Basic Information | |
---|---|
Family ID | F055548 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 138 |
Average Sequence Length | 46 residues |
Representative Sequence | FAKRVANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 138 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.55 % |
% of genes from short scaffolds (< 2000 bps) | 88.41 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (36.232 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.464 % of family members) |
Environment Ontology (ENVO) | Unclassified (55.797 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (61.594 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.66% β-sheet: 0.00% Coil/Unstructured: 75.34% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 138 Family Scaffolds |
---|---|---|
PF07659 | DUF1599 | 47.83 |
PF04545 | Sigma70_r4 | 7.97 |
PF05869 | Dam | 3.62 |
PF00145 | DNA_methylase | 2.90 |
PF01844 | HNH | 2.90 |
PF11397 | GlcNAc | 2.90 |
PF02767 | DNA_pol3_beta_2 | 1.45 |
PF02945 | Endonuclease_7 | 1.45 |
PF01555 | N6_N4_Mtase | 0.72 |
PF13578 | Methyltransf_24 | 0.72 |
PF09723 | Zn-ribbon_8 | 0.72 |
COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 2.90 |
COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 1.45 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.72 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.72 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 76.09 % |
Unclassified | root | N/A | 23.91 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002161|JGI24766J26685_10125105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
3300003393|JGI25909J50240_1026568 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
3300003986|Ga0063233_10269304 | Not Available | 528 | Open in IMG/M |
3300004096|Ga0066177_10045791 | All Organisms → Viruses → Predicted Viral | 1531 | Open in IMG/M |
3300004124|Ga0066178_10245723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
3300004461|Ga0066223_1022149 | All Organisms → Viruses → Predicted Viral | 3240 | Open in IMG/M |
3300004481|Ga0069718_10014634 | Not Available | 606 | Open in IMG/M |
3300005527|Ga0068876_10508857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
3300005662|Ga0078894_11411481 | Not Available | 581 | Open in IMG/M |
3300006802|Ga0070749_10593834 | Not Available | 597 | Open in IMG/M |
3300006805|Ga0075464_10897377 | Not Available | 553 | Open in IMG/M |
3300006920|Ga0070748_1291438 | Not Available | 581 | Open in IMG/M |
3300007992|Ga0105748_10093258 | All Organisms → Viruses → Predicted Viral | 1199 | Open in IMG/M |
3300008107|Ga0114340_1005825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6517 | Open in IMG/M |
3300008107|Ga0114340_1068477 | All Organisms → Viruses → Predicted Viral | 1501 | Open in IMG/M |
3300008108|Ga0114341_10398052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300008108|Ga0114341_10414237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
3300008108|Ga0114341_10428568 | Not Available | 628 | Open in IMG/M |
3300008110|Ga0114343_1048539 | All Organisms → Viruses → Predicted Viral | 1654 | Open in IMG/M |
3300008110|Ga0114343_1175739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
3300008110|Ga0114343_1181627 | Not Available | 632 | Open in IMG/M |
3300008113|Ga0114346_1079120 | All Organisms → Viruses → Predicted Viral | 1555 | Open in IMG/M |
3300008113|Ga0114346_1197914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
3300008116|Ga0114350_1008523 | All Organisms → Viruses → Predicted Viral | 4754 | Open in IMG/M |
3300008116|Ga0114350_1033912 | All Organisms → Viruses → Predicted Viral | 1994 | Open in IMG/M |
3300008120|Ga0114355_1097500 | All Organisms → Viruses → Predicted Viral | 1164 | Open in IMG/M |
