| Basic Information | |
|---|---|
| Family ID | F055535 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MALVKVSRLTETPDHYDSVKDFIAYGAIYRTVLEAVQDQNFEWKE |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 87.68 % |
| % of genes from short scaffolds (< 2000 bps) | 86.96 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (84.058 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (27.536 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.942 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (47.101 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.33% β-sheet: 0.00% Coil/Unstructured: 46.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF01844 | HNH | 6.52 |
| PF09723 | Zn-ribbon_8 | 6.52 |
| PF01464 | SLT | 1.45 |
| PF00145 | DNA_methylase | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.65 % |
| Unclassified | root | N/A | 4.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002363|B570J29624_105378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
| 3300002835|B570J40625_100833668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
| 3300002835|B570J40625_100893093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
| 3300004112|Ga0065166_10061121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1282 | Open in IMG/M |
| 3300005527|Ga0068876_10514951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300005662|Ga0078894_10380060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1277 | Open in IMG/M |
| 3300005662|Ga0078894_11418798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300005805|Ga0079957_1049467 | All Organisms → cellular organisms → Bacteria | 2587 | Open in IMG/M |
| 3300005805|Ga0079957_1051839 | All Organisms → cellular organisms → Bacteria | 2508 | Open in IMG/M |
| 3300005805|Ga0079957_1073795 | All Organisms → Viruses → Predicted Viral | 1958 | Open in IMG/M |
| 3300005805|Ga0079957_1317021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300006805|Ga0075464_10318968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
| 3300006805|Ga0075464_10530032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
| 3300006805|Ga0075464_10881871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300006920|Ga0070748_1196553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300006920|Ga0070748_1328068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300007538|Ga0099851_1194327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
| 3300007973|Ga0105746_1326911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300007974|Ga0105747_1105161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
| 3300008107|Ga0114340_1081459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1336 | Open in IMG/M |
| 3300008114|Ga0114347_1009978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5509 | Open in IMG/M |
| 3300008261|Ga0114336_1209189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
| 3300008264|Ga0114353_1088427 | All Organisms → Viruses → Predicted Viral | 1685 | Open in IMG/M |
| 3300008264|Ga0114353_1279084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300008266|Ga0114363_1049352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1681 | Open in IMG/M |
| 3300008266|Ga0114363_1077717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1245 | Open in IMG/M |
| 3300008266|Ga0114363_1091634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1110 | Open in IMG/M |
| 3300008266|Ga0114363_1119034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
| 3300008266|Ga0114363_1134206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
| 3300008266|Ga0114363_1172188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
