Lake | SSKRKVDAAVAAIFGYDRATQPPELKPPVARFFSVQL* |
| Ga0105097_101972851 | 3300009169 | Freshwater Sediment | RKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV* |
| Ga0105096_105436373 | 3300009170 | Freshwater Sediment | RRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV* |
| Ga0114979_100822594 | 3300009180 | Freshwater Lake | ARHIANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV* |
| Ga0114976_101889163 | 3300009184 | Freshwater Lake | RHVANCVTKQSSRGVMVAKASSKRKVDAAVASIFGYDRATRPPEPKAPVTRFFSIDI* |
| Ga0114967_105587701 | 3300010160 | Freshwater Lake | SSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV* |
| Ga0129333_101324901 | 3300010354 | Freshwater To Marine Saline Gradient | KTSSRGIMVAKATNKRKIDAAVAAIFGYDRATAPKPPKQPTARIHFV* |
| Ga0129333_107246513 | 3300010354 | Freshwater To Marine Saline Gradient | SARRKVDAAVAAIFGYDRATQPPPPKQPVAKFFSIQV* |
| Ga0129336_101224803 | 3300010370 | Freshwater To Marine Saline Gradient | VTKQSSRGVMVAKASARRKVDAAVAAIFGYDRATQPAPPKAPVPRFYSIRV* |
| Ga0129336_102965524 | 3300010370 | Freshwater To Marine Saline Gradient | GDERLARHIANTVTKTSSRGIMVAKATNKRKIDAAVAAIFGYDRATAPKPPKQPVARFHSI* |
| Ga0129336_106273401 | 3300010370 | Freshwater To Marine Saline Gradient | TKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAPPKPPTARYFSIQV* |
| Ga0133913_115605213 | 3300010885 | Freshwater Lake | ARHIANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPLEPAKPVAKFFSIQV* |
| Ga0133913_135657463 | 3300010885 | Freshwater Lake | QSSRGVMVAKASSKRKVDAAVAAIFGYDRATQPPEPKPPVARFFSVQL* |
| Ga0164292_110681361 | 3300013005 | Freshwater | NCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPVSKYFSIQV* |
| (restricted) Ga0172367_100320655 | 3300013126 | Freshwater | VTKQSSRGVMVAKASARRKVDAAVAAIFGYDRATQPQPPKPPVAQFFSIQV* |
| Ga0177922_102472843 | 3300013372 | Freshwater | VANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPPPVARFFSIQV* |
| Ga0177922_111020074 | 3300013372 | Freshwater | ASSRRKVDAAVASIFGYDRATQPPEPKAPVSKYFSIQV* |
| Ga0119952_11302221 | 3300014050 | Freshwater | KASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFSIQV* |
| Ga0181347_11403721 | 3300017722 | Freshwater Lake | RHVANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV |
| Ga0181362_11245241 | 3300017723 | Freshwater Lake | VMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPVVKYFSIQV |
| Ga0181358_12569631 | 3300017774 | Freshwater Lake | SRRKVDAAVAAIFGYDRATQPPEPKAPITRYFSVQV |
| Ga0181349_10686831 | 3300017778 | Freshwater Lake | ERLARHITNCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQ |
| Ga0169931_106175683 | 3300017788 | Freshwater | HINNSVTKTSSRGIMIAKANNKRKIDGAVAAIFSFDRAMAPVPKKPTPRVHFI |
| Ga0181359_10609991 | 3300019784 | Freshwater Lake | RRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV |
| Ga0181359_10765091 | 3300019784 | Freshwater Lake | GDERLARHVANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPLTPPPPVARFFSIQV |
| Ga0194118_100639354 | 3300020190 | Freshwater Lake | ARHISNCVTKQSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPVTRYFSIQV |
| Ga0194119_101653081 | 3300020220 | Freshwater Lake | GNANLNQHINNSVTKTSSRGIMIAKANNKRKIDGAVAAIFSFDRAMAPVPKKPTPRVHFI |
| Ga0208235_10233813 | 3300020530 | Freshwater | GVMVAKASSRRKVDAAVASIFGYDRATQPAPPKPPTARYFSIQV |
| Ga0207939_10017987 | 3300020536 | Freshwater | HITNCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPVSKYFSIQV |
