| Basic Information | |
|---|---|
| Family ID | F055467 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVTF |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 72.46 % |
| % of genes near scaffold ends (potentially truncated) | 98.55 % |
| % of genes from short scaffolds (< 2000 bps) | 95.65 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (67.391 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (34.783 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.870 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.145 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.73% β-sheet: 0.00% Coil/Unstructured: 77.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF07484 | Collar | 31.16 |
| PF13640 | 2OG-FeII_Oxy_3 | 4.35 |
| PF13392 | HNH_3 | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.33 % |
| Unclassified | root | N/A | 16.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_108833931 | Not Available | 520 | Open in IMG/M |
| 3300003277|JGI25908J49247_10141472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300003411|JGI25911J50253_10063826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1212 | Open in IMG/M |
| 3300004240|Ga0007787_10427140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300005527|Ga0068876_10102340 | All Organisms → Viruses → Predicted Viral | 1706 | Open in IMG/M |
| 3300005528|Ga0068872_10186431 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300005581|Ga0049081_10161164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
| 3300005582|Ga0049080_10136151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
| 3300005582|Ga0049080_10141505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
| 3300005583|Ga0049085_10051985 | All Organisms → Viruses → Predicted Viral | 1473 | Open in IMG/M |
| 3300005805|Ga0079957_1275494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300005805|Ga0079957_1353436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300007165|Ga0079302_1074527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300007972|Ga0105745_1101615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| 3300007972|Ga0105745_1243604 | Not Available | 576 | Open in IMG/M |
| 3300008108|Ga0114341_10447166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300008110|Ga0114343_1109005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
| 3300008113|Ga0114346_1145958 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
| 3300008113|Ga0114346_1211296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300008120|Ga0114355_1239479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300008266|Ga0114363_1065781 | All Organisms → Viruses → Predicted Viral | 1394 | Open in IMG/M |
| 3300008448|Ga0114876_1098507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 1171 | Open in IMG/M |
| 3300008450|Ga0114880_1161273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300009056|Ga0102860_1105051 | Not Available | 785 | Open in IMG/M |
| 3300009081|Ga0105098_10356939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300009164|Ga0114975_10355139 | Not Available | 805 | Open in IMG/M |
| 3300009164|Ga0114975_10690267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300009169|Ga0105097_10075269 | All Organisms → Viruses → Predicted Viral | 1833 | Open in IMG/M |
| 3300009180|Ga0114979_10052041 | All Organisms → Viruses → Predicted Viral | 2568 | Open in IMG/M |
| 3300009183|Ga0114974_10440972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300009184|Ga0114976_10217886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1045 | Open in IMG/M |
| 3300012702|Ga0157596_1170942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 578 | Open in IMG/M |
| 3300012776|Ga0138275_1281708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300013006|Ga0164294_10051361 | All Organisms → Viruses → Predicted Viral | 3199 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10617892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300013372|Ga0177922_10312100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300017722|Ga0181347_1092961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 868 | Open in IMG/M |
| 3300017723|Ga0181362_1059589 | Not Available | 784 | Open in IMG/M |