| 3300008266|Ga0114363_1208873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300008266|Ga0114363_1227799 | Not Available | 546 | Open in IMG/M |
| 3300008267|Ga0114364_1085221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
| 3300008450|Ga0114880_1041744 | All Organisms → Viruses → Predicted Viral | 1987 | Open in IMG/M |
| 3300008450|Ga0114880_1078906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1319 | Open in IMG/M |
| 3300008450|Ga0114880_1081468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1291 | Open in IMG/M |
| 3300008450|Ga0114880_1091633 | All Organisms → Viruses → Predicted Viral | 1193 | Open in IMG/M |
| 3300008450|Ga0114880_1104837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
| 3300008450|Ga0114880_1168411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300008450|Ga0114880_1255940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300009081|Ga0105098_10105159 | All Organisms → Viruses → Predicted Viral | 1223 | Open in IMG/M |
| 3300009152|Ga0114980_10175854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1264 | Open in IMG/M |
| 3300009155|Ga0114968_10054606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2560 | Open in IMG/M |
| 3300009158|Ga0114977_10334607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300009159|Ga0114978_10867588 | Not Available | 505 | Open in IMG/M |
| 3300009165|Ga0105102_10633865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300009169|Ga0105097_10222677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1039 | Open in IMG/M |
| 3300009170|Ga0105096_10489569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300009180|Ga0114979_10201384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1206 | Open in IMG/M |
| 3300009183|Ga0114974_10135591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1551 | Open in IMG/M |
| 3300009183|Ga0114974_10334375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
| 3300009184|Ga0114976_10223310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1030 | Open in IMG/M |
| 3300010354|Ga0129333_10291310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1462 | Open in IMG/M |
| 3300010354|Ga0129333_10482329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1089 | Open in IMG/M |
| 3300010368|Ga0129324_10144569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
| 3300010368|Ga0129324_10149825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
| 3300010370|Ga0129336_10246715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
| 3300010885|Ga0133913_13402862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1042 | Open in IMG/M |
| 3300012666|Ga0157498_1040642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300012666|Ga0157498_1056208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300012730|Ga0157602_1250380 | Not Available | 757 | Open in IMG/M |
| 3300012734|Ga0157615_1388504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300013004|Ga0164293_10390757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
| 3300013004|Ga0164293_10945209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300013005|Ga0164292_10406594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
| 3300017777|Ga0181357_1131468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
| 3300017778|Ga0181349_1313134 | Not Available | 506 | Open in IMG/M |
| 3300017780|Ga0181346_1046555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1765 | Open in IMG/M |
| 3300017780|Ga0181346_1213414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300017780|Ga0181346_1280458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300018815|Ga0187845_1246149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300020172|Ga0211729_10931353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300020527|Ga0208232_1017219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1062 | Open in IMG/M |