3300008261|Ga0114336_1075069 | All Organisms → Viruses → Predicted Viral | 2460 | Open in IMG/M |
3300008261|Ga0114336_1161868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 980 | Open in IMG/M |
3300008262|Ga0114337_1127584 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
3300008450|Ga0114880_1054002 | All Organisms → Viruses → Predicted Viral | 1685 | Open in IMG/M |
3300008450|Ga0114880_1067249 | All Organisms → Viruses → Predicted Viral | 1465 | Open in IMG/M |
3300008450|Ga0114880_1071294 | All Organisms → Viruses → Predicted Viral | 1411 | Open in IMG/M |
3300009009|Ga0105105_10443837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300009081|Ga0105098_10084986 | All Organisms → Viruses → Predicted Viral | 1346 | Open in IMG/M |
3300009085|Ga0105103_10926172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella anatolica | 512 | Open in IMG/M |
3300009158|Ga0114977_10200843 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
3300009160|Ga0114981_10074767 | All Organisms → Viruses → Predicted Viral | 1883 | Open in IMG/M |
3300009164|Ga0114975_10175175 | Not Available | 1219 | Open in IMG/M |
3300009164|Ga0114975_10540325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
3300009168|Ga0105104_10336609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella anatolica | 833 | Open in IMG/M |
3300009169|Ga0105097_10628391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
3300009170|Ga0105096_10319331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 794 | Open in IMG/M |
3300009170|Ga0105096_10558096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 599 | Open in IMG/M |
3300009180|Ga0114979_10588542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
3300009184|Ga0114976_10028088 | All Organisms → Viruses → Predicted Viral | 3396 | Open in IMG/M |
3300009184|Ga0114976_10194976 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
3300010157|Ga0114964_10027831 | All Organisms → Viruses → Predicted Viral | 3143 | Open in IMG/M |
3300010157|Ga0114964_10089110 | All Organisms → Viruses → Predicted Viral | 1543 | Open in IMG/M |
3300010160|Ga0114967_10565230 | Not Available | 549 | Open in IMG/M |
3300010334|Ga0136644_10329637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 879 | Open in IMG/M |
3300012013|Ga0153805_1066660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 610 | Open in IMG/M |
3300012723|Ga0157604_1253125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 789 | Open in IMG/M |
3300013005|Ga0164292_10072996 | All Organisms → Viruses → Predicted Viral | 2639 | Open in IMG/M |
3300013014|Ga0164295_11137994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
3300017723|Ga0181362_1044563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 930 | Open in IMG/M |
3300017723|Ga0181362_1104484 | Not Available | 561 | Open in IMG/M |
3300017736|Ga0181365_1135164 | Not Available | 588 | Open in IMG/M |
3300017761|Ga0181356_1018736 | All Organisms → Viruses → Predicted Viral | 2556 | Open in IMG/M |
3300017761|Ga0181356_1087346 | Not Available | 1028 | Open in IMG/M |
3300017761|Ga0181356_1112705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 875 | Open in IMG/M |
3300017766|Ga0181343_1154707 | Not Available | 638 | Open in IMG/M |
3300017766|Ga0181343_1163776 | Not Available | 617 | Open in IMG/M |
3300017774|Ga0181358_1107263 | Not Available | 994 | Open in IMG/M |
3300017777|Ga0181357_1060481 | All Organisms → Viruses → Predicted Viral | 1467 | Open in IMG/M |
3300017780|Ga0181346_1241886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300017780|Ga0181346_1279358 | Not Available | 573 | Open in IMG/M |
3300017784|Ga0181348_1086016 | All Organisms → Viruses → Predicted Viral | 1242 | Open in IMG/M |