| Ga0207941_10215013 | 3300020539 | Freshwater | SRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV |
| Ga0208231_10421931 | 3300020557 | Freshwater | VMVAKASSRRKVDAAVASIFGYDRATQPPAPKEPVAKYFSIQV |
| Ga0208465_10354611 | 3300020570 | Freshwater | SKSNSKRKIDAAVAAIFGYDRATAAPEPKAPVPKFFSLNL |
| Ga0213922_11024701 | 3300021956 | Freshwater | VAKASSRRKVDAAVASIFGYDRATQPAEPLPPVAKFFSIQV |
| Ga0222713_100372871 | 3300021962 | Estuarine Water | ASSKRKVDAAVAAIFGYDRATQPIEKQPVTRYFSIQS |
| Ga0222712_105498731 | 3300021963 | Estuarine Water | VTKQSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPLTKYFSIQV |
| Ga0181351_12060891 | 3300022407 | Freshwater Lake | KASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV |
| Ga0214921_100857811 | 3300023174 | Freshwater | RRKVDAAVAAIFGYDRATQPPEPKAPLTRYFSIQV |
| Ga0214923_101977533 | 3300023179 | Freshwater | VAKASSRRKVDAAVAAIFGYDRATQPPEPKAPLTRYFSIQV |
| Ga0210003_11107101 | 3300024262 | Deep Subsurface | VTKQSSRGVMVAKASARRKVDAAVASIFGYDRATQPPPPKAPVAKFFSIQV |
| Ga0244775_104661033 | 3300024346 | Estuarine | CVTKQSSRGSMVAKASAKRKVDAAVAAIFGYDRATQPPPPKAPIAKFFSIQV |
| Ga0244775_110012631 | 3300024346 | Estuarine | RGVMVAKASSRRKVDAAVASIFGYDRATQPPGPKEPVARYFSIQV |
| Ga0208019_11091923 | 3300025687 | Aqueous | DGNEGLARHVANCVTKQSSRGVMVAKASARRKVDAAVAAIFGYDRATQPPPPKEPTARFFSIQV |
| Ga0208916_102100311 | 3300025896 | Aqueous | VAKASSKRKVDAAVAAIFGYDRATQPAEPKKPVARFFSLDLGAK |
| Ga0208916_103899561 | 3300025896 | Aqueous | QSSRGVMVAKASARRKVDAAVAAIFGYDRATQPPPPKQPVARFFSIQV |
| Ga0255064_10059554 | 3300027138 | Freshwater | IANCVTKQSSRGSMVAKASAKRKVDAAVAAIFGYDRATQPPPPKAPIAKFFSIQV |
| Ga0255093_10547732 | 3300027492 | Freshwater | VTKQSSRGSMVAKASAKRKVDAAVAAIFGYDRATQPPPPKAPIAKFFSIQV |
| Ga0208133_11051431 | 3300027631 | Estuarine | KQSSRGSMVAKASAKRKVDAAVAAIFGYDRATQPPPPKAPIAKFFSIQV |
| Ga0209356_10865021 | 3300027644 | Freshwater Lake | ASSKRKVDAAVAAIFGYDRATQPPEPKPPVARFFSVQL |
| Ga0209443_11149813 | 3300027707 | Freshwater Lake | KQSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPLTRYFTIQV |
| Ga0209297_10920281 | 3300027733 | Freshwater Lake | GVMVAKASSKRKVDAAVAAIFGYDRATQPAEPKPPVARFFSVQL |
| Ga0209087_10125528 | 3300027734 | Freshwater Lake | RHISNCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV |
| Ga0209190_11892191 | 3300027736 | Freshwater Lake | VMVAKASSKRKVDAAVAAIFGYDRATQPAEPKPPVARFFSVQL |
| Ga0209355_10464311 | 3300027744 | Freshwater Lake | MVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPLTRYFTIQV |
| Ga0209444_101057563 | 3300027756 | Freshwater Lake | TKQSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPLTRYFTIQV |
| Ga0209134_102620393 | 3300027764 | Freshwater Lake | VTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPATPPPPVARFFSIQV |
| Ga0209500_101328753 | 3300027782 | Freshwater Lake | TKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV |
| Ga0209246_102729671 | 3300027785 | Freshwater Lake | VTKQPSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKEPVARYFSIQV |
| Ga0209107_105333431 | 3300027797 | Freshwater And Sediment | PRHISNCVTKQSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPVVKYFSIQV |
| Ga0209668_105591701 | 3300027899 | Freshwater Lake Sediment | SRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVAKFFSFQA |
| Ga0209400_10252166 | 3300027963 | Freshwater Lake | VAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV |
| Ga0209400_12458413 | 3300027963 | Freshwater Lake | TKQSSRGVMVAKASSKRKVDAAVAAIFGYDRATQPAEPKKPVARFFSLDLGAK |