| 3300017723|Ga0181362_1071710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
| 3300017736|Ga0181365_1064085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 910 | Open in IMG/M |
| 3300017736|Ga0181365_1073135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
| 3300017736|Ga0181365_1081461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 793 | Open in IMG/M |
| 3300017736|Ga0181365_1148975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
| 3300017761|Ga0181356_1052746 | Not Available | 1398 | Open in IMG/M |
| 3300017761|Ga0181356_1060122 | All Organisms → Viruses → Predicted Viral | 1293 | Open in IMG/M |
| 3300017761|Ga0181356_1130791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
| 3300017774|Ga0181358_1139597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
| 3300017774|Ga0181358_1207461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300017777|Ga0181357_1048345 | All Organisms → Viruses → Predicted Viral | 1663 | Open in IMG/M |
| 3300017777|Ga0181357_1122547 | Not Available | 974 | Open in IMG/M |
| 3300017777|Ga0181357_1296706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300017778|Ga0181349_1268806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300017778|Ga0181349_1295176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300017780|Ga0181346_1299937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 545 | Open in IMG/M |
| 3300017784|Ga0181348_1090524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1204 | Open in IMG/M |
| 3300017784|Ga0181348_1211408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300017784|Ga0181348_1224138 | Not Available | 662 | Open in IMG/M |
| 3300017785|Ga0181355_1132375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1015 | Open in IMG/M |
| 3300017785|Ga0181355_1133410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1010 | Open in IMG/M |
| 3300017785|Ga0181355_1152843 | Not Available | 931 | Open in IMG/M |
| 3300017785|Ga0181355_1209729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| 3300017785|Ga0181355_1387294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300020048|Ga0207193_1048322 | All Organisms → Viruses → Predicted Viral | 4507 | Open in IMG/M |
| 3300020162|Ga0211735_10953805 | Not Available | 500 | Open in IMG/M |
| 3300020506|Ga0208091_1038242 | Not Available | 525 | Open in IMG/M |
| 3300021140|Ga0214168_1113533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300021962|Ga0222713_10010267 | Not Available | 8442 | Open in IMG/M |
| 3300021962|Ga0222713_10160077 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
| 3300021962|Ga0222713_10313854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 994 | Open in IMG/M |
| 3300021962|Ga0222713_10456846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300021963|Ga0222712_10638410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300022179|Ga0181353_1065404 | Not Available | 936 | Open in IMG/M |
| 3300022179|Ga0181353_1090186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
| 3300022179|Ga0181353_1121749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300022190|Ga0181354_1036712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 1616 | Open in IMG/M |
| 3300022190|Ga0181354_1132168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 794 | Open in IMG/M |
| 3300022190|Ga0181354_1193350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300022407|Ga0181351_1027329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2424 | Open in IMG/M |
| 3300022407|Ga0181351_1047145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1808 | Open in IMG/M |
| 3300022407|Ga0181351_1101308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 1112 | Open in IMG/M |
| 3300022407|Ga0181351_1129677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 934 | Open in IMG/M |
| 3300022407|Ga0181351_1189073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300024346|Ga0244775_11338672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 553 | Open in IMG/M |
| 3300025075|Ga0209615_103548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
| 3300027141|Ga0255076_1041220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