3300017784|Ga0181348_1320327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300017785|Ga0181355_1007427 | All Organisms → Viruses → Predicted Viral | 4844 | Open in IMG/M |
3300017785|Ga0181355_1088968 | All Organisms → Viruses → Predicted Viral | 1285 | Open in IMG/M |
3300017785|Ga0181355_1106424 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
3300017785|Ga0181355_1143686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 966 | Open in IMG/M |
3300021952|Ga0213921_1049174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 624 | Open in IMG/M |
3300021956|Ga0213922_1029686 | All Organisms → Viruses → Predicted Viral | 1320 | Open in IMG/M |
3300021963|Ga0222712_10347081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 916 | Open in IMG/M |
3300022190|Ga0181354_1021280 | All Organisms → Viruses → Predicted Viral | 2059 | Open in IMG/M |
3300022407|Ga0181351_1155486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 817 | Open in IMG/M |
3300022407|Ga0181351_1188485 | Not Available | 702 | Open in IMG/M |
3300022747|Ga0228703_1108830 | Not Available | 638 | Open in IMG/M |
3300023174|Ga0214921_10372390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 746 | Open in IMG/M |
3300024358|Ga0255173_1062833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 623 | Open in IMG/M |
3300024513|Ga0255144_1020479 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
3300025075|Ga0209615_102583 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
3300027142|Ga0255065_1092223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 503 | Open in IMG/M |
3300027146|Ga0255104_1042045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 785 | Open in IMG/M |
3300027156|Ga0255078_1107562 | Not Available | 520 | Open in IMG/M |
3300027365|Ga0209300_1043614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 799 | Open in IMG/M |
3300027608|Ga0208974_1147024 | Not Available | 600 | Open in IMG/M |
3300027644|Ga0209356_1213987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 516 | Open in IMG/M |
3300027659|Ga0208975_1107607 | Not Available | 805 | Open in IMG/M |
3300027659|Ga0208975_1186037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 562 | Open in IMG/M |
3300027707|Ga0209443_1158696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 818 | Open in IMG/M |
3300027710|Ga0209599_10070622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella anatolica | 917 | Open in IMG/M |
3300027710|Ga0209599_10099958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 764 | Open in IMG/M |
(restricted) 3300027730|Ga0247833_1330872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
3300027736|Ga0209190_1183892 | Not Available | 875 | Open in IMG/M |
3300027741|Ga0209085_1279468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300027754|Ga0209596_1348053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 572 | Open in IMG/M |
3300027764|Ga0209134_10249243 | Not Available | 608 | Open in IMG/M |
3300027792|Ga0209287_10214803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 734 | Open in IMG/M |
3300027808|Ga0209354_10001745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9468 | Open in IMG/M |
3300027900|Ga0209253_11103235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 540 | Open in IMG/M |
3300028025|Ga0247723_1032189 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
3300028025|Ga0247723_1073956 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300028027|Ga0247722_10127973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 925 | Open in IMG/M |
3300031857|Ga0315909_10023561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6124 | Open in IMG/M |
3300031857|Ga0315909_10125825 | All Organisms → Viruses → Predicted Viral | 2156 | Open in IMG/M |
3300031951|Ga0315904_10456377 | All Organisms → Viruses → Predicted Viral | 1140 | Open in IMG/M |