| Ga0209191_10976603 | 3300027969 | Freshwater Lake | TNCVTKQSSRGVMVAKASSKRKVDAAVAAIFGYDRATQPPELKPPVARFFSVQL |
| Ga0209298_100669991 | 3300027973 | Freshwater Lake | MVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV |
| Ga0209298_102712481 | 3300027973 | Freshwater Lake | ANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPLEPAKPVAKFFSIQV |
| Ga0247723_10003581 | 3300028025 | Deep Subsurface Sediment | VANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPLEPLPPVTRFFSIQV |
| Ga0247723_10085195 | 3300028025 | Deep Subsurface Sediment | SKRKVDAAVAAIFGYDRATQPAEPKPPVARFFSVQL |
| (restricted) Ga0247843_11560641 | 3300028569 | Freshwater | KQSSRGVMVAKASSKRKVDAAVAAIFGYDRATQPPEPKSPVARFFSVQL |
| Ga0315907_1000759413 | 3300031758 | Freshwater | TKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPQPKEPVARYFSIQV |
| Ga0315907_103824293 | 3300031758 | Freshwater | ARHVANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPPPVARFFSIQV |
| Ga0315909_103299071 | 3300031857 | Freshwater | CVTKQSSRGLMVAKASARRKVDAAVAAIFGYDRATQPPPPKAPVAKFFSIQV |
| Ga0315904_100918695 | 3300031951 | Freshwater | RGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV |
| Ga0315904_110183033 | 3300031951 | Freshwater | GDERLARHIANTVTKTSSRGIMVAKATNKRKIDAAVAAIFGYDRATAPVPKPVVARFHSI |
| Ga0315901_102789363 | 3300031963 | Freshwater | MVAKASSRRKVDAAVASIFGYDRATQPAPPKPPTARYFSIQV |
| Ga0315901_107295251 | 3300031963 | Freshwater | KASSRRKVDAAVASIFGYDRATQPAPPKPPTARYFSIQV |
| Ga0315905_106316521 | 3300032092 | Freshwater | SRGLMVAKATNKRKIDAAVAAIFGYDRATAPKPKPVVPRIHFV |
| Ga0315902_105084171 | 3300032093 | Freshwater | AKASSRRKVDAAVASIFGYDRATQPPQPKEPVARYFSIQV |
| Ga0315903_104083363 | 3300032116 | Freshwater | MVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV |
| Ga0334982_0190215_892_1020 | 3300033981 | Freshwater | MVAKASSRRKVDAAVASIFGYDRATQPPAPKEPVAKYFSIQV |
| Ga0334979_0165767_1178_1324 | 3300033996 | Freshwater | QSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAPPKPPTARYFSIQV |
| Ga0334986_0016951_4846_5013 | 3300034012 | Freshwater | MNNCVTKQSSRGVMVSKSNSKRKIDAAVASIFGYDRATSAPEAKAPVPKFFSLNL |
| Ga0334998_0385743_31_159 | 3300034019 | Freshwater | MVSKSNSKRKIDAAVASIFGYDRATSAPEAKAPVPKFFSLNL |
| Ga0335002_0324922_2_109 | 3300034020 | Freshwater | VDAAVAAIFGYDRATQPAEPKKPVARFFSLDLGAK |
| Ga0334987_0170518_3_194 | 3300034061 | Freshwater | GDERLARHIANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAPPKPPTPRYFSIQV |
| Ga0334987_0631099_509_625 | 3300034061 | Freshwater | ASSRRKVDAAVASIFGYDRATQPPEPKAPVSKYFSIQV |
| Ga0334995_0069297_2594_2782 | 3300034062 | Freshwater | DERLARHITNCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV |
| Ga0335028_0173499_1211_1339 | 3300034071 | Freshwater | MVAKASSRRKVDAAVASIFGYDRATQPPEPKAPVSKYFSIQV |
| Ga0335027_0652080_3_182 | 3300034101 | Freshwater | LARHITNCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPVSKYFSIQV |
| Ga0335036_0438861_710_829 | 3300034106 | Freshwater | KASSRRKVDAAVASIFGYDRATQPLEPLPPITRFFSIQV |
| Ga0335036_0750442_1_123 | 3300034106 | Freshwater | AKASSRRKVDAAVASIFGYDRATQPPEPKAPVSKYFSIQV |
| Ga0335036_0892114_2_121 | 3300034106 | Freshwater | VAKATNKRKIDAAVAAIFGYDRATAPKPPKQPVARFHSI |
| Ga0335037_0073025_1686_1856 | 3300034107 | Freshwater | HIANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAPPKPPTPRYFSIQV |
| Ga0335066_0595938_1_114 | 3300034112 | Freshwater | KATNKRKIDAAVAAIFGYDRATAPKPPKQPVARFHSI |
| ⦗Top⦘ |