| 3300027608|Ga0208974_1091897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300027608|Ga0208974_1173942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300027659|Ga0208975_1096599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
| 3300027659|Ga0208975_1111615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
| 3300027679|Ga0209769_1056844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1308 | Open in IMG/M |
| 3300027710|Ga0209599_10193282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300027721|Ga0209492_1092294 | All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota → Megaviricetes → Imitervirales → Mimiviridae → unclassified Mimiviridae → Klosneuvirinae → Klosneuvirus → Klosneuvirus KNV1 | 1067 | Open in IMG/M |
| 3300027721|Ga0209492_1164488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 771 | Open in IMG/M |
| 3300027743|Ga0209593_10231995 | Not Available | 644 | Open in IMG/M |
| 3300027759|Ga0209296_1274415 | Not Available | 681 | Open in IMG/M |
| 3300027764|Ga0209134_10301525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300027785|Ga0209246_10171133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
| 3300027808|Ga0209354_10174595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 875 | Open in IMG/M |
| 3300027808|Ga0209354_10190417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 833 | Open in IMG/M |
| 3300027892|Ga0209550_10609957 | Not Available | 639 | Open in IMG/M |
| 3300028025|Ga0247723_1036292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1504 | Open in IMG/M |
| 3300031707|Ga0315291_10633303 | Not Available | 963 | Open in IMG/M |
| 3300031707|Ga0315291_10728114 | Not Available | 876 | Open in IMG/M |
| 3300031758|Ga0315907_10213846 | All Organisms → Viruses → Predicted Viral | 1611 | Open in IMG/M |
| 3300031758|Ga0315907_11006236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300031787|Ga0315900_10390365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1103 | Open in IMG/M |
| 3300031857|Ga0315909_10314870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1162 | Open in IMG/M |
| 3300031885|Ga0315285_10926144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300031885|Ga0315285_10962954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300031951|Ga0315904_10756134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300031951|Ga0315904_10887703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300031952|Ga0315294_10840828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300031952|Ga0315294_11210080 | Not Available | 612 | Open in IMG/M |
| 3300031963|Ga0315901_10633907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 805 | Open in IMG/M |
| 3300032046|Ga0315289_10418662 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300032046|Ga0315289_10654190 | Not Available | 964 | Open in IMG/M |
| 3300032050|Ga0315906_10660963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| 3300032053|Ga0315284_10578340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1345 | Open in IMG/M |
| 3300032053|Ga0315284_10601188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 1312 | Open in IMG/M |
| 3300032053|Ga0315284_11718686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300032053|Ga0315284_11985549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300032093|Ga0315902_10693226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 830 | Open in IMG/M |
| 3300032116|Ga0315903_10913079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 626 | Open in IMG/M |
| 3300032116|Ga0315903_10951134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300032116|Ga0315903_11201460 | Not Available | 511 | Open in IMG/M |
| 3300032156|Ga0315295_10299567 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300032342|Ga0315286_11345122 | Not Available | 691 | Open in IMG/M |
| 3300033233|Ga0334722_11219221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 527 | Open in IMG/M |
| 3300033996|Ga0334979_0488925 | Not Available | 668 | Open in IMG/M |
| 3300034061|Ga0334987_0475890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 768 | Open in IMG/M |