3300031963|Ga0315901_10228544 | All Organisms → Viruses → Predicted Viral | 1589 | Open in IMG/M |
3300031963|Ga0315901_10487308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 964 | Open in IMG/M |
3300031963|Ga0315901_10595666 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300031963|Ga0315901_11146795 | Not Available | 531 | Open in IMG/M |
3300031999|Ga0315274_12040082 | Not Available | 513 | Open in IMG/M |
3300032046|Ga0315289_11386867 | Not Available | 547 | Open in IMG/M |
3300032050|Ga0315906_10252060 | All Organisms → Viruses → Predicted Viral | 1621 | Open in IMG/M |
3300032050|Ga0315906_10563821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 947 | Open in IMG/M |
3300032093|Ga0315902_10515057 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
3300032116|Ga0315903_10274203 | All Organisms → Viruses → Predicted Viral | 1442 | Open in IMG/M |
3300032116|Ga0315903_10786111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 697 | Open in IMG/M |
3300032116|Ga0315903_10821927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 675 | Open in IMG/M |
3300032462|Ga0335396_10560918 | Not Available | 716 | Open in IMG/M |
3300033994|Ga0334996_0053056 | All Organisms → Viruses → Predicted Viral | 2504 | Open in IMG/M |
3300033995|Ga0335003_0274056 | Not Available | 769 | Open in IMG/M |
3300033996|Ga0334979_0552864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300034012|Ga0334986_0091423 | All Organisms → Viruses → Predicted Viral | 1839 | Open in IMG/M |
3300034012|Ga0334986_0101366 | All Organisms → Viruses → Predicted Viral | 1725 | Open in IMG/M |
3300034022|Ga0335005_0763417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
3300034066|Ga0335019_0269107 | All Organisms → Viruses → Predicted Viral | 1079 | Open in IMG/M |
3300034093|Ga0335012_0406047 | Not Available | 665 | Open in IMG/M |
3300034103|Ga0335030_0433464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella anatolica | 845 | Open in IMG/M |
3300034104|Ga0335031_0355355 | Not Available | 935 | Open in IMG/M |
3300034104|Ga0335031_0745133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 556 | Open in IMG/M |
3300034106|Ga0335036_0778543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella anatolica | 556 | Open in IMG/M |
3300034122|Ga0335060_0342985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 805 | Open in IMG/M |
3300034283|Ga0335007_0240394 | All Organisms → Viruses → Predicted Viral | 1227 | Open in IMG/M |
3300034283|Ga0335007_0264971 | All Organisms → Viruses → Predicted Viral | 1148 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.46% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.49% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 11.59% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.14% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.14% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.80% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.35% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.17% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.17% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.17% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.17% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.17% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.17% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.45% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.72% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.72% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.72% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.72% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.72% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.72% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.72% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.72% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012723 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024358 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d | Environmental | Open in IMG/M |