| 3300020533|Ga0208364_1018005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
| 3300020553|Ga0208855_1028190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
| 3300020573|Ga0208485_1070344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300021963|Ga0222712_10081111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2317 | Open in IMG/M |
| 3300021963|Ga0222712_10780731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300027733|Ga0209297_1155855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
| 3300027764|Ga0209134_10124163 | Not Available | 889 | Open in IMG/M |
| 3300027782|Ga0209500_10450011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300027816|Ga0209990_10192342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 949 | Open in IMG/M |
| 3300027897|Ga0209254_10691387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300027900|Ga0209253_10800563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300027973|Ga0209298_10045328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2065 | Open in IMG/M |
| 3300027973|Ga0209298_10075122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1515 | Open in IMG/M |
| 3300031758|Ga0315907_10099371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2495 | Open in IMG/M |
| 3300031758|Ga0315907_10121964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2224 | Open in IMG/M |
| 3300031758|Ga0315907_10434173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1052 | Open in IMG/M |
| 3300031787|Ga0315900_10101328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2803 | Open in IMG/M |
| 3300031857|Ga0315909_10207121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1547 | Open in IMG/M |
| 3300031857|Ga0315909_10311575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1170 | Open in IMG/M |
| 3300031857|Ga0315909_10968270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300031951|Ga0315904_10188958 | All Organisms → Viruses → Predicted Viral | 2035 | Open in IMG/M |
| 3300031951|Ga0315904_10646640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
| 3300031997|Ga0315278_12237716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300032050|Ga0315906_10120811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2577 | Open in IMG/M |
| 3300032050|Ga0315906_10236885 | All Organisms → Viruses → Predicted Viral | 1688 | Open in IMG/M |
| 3300032050|Ga0315906_11036239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300032093|Ga0315902_10180411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2150 | Open in IMG/M |
| 3300032093|Ga0315902_10194114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2048 | Open in IMG/M |
| 3300032093|Ga0315902_10658683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
| 3300033981|Ga0334982_0226226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
| 3300033993|Ga0334994_0372544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
| 3300033993|Ga0334994_0535479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300033993|Ga0334994_0542797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300033996|Ga0334979_0278577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
| 3300034012|Ga0334986_0373181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| 3300034019|Ga0334998_0232729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1127 | Open in IMG/M |
| 3300034061|Ga0334987_0257979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1183 | Open in IMG/M |
| 3300034061|Ga0334987_0616615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300034062|Ga0334995_0085370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2440 | Open in IMG/M |