| 3300034062|Ga0334995_0506108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300034073|Ga0310130_0240785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300034102|Ga0335029_0027227 | All Organisms → Viruses → Predicted Viral | 4321 | Open in IMG/M |
| 3300034104|Ga0335031_0507302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300034104|Ga0335031_0561471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300034106|Ga0335036_0363186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 942 | Open in IMG/M |
| 3300034272|Ga0335049_0167998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1559 | Open in IMG/M |
| 3300034283|Ga0335007_0174755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1516 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 34.78% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 10.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.70% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.80% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.07% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.35% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.62% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.45% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.45% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.45% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.45% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.72% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.72% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.72% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.72% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.72% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300012702 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012776 | Freshwater microbial communities from Lake Montjoie, Canada - M_130207_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1088339311 | 3300002408 | Freshwater | MPTQRIQFKDWLPDQPSILDSVSEANNVIPLAIGYG |
| JGI25908J49247_101414722 | 3300003277 | Freshwater Lake | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVNYSADASEDLT |
| JGI25911J50253_100638262 | 3300003411 | Freshwater Lake | MPVQRIAFKDWLPDQPSILDSVSEANNVIPLAVGMVRLSQQ* |
| Ga0007787_104271402 | 3300004240 | Freshwater Lake | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSA |
| Ga0068876_101023404 | 3300005527 | Freshwater Lake | MPVQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPF |
| Ga0068872_101864313 | 3300005528 | Freshwater Lake | MPIQRIAFKDWLPDQPSILDAVSEANNVIPLAVGYGPFKSAVN |
| Ga0049081_101611642 | 3300005581 | Freshwater Lentic | MPVQRIAFKDWLPDQPSILDSVSEANNVIPLAVGYGPFKSAVTFSGAASED |
| Ga0049080_101361512 | 3300005582 | Freshwater Lentic | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYG |
| Ga0049080_101415052 | 3300005582 | Freshwater Lentic | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKS |
| Ga0049085_100519851 | 3300005583 | Freshwater Lentic | MTTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGQF |
| Ga0079957_12754941 | 3300005805 | Lake | MPVQRIAFKDWLPDQPSILDAVSKANNVIPLAVGY |
| Ga0079957_13534361 | 3300005805 | Lake | MPIQRIAFKDWLPDQPSILDAVSKANNVIPLAVGY |
| Ga0079302_10745271 | 3300007165 | Deep Subsurface | MPTQRIAFKEWLPDQPSILDTVSEANNVIPLAVGYGPFKSAV |
| Ga0105745_11016151 | 3300007972 | Estuary Water | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVNYS |
| Ga0105745_12436041 | 3300007972 | Estuary Water | MTTQRIQFKDWLPDQPSILDTVAEANNVIPLAVGYGA |
| Ga0114341_104471662 | 3300008108 | Freshwater, Plankton | MPVQRIAFKDWLPDQPSILDSVSEANNVIPLAVGYGPFKSAVTFSGA |
| Ga0114343_11090051 | 3300008110 | Freshwater, Plankton | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVTFS |
| Ga0114346_11459581 | 3300008113 | Freshwater, Plankton | MPTQRIAFKEWLPDQPSILDTVSEANNVIPLAVGYGPFKSPVNYSANAS |
| Ga0114346_12112961 | 3300008113 | Freshwater, Plankton | MPTQRIAFKDWLPDQPSILESVSEANNVIPLAVGYGPFKSAVTFSGAASE |
| Ga0114355_12394791 | 3300008120 | Freshwater, Plankton | MPTQRIAFKEWLPDQPSILDTVSEANNVIPLAVGYGPFKSPVNYS |
| Ga0114363_10657811 | 3300008266 | Freshwater, Plankton | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVNYSGVA |
| Ga0114876_10985071 | 3300008448 | Freshwater Lake | MPTQRIQFKEWLPDQPSILDSVSEANNVIPLAVGYGAFKSAVSYSGVA |
| Ga0114880_11612731 | 3300008450 | Freshwater Lake | MPIQRIAFKDWLPDQPSILDAVSKANNVIPLAVGYG |