3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
3300027146 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h | Environmental | Open in IMG/M |
3300027156 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24766J26685_101251052 | 3300002161 | Freshwater And Sediment | VLNAVIVTLPPGMDINDYYLAHGADATRALLVGEQIG* |
JGI25909J50240_10265681 | 3300003393 | Freshwater Lake | VKEDGSNPGAEFSKRVANEVMNSTIVTLPPNMDINDYYLAHGASATRKLLIGESSE* |
Ga0063233_102693042 | 3300003986 | Freshwater Lake | NEVMNSQIVTLPPGMDINDYYLVNGIDDTRKLLIGESNV* |
Ga0066177_100457911 | 3300004096 | Freshwater Lake | GAEFSKRVAQEITNSTIVTLPPSMDINDFYLANGADATKALLLGEKDE* |
Ga0066178_102457232 | 3300004124 | Freshwater Lake | ADFAKRVANEIINSTIVTLPAGMDINDYYLAYGADATRALLVGELKG* |
Ga0066223_10221498 | 3300004461 | Marine | ADFAKRVANEILNSQIVTLPPGMDINDYYLAHGADATRALLVGEKGE* |
Ga0069718_100146342 | 3300004481 | Sediment | FSKRVASEVLNSTIVTLPPNMDINDYYLAHGAEATSTLLVGEGNG* |
Ga0068876_105088571 | 3300005527 | Freshwater Lake | PGAEFAKRVANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV* |
Ga0078894_114114812 | 3300005662 | Freshwater Lake | VAGEVINGTIVQLPPNMDITDYYLANGADATKQLLGVPNV* |
Ga0070749_105938341 | 3300006802 | Aqueous | NEILNSQIVTLPPGMDINDYYLAHGADATRALLVGEKGE* |
Ga0075464_108973772 | 3300006805 | Aqueous | AEFAKRVAQEVSNSTIVTLPPSMDINDFYLARGLDATKALLLGEKDE* |
Ga0070748_12914381 | 3300006920 | Aqueous | NGTIVQLPPNMDITDYYLANGADATKHLLGVPNV* |
Ga0105748_100932583 | 3300007992 | Estuary Water | ANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV* |
Ga0114340_100582523 | 3300008107 | Freshwater, Plankton | VMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV* |
Ga0114340_10684774 | 3300008107 | Freshwater, Plankton | AKRVANEVMNSTIVTLPPSMDINDYYLANGAEATRNLLIGESNG* |
Ga0114341_103980521 | 3300008108 | Freshwater, Plankton | GAEFAKRVANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV* |
Ga0114341_104142372 | 3300008108 | Freshwater, Plankton | IKEDGTNPGAEFAKRVANDVMNSQIVTLPPGMDINDYYLANGIDATKELLTGNASNR* |
Ga0114341_104285682 | 3300008108 | Freshwater, Plankton | EVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV* |
Ga0114343_10485394 | 3300008110 | Freshwater, Plankton | KEDGTNPGAEFAKRVANDVMNSTIVTLPPGMDINDYYLANGEVATRALLTGEKGE* |
Ga0114343_11757391 | 3300008110 | Freshwater, Plankton | EFAKRVANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV* |
Ga0114343_11816272 | 3300008110 | Freshwater, Plankton | LNGTIVTLPPNMDINDYYLAHGAEATTALLVGEGNG* |
Ga0114346_10791204 | 3300008113 | Freshwater, Plankton | KEDGSNPGAEFAKRVANEVMNSTIVTLPPSMDINDYYLANGVEATRNLLIGESNE* |
Ga0114346_11979143 | 3300008113 | Freshwater, Plankton | EFAKRVANDVMNSQIVTLPPGMDINDYYLANGIDATKELLTGNASNR* |
Ga0114350_100852314 | 3300008116 | Freshwater, Plankton | KEDGSNPGAEFAKRVANEVMNSTIVTLPPSMDINDYYLANGAEATRNLLIGESNG* |
Ga0114350_10339125 | 3300008116 | Freshwater, Plankton | MNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV* |
Ga0114355_10975003 | 3300008120 | Freshwater, Plankton | GTNPGADFAKRVANEILNSTIVTLPPGMDINDYYLAYGADATRTLLVGEPKG* |
Ga0114336_10750697 | 3300008261 | Freshwater, Plankton | IKEDGTNPGAEFAKRVANDVMNSTIVTLPPGMDINDYYLANGEVATRALLTGEKGE* |
Ga0114336_11618683 | 3300008261 | Freshwater, Plankton | EDGSNPGAEFSKRVANEIINSQIVTLPPGLDINDYYLAYGADATKALLVGETKGE* |
Ga0114337_11275841 | 3300008262 | Freshwater, Plankton | NSTIVTLPPGMDINDYYLAHGADATRALLVGEPKGE* |
Ga0114880_10540021 | 3300008450 | Freshwater Lake | NDVKEDGSNPGADFSKRVSQEVLNGTIVHLPPNMDINDYYLAYGAQATKTLLVGEGNG* |