| 3300034062|Ga0334995_0105245 | All Organisms → Viruses → Predicted Viral | 2129 | Open in IMG/M |
| 3300034062|Ga0334995_0748944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300034066|Ga0335019_0461045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300034072|Ga0310127_049571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2114 | Open in IMG/M |
| 3300034072|Ga0310127_305798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300034073|Ga0310130_0178582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300034092|Ga0335010_0149420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1483 | Open in IMG/M |
| 3300034092|Ga0335010_0210369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1178 | Open in IMG/M |
| 3300034092|Ga0335010_0224575 | All Organisms → Viruses → Predicted Viral | 1126 | Open in IMG/M |
| 3300034092|Ga0335010_0228145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1114 | Open in IMG/M |
| 3300034092|Ga0335010_0331233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
| 3300034093|Ga0335012_0388936 | Not Available | 685 | Open in IMG/M |
| 3300034101|Ga0335027_0143532 | All Organisms → Viruses → Predicted Viral | 1761 | Open in IMG/M |
| 3300034102|Ga0335029_0547692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300034104|Ga0335031_0234872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1223 | Open in IMG/M |
| 3300034106|Ga0335036_0408400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
| 3300034106|Ga0335036_0669184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300034109|Ga0335051_0142441 | All Organisms → Viruses → Predicted Viral | 1226 | Open in IMG/M |
| 3300034109|Ga0335051_0357261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300034112|Ga0335066_0336276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
| 3300034122|Ga0335060_0063299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2301 | Open in IMG/M |
| 3300034122|Ga0335060_0242237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1008 | Open in IMG/M |
| 3300034122|Ga0335060_0532676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300034284|Ga0335013_0280285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1069 | Open in IMG/M |
| 3300034355|Ga0335039_0663264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300034356|Ga0335048_0072536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2143 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 27.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.87% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 10.14% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.42% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.97% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.07% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.62% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.62% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.90% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 2.90% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 2.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.45% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.45% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 1.45% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.45% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.45% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002363 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012734 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018815 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020573 | Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29624_1053781 | 3300002363 | Freshwater | AYLDFPITPHQAALCMALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED* |