| Ga0102860_11050513 | 3300009056 | Estuarine | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFK |
| Ga0105098_103569391 | 3300009081 | Freshwater Sediment | MPTQRIAFKEWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVTY |
| Ga0114975_103551392 | 3300009164 | Freshwater Lake | MTTQRIQFKDWLPDQPSILDTVSEANNVIPLAIGYGPFKSAVNYSGAATEDLNN |
| Ga0114975_106902672 | 3300009164 | Freshwater Lake | MPTQRIAFKDWLPDQPSILETVSEANNVIPLAVGYGPFKSAVNYSGAATE |
| Ga0105097_100752691 | 3300009169 | Freshwater Sediment | MPIQRIAFKDWLPDQPSILDAVSEANNVIPLAVGY |
| Ga0114979_100520414 | 3300009180 | Freshwater Lake | MATQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVNFSSDASENL |
| Ga0114974_104409721 | 3300009183 | Freshwater Lake | MPTQRIAFKDWLPDQPSILETVSEANNVIPLAVGYGPFKSAVNYSLA |
| Ga0114976_102178861 | 3300009184 | Freshwater Lake | MATQRITFKDWLPDQPSILDTVSEANNVIPLAVGYGA |
| Ga0157596_11709422 | 3300012702 | Freshwater | MPTQRITFKEWLPDQPSILDSVSEANNVIPLAIGYGPFKSSVNY |
| Ga0138275_12817082 | 3300012776 | Freshwater Lake | MPTQRIQFKEWLPDQPSILDAVSEVNNVIPLAVGYGSFKSA |
| Ga0164294_100513616 | 3300013006 | Freshwater | MPTQRIQFKDWLPDQPSILDTVSQANNVIPLAVGYGAFKSAV |
| (restricted) Ga0172371_106178922 | 3300013138 | Freshwater | MPTQRIAFKDWLPDQPSILDSVSEANNVIPLAVGYGPFKSAVQFSG |
| Ga0177922_103121002 | 3300013372 | Freshwater | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVNYS |
| Ga0181347_10929612 | 3300017722 | Freshwater Lake | MTTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVDYSASASEDLTN |
| Ga0181362_10595891 | 3300017723 | Freshwater Lake | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVNYSADASEDLTNV |
| Ga0181362_10717102 | 3300017723 | Freshwater Lake | MPTQRIQFKDWLPDQPSILDTVAEANNVIPLAVGYGAFKSAVDYSA |
| Ga0181365_10640851 | 3300017736 | Freshwater Lake | MTTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYG |
| Ga0181365_10731351 | 3300017736 | Freshwater Lake | MPTQRIQFKDWLPDQPSILDTVSQANNVIPLAVGYGPFKSAVTFSGAASEDLNN |
| Ga0181365_10814611 | 3300017736 | Freshwater Lake | MTTQRIQFKDWLPDQPSILDTVAEANNVIPLAVGYG |
| Ga0181365_11489751 | 3300017736 | Freshwater Lake | MPVQRIAFKDWLPDQPSILDSVSEANNVIPLAVGYGP |
| Ga0181356_10527461 | 3300017761 | Freshwater Lake | MPVQRIAFKDWLPDQPSILDSVSEANNVIPLAVGYGPFKSAVTFSGAASEDLNN |
| Ga0181356_10601223 | 3300017761 | Freshwater Lake | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVNYSADANEDLT |
| Ga0181356_11307912 | 3300017761 | Freshwater Lake | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVNYSADASEDLTNVFAAK |
| Ga0181358_11395971 | 3300017774 | Freshwater Lake | MPTQRIAFKDWLPDQPSILDTVSQANNVIPLAVRYG |
| Ga0181358_12074611 | 3300017774 | Freshwater Lake | MPVQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPSKSAVTFSGAASEDLNNCF |
| Ga0181357_10483453 | 3300017777 | Freshwater Lake | MTTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFM |
| Ga0181357_11225471 | 3300017777 | Freshwater Lake | MPTQRIQFKDWLPDQPSILDTVAEANNVIPLAVGYGAFKSAVDY |
| Ga0181357_12967061 | 3300017777 | Freshwater Lake | MPTQRIAFKDWLPDQPSILDSVSEANNVIPLAVGYGPFKSAVT |
| Ga0181349_12688062 | 3300017778 | Freshwater Lake | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVTFSGAASEDLN |
| Ga0181349_12951761 | 3300017778 | Freshwater Lake | MPVQRIAFKDWLPDQPSILDSVSEANNVIPLAVGYGPFK |
| Ga0181346_12999371 | 3300017780 | Freshwater Lake | MATQRITFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVDY |
| Ga0181348_10905243 | 3300017784 | Freshwater Lake | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVDYSA |
| Ga0181348_12114081 | 3300017784 | Freshwater Lake | MPVQRIAFKDWLPDQPSILDSVSEANNVIPLAVGYGPFKSAVTF |
| Ga0181348_12241381 | 3300017784 | Freshwater Lake | MTTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGQFKSAVNYSAS |
| Ga0181355_11323751 | 3300017785 | Freshwater Lake | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVTFSG |
| Ga0181355_11334101 | 3300017785 | Freshwater Lake | MPVQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVTFSGAASEDLNNCF |
| Ga0181355_11528431 | 3300017785 | Freshwater Lake | MTTQRIQFKDWLPDQPSILDTVSQANNVIPLAVGYGQFKSAVNY |
| Ga0181355_12097291 | 3300017785 | Freshwater Lake | MPTQRIAFKDWLPDQPSILDSVSEANNVIPLAVGYGPF |