Ga0114880_10672494 | 3300008450 | Freshwater Lake | EILNSTIVTLPPGMDINDYYLAYGADATRALLVGEPKGE* |
Ga0114880_10712944 | 3300008450 | Freshwater Lake | NEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV* |
Ga0105105_104438373 | 3300009009 | Freshwater Sediment | ANEVMNSVIVTLPPGMDINDYYLAHGADATRALLVGEQIG* |
Ga0105098_100849864 | 3300009081 | Freshwater Sediment | NEVMNSSIVTLPPGMDINDYYLAHGADATRALLVGEQIG* |
Ga0105103_109261722 | 3300009085 | Freshwater Sediment | GSNPGQEFAKRVANEVMNSTIFTLPPGMDINDYYLTHGVEATRTLLIGESNV* |
Ga0114977_102008431 | 3300009158 | Freshwater Lake | NSTIVTLPPGMDINDHYLAYGADATRTLLVGEPKG* |
Ga0114981_100747671 | 3300009160 | Freshwater Lake | RVANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV* |
Ga0114975_101751753 | 3300009164 | Freshwater Lake | VANEILNSVIVTLPPGMDINDYYLANGADATRALLVGEKGE* |
Ga0114975_105403252 | 3300009164 | Freshwater Lake | GAEFSKRVASEVLNSTIVTLPPNMDINDYYLAYGADATKTLLVGEENG* |
Ga0105104_103366093 | 3300009168 | Freshwater Sediment | AKRVANDVMNSIIVTLPPGMDINDYYLANGEVATRALLTGEKGE* |
Ga0105097_106283911 | 3300009169 | Freshwater Sediment | DGTNPGAEFAKRVAQEVSNSTIVTLPPSMDINDFYLTKGLDATKALLLGQKDE* |
Ga0105096_103193313 | 3300009170 | Freshwater Sediment | SVIVTLPPGMDINDYYLAHGADATRALLVGEQIG* |
Ga0105096_105580961 | 3300009170 | Freshwater Sediment | VANEVMNSTIVTLPPGMDINDYYLAYGADATRALLVGELKGE* |
Ga0114979_105885423 | 3300009180 | Freshwater Lake | ANEVMNSTIVTLPAGMDINDYYLKHGVDDTRKLLIGESNV* |
Ga0114976_100280881 | 3300009184 | Freshwater Lake | VLNGVIVTLPPNMDINDYYLAYGADATRALLVGEMNG* |
Ga0114976_101949763 | 3300009184 | Freshwater Lake | ANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGVEQ* |
Ga0114964_100278318 | 3300010157 | Freshwater Lake | AKRVASEVLNSVIVTLPPNMDINDYYLAYGAEATQTLLVGEQNG* |
Ga0114964_100891104 | 3300010157 | Freshwater Lake | AKRVASEVLNSVIVTLPPNMDINDYYLAYGAEATQTLLVGEKNG* |
Ga0114967_105652302 | 3300010160 | Freshwater Lake | NPGADFSKRVQQEVLNGVIVTLPPNMDINDYYLAYGADATRALLVGEQNG* |
Ga0136644_103296371 | 3300010334 | Freshwater Lake | DGSNPGAEFAKRVANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV* |
Ga0153805_10666602 | 3300012013 | Surface Ice | SNPGAEFAKRVANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV* |
Ga0157604_12531253 | 3300012723 | Freshwater | FAKRVANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV* |
Ga0164292_100729961 | 3300013005 | Freshwater | GTNPGAEFSKRVQQEVLNGTIVTLPPSMDINDYYLAHGTDATKALLIGEPSASY* |
Ga0164295_111379941 | 3300013014 | Freshwater | DGSNPGADFAKRVANEILNSTIVTMPPGMDINDHYLAYGADATRTLLVGEMKG* |
Ga0181362_10445631 | 3300017723 | Freshwater Lake | PGADFAKRVASEVLNGTIVSLPPSMDINDFYLANGTEGIKKLLGEKSE |
Ga0181362_11044841 | 3300017723 | Freshwater Lake | PGAEFAKRVANEVFNSVIVTLPPNMDINDYYLANGASATRKLLIGESDV |
Ga0181365_11351641 | 3300017736 | Freshwater Lake | KEDGSNPGADFSKRVQQEVLNGVIVTLPTNMDINDYYLAYGADATRALLVGEQNG |
Ga0181356_10187361 | 3300017761 | Freshwater Lake | DFAKRVANEIINSTIVTLPPGMDINDYYLAYGADATRTLLVGELKGE |
Ga0181356_10873463 | 3300017761 | Freshwater Lake | ASEVLNGTIVSLPPSMDINDFYLANGTEGIKKLLGEKSE |
Ga0181356_11127051 | 3300017761 | Freshwater Lake | AQEISNSTIVTLPPSMDINDFYLANGADATKALLLGEKDE |
Ga0181343_11547073 | 3300017766 | Freshwater Lake | GTNPGAEFSKRVQQEVLNGTIVHLPPNMDINDYYLAYGAEATKTLLVGEAIG |
Ga0181343_11637763 | 3300017766 | Freshwater Lake | MNSTIVTLPPNMDINDYYLANGIEATRNLLIGESNE |
Ga0181358_11072633 | 3300017774 | Freshwater Lake | LNGVIVTLPTNMDINDYYLAYGADATRALLVGEQNG |
Ga0181357_10604811 | 3300017777 | Freshwater Lake | RVANEVMNSQIVTLPPGMDINDYYLANGIDATRELLIGRQ |
Ga0181346_12418862 | 3300017780 | Freshwater Lake | KEDGSNPGADFSKRVANEVMNSTIVTLPPNMDINDYYLVHGASATRKLLIGEYSE |
Ga0181346_12793582 | 3300017780 | Freshwater Lake | VMNSQIVTLPPGLDINDYYLANGIDATRKLLIGESNV |