| B570J40625_1008336681 | 3300002835 | Freshwater | QAALCMALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED* |
| B570J40625_1008930931 | 3300002835 | Freshwater | MALVKVSRLTETPDHYDSIKDFVAYGAIYRTVLEAVQDQDFEWKE* |
| Ga0065166_100611211 | 3300004112 | Freshwater Lake | VKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED* |
| Ga0068876_105149512 | 3300005527 | Freshwater Lake | TPDHYDSIKDFVAYGAIYRSVLEAVQDQDFEWKE* |
| Ga0078894_103800605 | 3300005662 | Freshwater Lake | SRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED* |
| Ga0078894_114187981 | 3300005662 | Freshwater Lake | RLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED* |
| Ga0079957_10494671 | 3300005805 | Lake | LTETPDHYDSIKDFVAYGAIYRTVLEAVQDQDFEWKE* |
| Ga0079957_10518397 | 3300005805 | Lake | CMALVKVSRLTETPDHYDSIKDFVAYGAIYRTVLEAVQDQDFEWKE* |
| Ga0079957_10737957 | 3300005805 | Lake | CMALVKVSRLTETPDHYDSVKDFIAYGAIYRNVLEAVQDQDFEWKE* |
| Ga0079957_13170212 | 3300005805 | Lake | SAYLDFPITPHQAALCMALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVMDDTFEWEDK* |
| Ga0075464_103189681 | 3300006805 | Aqueous | PITPHQAALCMALVKVSRLTETPDHYDSIKDFVAYGAIYRTVLEAVQDQDFEWKE* |
| Ga0075464_105300322 | 3300006805 | Aqueous | KVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED* |
| Ga0075464_108818712 | 3300006805 | Aqueous | LVKVSRLTETPDHEDSIKDFIAYGAVYKTVLDAVKDDSWDE* |
| Ga0070748_11965532 | 3300006920 | Aqueous | LCMALVKVSRLTETPDHYDSIKDFVAYGAIYRTVLEAVQDQNFEWKE* |
| Ga0070748_13280682 | 3300006920 | Aqueous | VSRLTETPDHYDSVKDFIAYGALYGTVLEAVQDQDFEWKE* |
| Ga0099851_11943271 | 3300007538 | Aqueous | ETPDHYDSVKDFIAYGAIYRNVLEAVQDEDFEWKE* |
| Ga0105746_13269111 | 3300007973 | Estuary Water | LDFPITPHQAALWMALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED* |
| Ga0105747_11051612 | 3300007974 | Estuary Water | WSAYLDFPIMPHQEALCMALIKVSRLTETPTHDDSIKDLIAYGALYKTILDAETDADFGWEE* |
| Ga0114340_10814591 | 3300008107 | Freshwater, Plankton | VALCMALVKVSRLTETPDHEDSIKDFIAYGAVYKTVLDAVKDESWEDE* |
| Ga0114347_10099781 | 3300008114 | Freshwater, Plankton | ESPDHYDSIKDFVAYGSIYRTVLEAVQDPDFEWKE* |
| Ga0114336_12091891 | 3300008261 | Freshwater, Plankton | ALVKVSRLTETPDHEDSIKDFIAYGAVYKTVLDAVKDDSWEDQ* |
| Ga0114353_10884271 | 3300008264 | Freshwater, Plankton | LDFPITPHQAALCMALVKVSRLTETPDHYDSVKDFIAYGAIYRNVLEAVQDQDFEWKE* |
| Ga0114353_12790841 | 3300008264 | Freshwater, Plankton | LDFPITPHQAALCMALVKVSRLSETPDHYDSIKDFIAYGSVYNTVLEAVKDDQFEWGDK* |
| Ga0114363_10493521 | 3300008266 | Freshwater, Plankton | LTETPDHYDSVKDFIAYGAIYRNVLEAVQDQDFEWKE* |
| Ga0114363_10777171 | 3300008266 | Freshwater, Plankton | DYPITPHQAALCMALVKVSRLTETPDHYDSVKDFVAYGAIYRTVLEAVQDQDFEWKE* |
| Ga0114363_10916343 | 3300008266 | Freshwater, Plankton | LCMALVKVSRLSETPDHEDSIKDFIAYGSVYKTVLDAVKDENWEDQ* |
| Ga0114363_11190341 | 3300008266 | Freshwater, Plankton | DFPITPHQAALCMALVKVSRLTETPDHYDSVKDFIAYGAIYRTVLEAVQDDDFEWKE* |
| Ga0114363_11342062 | 3300008266 | Freshwater, Plankton | LCMALVKVSRLSETPDHEDSIKDFIAYGSVYKTVLDAVKDENWED* |
| Ga0114363_11721881 | 3300008266 | Freshwater, Plankton | HQAALCMALVKVSRLTETPDHYDSIKDFVAYGAIYRTVLEAVQDQDFEWKE* |
| Ga0114363_12088731 | 3300008266 | Freshwater, Plankton | DYPITPHQAALCMALVKVSRLTETPDHYDSVKDFVAYGAIYRTVLEAVQDQNFEWKE* |
| Ga0114363_12277991 | 3300008266 | Freshwater, Plankton | LSETSDHYDSIKDFIAYGAVYNTVLEAVKDDQFEWGDK* |
| Ga0114364_10852211 | 3300008267 | Freshwater, Plankton | AYLDFPITPHQAALCMALVKVSRLTETPDHEDSIKDFIAYGAVYKTVLDAVKDDSWDE* |
| Ga0114880_10417445 | 3300008450 | Freshwater Lake | QAALCMALVKVSRLTETPDHYDSIKDFVAYGAIYRTVLEAVQDQDFEWKE* |
| Ga0114880_10789061 | 3300008450 | Freshwater Lake | ITPHQAALCMALVKVSRLTETPDHYDSVKDFIAYGAIYRTVLEAVQDDDFEWKE* |