| Ga0181355_13872941 | 3300017785 | Freshwater Lake | MPTQRIQFKDWLPDQPSILDTVAEANNVIPLAVGYGAFKSAVNYSESASEDLTNV |
| Ga0207193_10483228 | 3300020048 | Freshwater Lake Sediment | MPTQRIQFKDWLPDQPSILDAVSEANNVIPLAIGYGPFKT |
| Ga0211735_109538051 | 3300020162 | Freshwater | MATQRIQFKDWLPDQPSILDTVSEANNVIPLAIGYGPFKS |
| Ga0208091_10382421 | 3300020506 | Freshwater | MTTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGSFKSAVDYSASASEDLTN |
| Ga0214168_11135331 | 3300021140 | Freshwater | MPTQRITFKEWLPDQPSVLDSVSEANNVIPLAIGYGPFK |
| Ga0222713_100102671 | 3300021962 | Estuarine Water | MPVQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAV |
| Ga0222713_101600771 | 3300021962 | Estuarine Water | MPVQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVT |
| Ga0222713_103138543 | 3300021962 | Estuarine Water | MPTQRIAFKDWLPDQPSILDSVSEANNVIPAAVGY |
| Ga0222713_104568462 | 3300021962 | Estuarine Water | MPIQRIAFKEWLPDQPSVLDAVSEANNVIPLAVGYGPFKSAVNYSQSAS |
| Ga0222712_106384102 | 3300021963 | Estuarine Water | MPTQRIAFKEWLPDQPSILDSVSEANNVIPLAVGYGPFKSAVN |
| Ga0181353_10654041 | 3300022179 | Freshwater Lake | MTTQRIQFKDWLPDQPSILDTVSEANNVTPLAIGYGPFKSAVNYSASASEDLTNVFAT |
| Ga0181353_10901862 | 3300022179 | Freshwater Lake | MPVQRIAFKDWLPDQPSILDTVSEANKVIPLAVGYGPFKSAVTFSGAA |
| Ga0181353_11217492 | 3300022179 | Freshwater Lake | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVTF |
| Ga0181354_10367123 | 3300022190 | Freshwater Lake | MPTQRIQFKDWLPDQPSILDTVAEANNVIPLAVGYGA |
| Ga0181354_11321682 | 3300022190 | Freshwater Lake | MPVQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVTFSGAASEDLNN |
| Ga0181354_11933501 | 3300022190 | Freshwater Lake | MPVQRIAFKDWLPDQPSILDSVSEANNVIPLAVGYGPFKSAVTFSGAASEDLNNCF |
| Ga0181351_10273295 | 3300022407 | Freshwater Lake | MPVQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVTFS |
| Ga0181351_10471453 | 3300022407 | Freshwater Lake | MTTQRIQFKDWLPDQPSILDTVSEANNVIPLALGYGAFKSAVNY |
| Ga0181351_11013083 | 3300022407 | Freshwater Lake | MTTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVNS |
| Ga0181351_11296773 | 3300022407 | Freshwater Lake | MPVQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSA |
| Ga0181351_11890732 | 3300022407 | Freshwater Lake | MPVQRIAFKDWLPDQPSILDSVSEANNVIPLAVGYGPFKSAVTFSG |
| Ga0244775_113386721 | 3300024346 | Estuarine | MTTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGQ |
| Ga0209615_1035481 | 3300025075 | Freshwater | MPTQRITFKEWLPDQPSILDSVSEANNVIPLAVGYGPFKSSVNYSGAASEALN |
| Ga0255076_10412202 | 3300027141 | Freshwater | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVNYSADASEDLTNVF |
| Ga0208974_10918971 | 3300027608 | Freshwater Lentic | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVTFSGAASEDLNNCF |
| Ga0208974_11739422 | 3300027608 | Freshwater Lentic | MPTQRIQFKDWLPDQPSILDTVAEANNVIPLAVGYGAFKSAV |
| Ga0208975_10965992 | 3300027659 | Freshwater Lentic | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGY |
| Ga0208975_11116151 | 3300027659 | Freshwater Lentic | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVTFSGA |
| Ga0209769_10568443 | 3300027679 | Freshwater Lake | MPVQRIAFKDWLPDQPSILDSVSEANNVIPLAVGYG |
| Ga0209599_101932822 | 3300027710 | Deep Subsurface | MATQRITFKEWLPDQPTVLDCLTDAKNVVPVAVGYAPM |
| Ga0209492_10922941 | 3300027721 | Freshwater Sediment | MGITLGILMPTQRIAFKEWLPDQPSILDSVSEANNVIPLAVGYGPF |
| Ga0209492_11644881 | 3300027721 | Freshwater Sediment | MPIQRIAFKDWLPDQPSILDAVSEANNVIPLAVGYGPFKSA |
| Ga0209593_102319953 | 3300027743 | Freshwater Sediment | MPTQRIAFKEWLPDQPSILDSVSEANNVIPLAVGYGPFKSAVTFSGAASEEL |
| Ga0209296_12744152 | 3300027759 | Freshwater Lake | MPTQRIAFKDWLPDQPSILETVSEANNVIPLAVGYGPFKSAVNYSL |
| Ga0209134_103015252 | 3300027764 | Freshwater Lake | MPTQRIQFKEWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVNYSSAASEAL |
| Ga0209246_101711331 | 3300027785 | Freshwater Lake | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAV |
| Ga0209354_101745952 | 3300027808 | Freshwater Lake | MTTQRIQFKDWLPDQPSILDTVAEANNVIPLAVGY |
| Ga0209354_101904172 | 3300027808 | Freshwater Lake | MPVQRIAFKDWLPDQPSILDSVSEANNVIPLAVGYGPFKSAVTFSGAASE |