Ga0181348_10860161 | 3300017784 | Freshwater Lake | DGSNPGAEFAKRVANEVMNSQIVTLPPGMDINDYYLVNGIDDTRKLLIGESNV |
Ga0181348_13203272 | 3300017784 | Freshwater Lake | VANEVMNSTIVTLPPNMDINDYYLVHGASATRKLLIGEYSE |
Ga0181355_10074271 | 3300017785 | Freshwater Lake | ISNSTIVTLPPSMDINDFYLANGADATKALLLGEKDE |
Ga0181355_10889684 | 3300017785 | Freshwater Lake | VANEVMNSVIVTLPPGMDINDYYLAHGADATRALLVGEKGE |
Ga0181355_11064243 | 3300017785 | Freshwater Lake | VANEVMNSQIVTLPPGMDINDYYLANGIDATRELLIGRQ |
Ga0181355_11436861 | 3300017785 | Freshwater Lake | IKEDGTNPGAEFSKRVASEILNSQIVTLPPGMDINDYYLAHGAEATRALLVGEPKGE |
Ga0213921_10491743 | 3300021952 | Freshwater | NEVMNSVIVTLPPGMDINDYYLAHGADATRALLVGEKGE |
Ga0213922_10296864 | 3300021956 | Freshwater | DGSNPGAEFSKRVASEVLNGTIVHLPPNMDINDYYLVHGADATKTLLVGE |
Ga0222712_103470811 | 3300021963 | Estuarine Water | EFAKRVANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV |
Ga0181354_10212801 | 3300022190 | Freshwater Lake | RAEFAKRVANEVMNSQIVTLPPGMDINDYYLVNGIDDTRKLLIGESNV |
Ga0181351_11554863 | 3300022407 | Freshwater Lake | EDGSNPGAEFSKRVANEIINSQIVTLPPGLDINDYYLAYGADATKALLVGETKGE |
Ga0181351_11884853 | 3300022407 | Freshwater Lake | NSQIVTLPPGMDINNYYLVNGIDDTRKLLIGESNV |
Ga0228703_11088303 | 3300022747 | Freshwater | KEDGSNPGAEFNRRVASEVMNATIVNLPEGLDINDYYLQNGHDKTRRLLGVVDE |
Ga0214921_103723903 | 3300023174 | Freshwater | GSNPGADFAKRVANEIVNSQIVTLPAGMDINDYYLAYGAEATRTLLIGELKG |
Ga0255173_10628331 | 3300024358 | Freshwater | ADFAKRVHQEVLNGVIISLPPNMDINDYYLAYGADATKTLLVGEAIG |
Ga0255151_10784492 | 3300024496 | Freshwater | KEDGTNPGQEFARRVASEVINATIVSLPAGLDITDYYLQNGYDETRRLFGVASDMF |
Ga0255144_10204791 | 3300024513 | Freshwater | FAKRVHQEVLNGVIISLPPNMDINDYYLAYGADATKTLLVGETIG |
Ga0209615_1025831 | 3300025075 | Freshwater | SKRVAQEVTNSTIVTLPPSMDINDYYLANGVDATRALLLGEKDE |
Ga0255065_10922231 | 3300027142 | Freshwater | DGSNPGAEFAKRVANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV |
Ga0255104_10420453 | 3300027146 | Freshwater | EFSKRVANEIINSQIVTLPPGLDINDYYLAYGADATKALLVGETKGE |
Ga0255078_11075622 | 3300027156 | Freshwater | DGSNPGADFSKRVQQEVLNGVIVTLPPNMDINDYYLAYGADATRALLVGEQNG |
Ga0209300_10436143 | 3300027365 | Deep Subsurface | INSQIVTLPPGLDINDYYLAYGADATKALLVGETKGE |
Ga0208974_11470242 | 3300027608 | Freshwater Lentic | AKRVANEVMNSTIVTLPAGMDINDYYLKHGMEDTRKLLIGESNV |
Ga0209356_12139872 | 3300027644 | Freshwater Lake | AEFAKRVANEVMNSQIVTLPPGMDINDYYLANGGPATRKLLIGESNV |
Ga0208975_11076071 | 3300027659 | Freshwater Lentic | ANEILNSTIVTLPPGMDINDYYLAHGADATRALLVGEPKGE |
Ga0208975_11860371 | 3300027659 | Freshwater Lentic | GSNPGAEFSKRVANEIINSQIVTLPPGLDINDYYLAYGADATKALLVGETKGE |
Ga0209443_11586961 | 3300027707 | Freshwater Lake | SKRVAQEITNSTIVTLPPSMDINDFYLANGADATKALLLGEKDE |
Ga0209599_100706223 | 3300027710 | Deep Subsurface | NPGAEFAKRVANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV |
Ga0209599_100999583 | 3300027710 | Deep Subsurface | SNPGADFSKRVANEIVNSQIVTLPAGMDINDYYLAYGADATRTLLIGELKG |
(restricted) Ga0247833_13308721 | 3300027730 | Freshwater | GTNPGAEFSKRVASEVLNSQIVTLPPNMDINDYYLAYGEQATKTLLVGEAIG |
Ga0209190_11838923 | 3300027736 | Freshwater Lake | GAEFAKRVANEVMNSTIVTLPAGMDINDYYLKHGVEDTRKLLIGESNV |
Ga0209085_12794682 | 3300027741 | Freshwater Lake | KRVASEVLNSVIVTLPPGMDVNDYYLAYGADATRTLLVGEPSASH |
Ga0209596_13480531 | 3300027754 | Freshwater Lake | FAKRVANEVMNSQIVTLPPGMDINDYYLANGGPATRKLLIGESNV |
Ga0209134_102492431 | 3300027764 | Freshwater Lake | NEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV |
Ga0209287_102148031 | 3300027792 | Freshwater Sediment | RVANEVMNSVIVTLPPGMDINDYYLAHGADATRALLVGEQIG |
Ga0209354_100017451 | 3300027808 | Freshwater Lake | GAEFSKRVANEVMNSTIVTLPPNMDINDYYLAHGASATRKLLIGESSE |
Ga0209253_111032352 | 3300027900 | Freshwater Lake Sediment | DNDIKEDGTNPGAEFSKRVASEIINSQIVTLPPGMDINDYYLANGADATRALLVGESKGE |