| Ga0114880_10814684 | 3300008450 | Freshwater Lake | DYPITPHQAALCMALVKVSRLTETPDHYDSIKDFVAYGAIYRTVLEAVQDQDFEWKE* |
| Ga0114880_10916331 | 3300008450 | Freshwater Lake | TETPDHYDSVKDFIAYGAIYRNVLEAVQDQDFEWKE* |
| Ga0114880_11048371 | 3300008450 | Freshwater Lake | ALCMALVKVSRLTETPDHYDSIKDFVAYGAIYRTVLEAVQDQDFEWKE* |
| Ga0114880_11684111 | 3300008450 | Freshwater Lake | ALVKVSRLSETPDHYDSIKDFIAYGSVYNTVLEAVKDDQFEWGDK* |
| Ga0114880_12559401 | 3300008450 | Freshwater Lake | LDYPITPHQAALCMALVKVSRLTETPDHYDSIKDFVAYGAIYRTVLEAVQDQDFEWKE* |
| Ga0105098_101051591 | 3300009081 | Freshwater Sediment | VSRLTETPDHYDSVKDFIAYGAIYRNVLEAVQDQDFEWKE* |
| Ga0114980_101758541 | 3300009152 | Freshwater Lake | AALCMALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVKDENWED* |
| Ga0114968_100546061 | 3300009155 | Freshwater Lake | MALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED* |
| Ga0114977_103346071 | 3300009158 | Freshwater Lake | PHQAALCMALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED* |
| Ga0114978_108675881 | 3300009159 | Freshwater Lake | KVSRLTETPDHADSIKDFIAYGAVYKTVLDAVKDENWED* |
| Ga0105102_106338652 | 3300009165 | Freshwater Sediment | LCMALVKVSRLTESPDHYDSVKDFIAYGSIYRTVLEAEQDSDFDWKE* |
| Ga0105097_102226771 | 3300009169 | Freshwater Sediment | LCMALVKVSRLTETPDHYDSVKDFIAYGAIYRTVLEAEQDSDFDWRE* |
| Ga0105096_104895691 | 3300009170 | Freshwater Sediment | TPDHYDSVKDFIAYGAIYRTVLEAEQDSDFDWRE* |
| Ga0114979_102013843 | 3300009180 | Freshwater Lake | ALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVKDENWED* |
| Ga0114974_101355913 | 3300009183 | Freshwater Lake | HQAALCMALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED* |
| Ga0114974_103343751 | 3300009183 | Freshwater Lake | FPITPHQVALCMALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED* |
| Ga0114976_102233103 | 3300009184 | Freshwater Lake | LVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED* |
| Ga0129333_102913104 | 3300010354 | Freshwater To Marine Saline Gradient | DFPITPHQAALCMALVKVSRLTETPDHYDSVKDFIAYGAIYRTVLEAVQDQDFEWKE* |
| Ga0129333_104823293 | 3300010354 | Freshwater To Marine Saline Gradient | FPITPHQAALCMALVKVSRLTETPDHYDSVKDFIAYGALYRTVLEAVQDQDFEWKE* |
| Ga0129324_101445693 | 3300010368 | Freshwater To Marine Saline Gradient | ALCMALVKVSRLTETPDHYDSVKDFIAYGAIYRNVLEAVQDKDFEWKE* |
| Ga0129324_101498253 | 3300010368 | Freshwater To Marine Saline Gradient | ALCMALVKVSRLTETPDHYDSVKDFIAYGAIYRNVLEAVQDQDFEWKE* |
| Ga0129336_102467151 | 3300010370 | Freshwater To Marine Saline Gradient | RLTETSDHYDSVKDFIAYGAIYRTVLEAVQDDDFEWKE* |
| Ga0133913_134028621 | 3300010885 | Freshwater Lake | LVKVSRLAETPDHYDSIKDFIAYGSVYKTVLDAVKDENWED* |
| Ga0157498_10406421 | 3300012666 | Freshwater, Surface Ice | VSRLSETPDHYDSIKDFIAYGSVYKTVLDAVKDENWED* |
| Ga0157498_10562082 | 3300012666 | Freshwater, Surface Ice | ITPHQAALCMALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED* |
| Ga0157602_12503802 | 3300012730 | Freshwater | SPDHYDSVKDLVAYSSIYRTVLEAVQDKDFEWKE* |
| Ga0157615_13885041 | 3300012734 | Freshwater | PHQAALCMALVKVSRLSESPDHYDSVKDLVAYSSIYRTVLEAVQDKDFEWKE* |
| Ga0164293_103907571 | 3300013004 | Freshwater | RLSETPDHEDSIKDFIAYGSVYKTVLDAVKDENWED* |
| Ga0164293_109452091 | 3300013004 | Freshwater | ITPHQAALCMALVKVSRLTETPDHYDSIKDFVAYGAIYRTVLEAVQDQDFEWKE* |
| Ga0164292_104065941 | 3300013005 | Freshwater | HQAALCMALVKVSRLSETPDHEDSIKDFIAYGSVYKTVLDAVKDENWED* |
| Ga0181357_11314683 | 3300017777 | Freshwater Lake | AYLDFPITPHQAALCMALVKVSRLSETPDHEDSIKDFIAYGSVYKTVLDAVKDENWED |
| Ga0181349_13131341 | 3300017778 | Freshwater Lake | QAALCMALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED |
| Ga0181346_10465551 | 3300017780 | Freshwater Lake | IMPHQAALCMALIKVSRLTETPTHDDSIKDLIAYGALYKTILDAETDADFGWEE |