| Ga0209550_106099572 | 3300027892 | Freshwater Lake | MTTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGPFK |
| Ga0247723_10362923 | 3300028025 | Deep Subsurface Sediment | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAIGYGPFKSAVNYSGAATEDLNN |
| Ga0315291_106333033 | 3300031707 | Sediment | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGQFKSA |
| Ga0315291_107281142 | 3300031707 | Sediment | MTTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSA |
| Ga0315907_102138461 | 3300031758 | Freshwater | MPTQRIAFKEWLPDQPSILDSVSEANNVIPLAVGYGPFKSAVTFSGAASEDLNNC |
| Ga0315907_110062362 | 3300031758 | Freshwater | MPVQRIAFKDWLPDQPSILESVSEANNVIPLAVGYGPFKSA |
| Ga0315900_103903651 | 3300031787 | Freshwater | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVTFSGAASEDLNN |
| Ga0315909_103148701 | 3300031857 | Freshwater | MPTQRIAFKEWLPDQPSILDTVSEANNVSPLAVGYG |
| Ga0315285_109261441 | 3300031885 | Sediment | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVD |
| Ga0315285_109629542 | 3300031885 | Sediment | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVN |
| Ga0315904_107561341 | 3300031951 | Freshwater | MPVQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGP |
| Ga0315904_108877032 | 3300031951 | Freshwater | MPIQRIAFKDWLPDQPSILDAVSEANNVIPLAVGYGPF |
| Ga0315294_108408281 | 3300031952 | Sediment | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVNYSASASEDL |
| Ga0315294_112100802 | 3300031952 | Sediment | MPTQRIQFKDWLPDQPSIIDTVSEANNVIPLAIGYGPFKSAVNYSSAATEDLTNC |
| Ga0315901_106339072 | 3300031963 | Freshwater | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFK |
| Ga0315289_104186623 | 3300032046 | Sediment | MTTQRIQFKDWLPDQPSILDTVAEANNVIPLAVGYGAF |
| Ga0315289_106541902 | 3300032046 | Sediment | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAI |
| Ga0315906_106609632 | 3300032050 | Freshwater | MPIQRIAFKDWLPDQPSILDAVSKANNVIPLAVGYGPFKSAVNYS |
| Ga0315284_105783401 | 3300032053 | Sediment | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVNY |
| Ga0315284_106011883 | 3300032053 | Sediment | MTTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVNYSASASEDLTNV |
| Ga0315284_117186861 | 3300032053 | Sediment | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVNYSASASED |
| Ga0315284_119855492 | 3300032053 | Sediment | MPTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVDYSASASEDLT |
| Ga0315902_106932261 | 3300032093 | Freshwater | MPIQRIAFKDWLPDQPSILDAVSKANNVIPLAVGYGPFKSAVNYSGD |
| Ga0315903_109130791 | 3300032116 | Freshwater | MPTQRIQFKEWLPDQPSILDSVSEANNVIPLAVGYGAFKSAVSYSGVATENLTNCFAAK |
| Ga0315903_109511341 | 3300032116 | Freshwater | MPVQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVTFSG |
| Ga0315903_112014602 | 3300032116 | Freshwater | MPVQRIAFKDWLPDQPSILDSVSEANNVIPLAVGYGPFKSAVTFSGAASEDLNNCFA |
| Ga0315295_102995671 | 3300032156 | Sediment | MTTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAF |
| Ga0315286_113451221 | 3300032342 | Sediment | MTTQRIQFKDWLPDQPSILDTVAEANNVIPLAVGYGAFKSAVNYSADASED |
| Ga0334722_112192211 | 3300033233 | Sediment | MTTQRIQFKDWLPDQPSILDTVSEANNVIPLAVGYGAFKSAVNYSASASEDLTNVF |
| Ga0334979_0488925_497_667 | 3300033996 | Freshwater | MPTQRIAFKEWLPDQPSILDSVSEANNVIPLAVGYGPFKSAVTYSGVATEALNNVFA |
| Ga0334987_0475890_1_135 | 3300034061 | Freshwater | MPVQRIAFKDWLPDQPSILDSVSEANNVIPLAVGYGPFKSAVTFS |
| Ga0334995_0506108_1_153 | 3300034062 | Freshwater | MPTQRIAFKEWLPDQPSILDSVSEANNVIPLAVGYGPFKSAVTFSGAASED |
| Ga0310130_0240785_3_158 | 3300034073 | Fracking Water | MPTQRITFKEWLPDQPSILDSVSEANNVIPLAIGYGPFKSAVNYSGAATEDL |
| Ga0335029_0027227_1_165 | 3300034102 | Freshwater | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVTFSGAASEDLNNC |
| Ga0335031_0507302_2_127 | 3300034104 | Freshwater | MPVQRIAFKEWLPDQPSILDSVSEANNVIPLAVGYGPFKSAV |
| Ga0335031_0561471_3_176 | 3300034104 | Freshwater | MPVQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVTFSGAASEDLNNCFAA |
| Ga0335036_0363186_2_148 | 3300034106 | Freshwater | MPTQRIAFKDWLPDQPSILDTVSEANNVIPLAVGYGPFKSAVTFSGAAS |
| Ga0335049_0167998_1447_1557 | 3300034272 | Freshwater | MPTQRIQFKEWLPDQPSILDTVSEANNVIPLAVGYGP |
| Ga0335007_0174755_1373_1516 | 3300034283 | Freshwater | MATQRITFKEWLPDQPSILDSVSEANNVIPLAIGYGPFKSAVTYSGVA |
| ⦗Top⦘ |