Ga0247723_10321891 | 3300028025 | Deep Subsurface Sediment | EDGSNPGAEFSKRVANEVMNSTIVSLPAGMDITDYYLANGAEATRKILIGGYAGE |
Ga0247723_10739561 | 3300028025 | Deep Subsurface Sediment | AKRVANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV |
Ga0247722_101279733 | 3300028027 | Deep Subsurface Sediment | DFSKRVANEIVNSQIVTLPAGMDINDYYLAYGADATRTLLIGELKG |
Ga0315909_100235611 | 3300031857 | Freshwater | AKRVANEVMNSTIVTLPPSMDINDYYLANGVEATRNLLIGESNE |
Ga0315909_101258256 | 3300031857 | Freshwater | DNDIKEDGTNPGADFAKRVANEILNSTIVTLPPGMDINDYYLAYGADATRTLLVGEPKG |
Ga0315904_104563771 | 3300031951 | Freshwater | NSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV |
Ga0315901_102285441 | 3300031963 | Freshwater | KEDGSNPGAEFAKRVANEVMNSTIVTLPPSMDINDYYLANGVEATRNLLIGESNE |
Ga0315901_104873083 | 3300031963 | Freshwater | AEFAKRVANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV |
Ga0315901_105956663 | 3300031963 | Freshwater | GSNPGAEFAKRVANEVMNSQIVTLTPGMDINDYYLANGIDATRKLLIGESNV |
Ga0315901_111467951 | 3300031963 | Freshwater | GSNPGADFSKRVQQEVLNGVIVTLPPNMDINDYYLAYGADATRALLVGEMNG |
Ga0315274_120400822 | 3300031999 | Sediment | GSNPGADFSKRVQQEVLNGVIVTLPTNMDINDYYLAYGADATRALLVGEQNG |
Ga0315289_113868672 | 3300032046 | Sediment | VANDVMNSTIVTLPPGMDINDYYLAHGASATRALLVGVESE |
Ga0315906_102520604 | 3300032050 | Freshwater | KRVANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV |
Ga0315906_105638213 | 3300032050 | Freshwater | AKRVANDVMNSTIVTLPPGMDINDYYLANGEVATRALLTGEKGE |
Ga0315902_1004500616 | 3300032093 | Freshwater | TIYVIGDNDIKEDGTNPGAEFAKRVANEVINSVIVTLPPGMDINDYYLAHGDVATRALLTGERNE |
Ga0315902_105150571 | 3300032093 | Freshwater | MNSTIVTLPPGMDINDYYLANGEVATRALLTGEKGE |
Ga0315903_102742034 | 3300032116 | Freshwater | VANEILNSTIVTMPPGMDINDYYLAFGADATRSLLVGELKG |
Ga0315903_107861113 | 3300032116 | Freshwater | TNPGAEFSKRVASEILNSVIVTLPPGMDINDHYLKFGADATRALLVGEKGE |
Ga0315903_108219271 | 3300032116 | Freshwater | FAKRVANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV |
Ga0335396_105609183 | 3300032462 | Freshwater | EDGSNPGQDFAKRVANEVLNSVIVTLPPGQDINDYYLVHGADATRTLLIGARGE |
Ga0334996_0053056_2385_2504 | 3300033994 | Freshwater | EILNSTIVTLPPGMDINDYYLAHGADATRALLVGEPKGE |
Ga0335003_0274056_657_767 | 3300033995 | Freshwater | MNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV |
Ga0334979_0552864_461_616 | 3300033996 | Freshwater | PGAEFSKRVQQEVLNGTIVTLPPSMDINDYYLAHGTDATKALLIGEPSASY |
Ga0334986_0091423_1681_1839 | 3300034012 | Freshwater | GSNPGAEFAKRVANEVINSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV |
Ga0334986_0101366_3_146 | 3300034012 | Freshwater | PGAEFAKRVANEVMNSQIVTLPPGMDINDYYLANGIEATRELLIGRQ |
Ga0335005_0763417_2_142 | 3300034022 | Freshwater | EFSKRVAQEIPNSTIVTLPPSMDVNDFYLANGADATKALLLGEKDE |
Ga0335019_0269107_1_153 | 3300034066 | Freshwater | NPGAEFSKRVQQEVLNGTIVHLPPNMDINDYYLAYGAEATKTLLVGEAIG |
Ga0335012_0406047_2_160 | 3300034093 | Freshwater | GSNPGAEFAKRVANEVMNSQIVTLPPGMDINDYYLANGIDATRKLLIGESNV |
Ga0335030_0433464_686_844 | 3300034103 | Freshwater | GTNPGAEFSKRVASEILNSVIVTLPPGMDINDHYLKFGADATRALLVGEKGE |
Ga0335031_0355355_816_935 | 3300034104 | Freshwater | NEILNSTIVTLPPGMDINDYYLAHGAEATKTLLVGERNE |
Ga0335031_0745133_386_556 | 3300034104 | Freshwater | KEDGSNPGAEFAKRVANEVMNSVIVTLSPGMDINDYYLANGADATRALLVGEPKGE |
Ga0335036_0778543_425_556 | 3300034106 | Freshwater | KRVANEILNSTIVTLPPGMDINDHYLAYGADATRTLLVGEPKG |
Ga0335060_0342985_650_805 | 3300034122 | Freshwater | NPGAEFSKRVASEVMNSTIVSLPAGMDITDYYLANGAEATRKILIGGYAGE |
Ga0335007_0240394_1_141 | 3300034283 | Freshwater | EFAKRVAQEVSNSTIVTLPPSMDINDFYLTKGLDATKALLLGQKDE |
Ga0335007_0264971_2_163 | 3300034283 | Freshwater | DGSNPGADFSKRVSQEVLNGTIVHLPPNMDINDYYLAYGAQATKTLLVGEGNG |
⦗Top⦘ |