| Ga0181346_12134142 | 3300017780 | Freshwater Lake | LCMALVKVSRLSETSDHYDSIKDFIAYGAVYNTVLEAVKDDQFEWGDK |
| Ga0181346_12804581 | 3300017780 | Freshwater Lake | IMPHQAALCMALIKVSRLTETPTHDDSIKDLIAYGALYKTILDAETDADFEWEE |
| Ga0187845_12461492 | 3300018815 | Freshwater | VSRLSETPDHYDSIKDFIAYGSVYKTVLDAVKDENWED |
| Ga0211729_109313531 | 3300020172 | Freshwater | VSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED |
| Ga0208232_10172194 | 3300020527 | Freshwater | KVSRLTETPDHYDSVKDFIAYGAIYRNVLEAVQDQDFEWKE |
| Ga0208364_10180053 | 3300020533 | Freshwater | MALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED |
| Ga0208855_10281902 | 3300020553 | Freshwater | LCMALVKVSRLSETPDHEDSIKDFIAYGSVYKTVLDAVKDENWED |
| Ga0208485_10703442 | 3300020573 | Freshwater | LVKVSRLSETSDHYDSIKDFIAYGAVYNTVLEAVKDDQFEWGDK |
| Ga0222712_100811118 | 3300021963 | Estuarine Water | ALCMALVKVSRLTETPDHDDSIKDFIAYGAVYKTVLDAVKDESWDQE |
| Ga0222712_107807311 | 3300021963 | Estuarine Water | AALCMALVKVSRLSETSDHYDSIKDFIAYGAVYNTVLEAVKDDQFEWGDK |
| Ga0209297_11558553 | 3300027733 | Freshwater Lake | LVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED |
| Ga0209134_101241633 | 3300027764 | Freshwater Lake | QAALCMALVKVSRLSETPDHYDSIKDFIAYGSVYKSVLDAVQDENWED |
| Ga0209500_104500112 | 3300027782 | Freshwater Lake | PHQAALCMALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVKDENWED |
| Ga0209990_101923423 | 3300027816 | Freshwater Lake | LDFPITPHQAALCMALVKVSRLTETPDHYDSIKDFVAYGAIYRTVLEAVQDQDFEWKE |
| Ga0209254_106913872 | 3300027897 | Freshwater Lake Sediment | MALVKVSRLAETPDHYDSIKDFIAYGAVYNTVLEAVKDDQFEWGDK |
| Ga0209253_108005631 | 3300027900 | Freshwater Lake Sediment | YLDFPITPHQAALCMALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED |
| Ga0209298_100453286 | 3300027973 | Freshwater Lake | VKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVKDENWED |
| Ga0209298_100751223 | 3300027973 | Freshwater Lake | AALCMALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVKDENWED |
| Ga0315907_100993717 | 3300031758 | Freshwater | HQAALCMALVKVSRLTETPDHYDSVKDFIAYGALYRTVLEAVQDQDFEWKE |
| Ga0315907_101219641 | 3300031758 | Freshwater | YLDFPITPHQAALCMALVKVSRLTESPDHYDSVKDFIAYGSIYRSVLEAVQDNDFEWKE |
| Ga0315907_104341734 | 3300031758 | Freshwater | ALCMALVKVSRLTETPDHYDSVKDFIAYGAIYRTVLEAVQDQDFEWKE |
| Ga0315900_101013287 | 3300031787 | Freshwater | LDYPITPHQAALCMALVKVSRLTETPDHYDSVKDFVAYGAIYRTVLEAVQDQDFEWKE |
| Ga0315909_102071211 | 3300031857 | Freshwater | VSRLTETPDHYDSVKDFIAYGAIYRNVLEAVQDQDFEWKE |
| Ga0315909_103115754 | 3300031857 | Freshwater | LDFPITPHQAALCMALVKVSRLTETPDHYDSVKDFIAYGAIYRTVLEAVQDQDFEWKE |
| Ga0315909_109682701 | 3300031857 | Freshwater | PPQAALCMALVKVSRLTESPDHYDSIKDFVAYGSIYRTVLEAVQDPDFEWKE |
| Ga0315904_101889581 | 3300031951 | Freshwater | AYLDFPITPHQAALCMALVKVSRLTETPDHYDSVKDFIAYGAIYRTVLEAVQDDDFEWKE |
| Ga0315904_106466403 | 3300031951 | Freshwater | LTETPDHYDSVKDFIAYGAIYRTVLEAVQDQDFEWKE |
| Ga0315278_122377162 | 3300031997 | Sediment | QAALCMALIKVSRLTETPTHDDSIKDLIAYGALYKTILDAETDADFGWEE |
| Ga0315906_101208118 | 3300032050 | Freshwater | AYLDFPITPHQAALCMALVKVSRLTETPDHYDSVKDFIAYGALYRTVLEAVQDQDFEWKE |
| Ga0315906_102368855 | 3300032050 | Freshwater | DFPITPHQAALCMALVKVSRLTETPDHYDSVKDFIAYGAIYRNVLEAVQDQDFEWKE |
| Ga0315906_110362391 | 3300032050 | Freshwater | DFPITPHQAALCMALVKVSRLTESPDHYDSVKDFIAYGSIYRSVLEAVQDNDFEWKE |
| Ga0315902_101804111 | 3300032093 | Freshwater | LVKVSRLSETPDHHDSIKDFIAYGSVYKTVLDAVQDENWED |
| Ga0315902_101941146 | 3300032093 | Freshwater | PHQAALCMALVKVSRLTETADHYDSIKDFVAYGAIYRTVLEAVQDQDFEWKE |
| Ga0315902_106586831 | 3300032093 | Freshwater | HQAALCMALVKVSRLSETPDHEDSIKDFIAYGSVYKTVLDAVKDENWED |
| Ga0334982_0226226_3_131 | 3300033981 | Freshwater | ALVKVSRLSETPDHEDSIKDFIAYGSVYKTVLDAVKDENWED |
| Ga0334994_0372544_122_253 | 3300033993 | Freshwater | MALVKVSRLTETPDHEDSIKDFIAYGAVYKTVLDAVQDESWDQ |
| Ga0334994_0535479_35_172 | 3300033993 | Freshwater | MALVKVSRLTETPDHYDSVKDFIAYGSIYRTVLEAEQDSEFDWKD |
| Ga0334994_0542797_54_185 | 3300033993 | Freshwater | MALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVKDENWED |
| Ga0334979_0278577_1_126 | 3300033996 | Freshwater | LVKVSRLSETPDHEDSIKDFIAYGSVYKTVLDAVKDENWED |
| Ga0334986_0373181_524_655 | 3300034012 | Freshwater | MALVKVSRLSETPDHEDSIKDFIAYGSVYKTVLDAVQDENWED |
| Ga0334998_0232729_1_111 | 3300034019 | Freshwater | TETPDHYDSVKDFIAYGAIYRNVLEAVQDQDFEWKE |
| Ga0334987_0257979_1_135 | 3300034061 | Freshwater | MALVKVSRLTETPDHEDSIKDFIAYGAVYKTVLDAVKDESWEDQ |
| Ga0334987_0616615_3_110 | 3300034061 | Freshwater | ETPDHYDSIKDFVAYGAIYRTVLEAVQDQDFEWKE |
| Ga0334995_0085370_3_113 | 3300034062 | Freshwater | RLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWED |
| Ga0334995_0105245_2010_2129 | 3300034062 | Freshwater | SRLTETPDHYDSVKDFIAYGAIYRNVLEAVQDQDFEWKE |
| Ga0334995_0748944_12_143 | 3300034062 | Freshwater | MALVKVSRLTETPDHEDSIKDFIAYGAVYKTVLDAVKDDSWDE |
| Ga0335019_0461045_1_126 | 3300034066 | Freshwater | VKVSRLTETPDHEDSIKDFIAYGAVYKTVLDAVKDESWEDQ |
| Ga0310127_049571_58_195 | 3300034072 | Fracking Water | MALVKVSRLTETPDHYDSVKDFIAYGAIYRTVLEAVQDQNFEWKE |
| Ga0310127_305798_53_190 | 3300034072 | Fracking Water | MALVKVSRLTETPDHYDSVKDFIAYGALYRTVLEAVQDQDFEWKE |
| Ga0310130_0178582_54_191 | 3300034073 | Fracking Water | MALVKVSRLTETPDHYDSVKDFIAYGAIYRNVLEAVQDQDFEWKE |
| Ga0335010_0149420_1_120 | 3300034092 | Freshwater | SRLTETPDHYDSIKDFVAYGAIYRTVLEAVQDQDFEWKE |
| Ga0335010_0210369_967_1098 | 3300034092 | Freshwater | MALVKVSRLSETPDHDDSIKDFIAYGSVYKTVLDAVKDENWED |
| Ga0335010_0224575_894_1031 | 3300034092 | Freshwater | MALVKVSRLTESPDHYDSVKDFIAYGAIYRTVLEAEQDSEFDWKD |
| Ga0335010_0228145_1_117 | 3300034092 | Freshwater | VSRLTETPDHEDSIKDFIAYGAVYKTVLDAVQDESWDQ |
| Ga0335010_0331233_731_856 | 3300034092 | Freshwater | LVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVKDENWED |
| Ga0335012_0388936_3_119 | 3300034093 | Freshwater | RLTETPDHYDSVKDFIAYGAIYRNVLEAVQDQDFEWKE |
| Ga0335027_0143532_1_138 | 3300034101 | Freshwater | MALVKVSRLTETPDHYDSIKDFVAYGAIYRTVLEAVQDDDFEWKE |
| Ga0335029_0547692_478_609 | 3300034102 | Freshwater | MALVKVSRLTETPDHQDSIKDFIAYGAVYKTVLDAVQDESWDQ |
| Ga0335031_0234872_26_157 | 3300034104 | Freshwater | MALVKVSRLTETPDHEDSIKDFIAYGAVYKTVLDAVKDENWEE |
| Ga0335036_0408400_754_870 | 3300034106 | Freshwater | VSRLTETPDHQDSIKDFIAYGAVYKTVLDAVKDESWDQ |
| Ga0335036_0669184_463_600 | 3300034106 | Freshwater | MALVKVSRLTETPDHYDSVKDFIAYGSIYRTVLEAEQDADFDWKE |
| Ga0335051_0142441_1101_1226 | 3300034109 | Freshwater | KVSRLTETPDHYDSVKDFIAYGAIYRTVLEAVQDQDFEWKE |
| Ga0335051_0357261_427_561 | 3300034109 | Freshwater | MALVKVSRLSETPDHEDSIKDFIAYGSVYKTVLDAVKDENWEDK |
| Ga0335066_0336276_53_184 | 3300034112 | Freshwater | MALVKVSRLSETPDHYDSIKDFIAYGSVYKTVLDAVQDENWEN |
| Ga0335060_0063299_2192_2299 | 3300034122 | Freshwater | ESPDHYDSVKDFIAYGAIYRTVLEAEQDSEFDWKD |
| Ga0335060_0242237_901_1008 | 3300034122 | Freshwater | ETPDHYDSVKDFIAYGSIYRTVLEAEQDADFDWKE |
| Ga0335060_0532676_440_598 | 3300034122 | Freshwater | PHQAALCMALVKVSRLTETPDHYDSVKDFVAYGAIYRTVLEAVQDQDFEWKE |
| Ga0335013_0280285_952_1068 | 3300034284 | Freshwater | RLTETPDHYDSVKDFVAYGAIYRTVLEAVQDQDFEWKE |
| Ga0335039_0663264_78_218 | 3300034355 | Freshwater | MALVKVSRLTETPDHYDSIKDFIAYGAVYNTVLEAVKDDQFEWGDK |
| Ga0335048_0072536_2018_2143 | 3300034356 | Freshwater | KVSRLTETPNHYDSVKDFIAYGAIYRNVLEAVQDQDFEWKE |
| ⦗Top⦘ |