| Basic Information | |
|---|---|
| Family ID | F055345 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MRPEAKAQIYSVNENLPADQVARMGVLDQLERTRRKEKKSGEVAEK |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.70 % |
| % of genes near scaffold ends (potentially truncated) | 73.19 % |
| % of genes from short scaffolds (< 2000 bps) | 97.83 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (97.101 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (72.464 % of family members) |
| Environment Ontology (ENVO) | Unclassified (94.203 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (91.304 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.76% β-sheet: 0.00% Coil/Unstructured: 43.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF07893 | DUF1668 | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 97.10 % |
| All Organisms | root | All Organisms | 2.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 72.46% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 15.22% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 5.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
| 3300009973 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG | Host-Associated | Open in IMG/M |
| 3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
| 3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
| 3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
| 3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028140 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028141 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028144 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028251 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028471 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028523 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032589 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032790 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032843 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062593_1027336841 | 3300004114 | Soil | MRPEAKAQIYSVNEDLPANQVARM*GALDQLERTRGKEKAGEAADEKVNCK* |
| Ga0070704_1019937831 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPEAKAQIYSINENLLANQVARM*DVLDHLERARRNKKDGEAADEKVNCK* |
| Ga0068859_1029272861 | 3300005617 | Switchgrass Rhizosphere | MRPEAKAQIYSVNENLPADQVARM*GVLDQLERTRR |
| Ga0068858_1015459522 | 3300005842 | Switchgrass Rhizosphere | RPEAKAQIYSVNENLPANQVARM*DVLDQLERTRKKKKDGEAADEKVNCK* |
| Ga0068860_1027895411 | 3300005843 | Switchgrass Rhizosphere | MRPEAKAQIYSVNENLPADQVARM*CVLDQLERTRRKEKKSGE |
| Ga0105137_1032091 | 3300009972 | Switchgrass Associated | MRSEAKAQIYSVNENLPADQVARM*GVLDQLERTRRKEKKSGEVAEKKIAGKR* |
| Ga0105136_1097141 | 3300009973 | Switchgrass Associated | MRPEAKAQIYSVNENLPADQVARM*GVLDQLERTRRKEKKSGEAAEK* |
| Ga0105129_1070071 | 3300009975 | Switchgrass Associated | MRPKAKAQIYSVNENLPADQIARM*GVLDQLERTRRKEKKSGEVAEK* |
| Ga0105128_1201941 | 3300009976 | Switchgrass Associated | MRPEANAQIYSVNENLPADQVAQM*DVLDQLERARRKEKKSGEVAEK* |
| Ga0105135_1056911 | 3300009980 | Switchgrass Associated | MHPEAKTQIYSVNEDLPANQVARMRGVLDQLERTRIKRKKDGEVADGKVICM* |
| Ga0105131_1175171 | 3300009989 | Switchgrass Associated | MRQEAKAQIYSVNKNLPANQVARM*DVLDQLERARKKKKDGEAVDEKVNCK |
| Ga0105120_10128691 | 3300009992 | Switchgrass Associated | MRPEAKAQIYSVNENLPADQVARM*GVLDQLERTRRKEKKSGEVAEK* |
| Ga0105139_10988911 | 3300009995 | Switchgrass Associated | MRPEAKAQIYSINEDLPANQVGRMQGVLDQLERTHIKEKRMAKSSMEK* |
| Ga0134126_121284401 | 3300010396 | Terrestrial Soil | MRTEAKAQIYSVNKNLPANQVARM*DVLDQLERTHRKEKGMAKSPT |
| Ga0134121_123330272 | 3300010401 | Terrestrial Soil | MLPEAKAQIYSVNKNLPADQVARM*GVIDQLERTRRK |
| Ga0157379_116550321 | 3300014968 | Switchgrass Rhizosphere | MRPETKAQIYSVNENLPANQVALM*GVLDQLERTRGK |
| Ga0182183_10631391 | 3300015270 | Switchgrass Phyllosphere | MHPEAKAQIYSINEDLPANQVARI*GVLDRLERTRKKKKKRGGEV |
| Ga0182102_10072721 | 3300015273 | Switchgrass Phyllosphere | MRPEAKAQIYSVDENLPADQVARM*CILDQLERTRRKEKKSGEVAEK* |
| Ga0182099_10089151 | 3300015278 | Switchgrass Phyllosphere | MRPEAKAQIFSVNENSTANQVARL*GVLDQLERTREKKKKMA |
| Ga0182100_10100831 | 3300015280 | Switchgrass Phyllosphere | AQIYSVNENLPADQVARM*CILDQLERTRRKEKKSGEVTEK* |
| Ga0182100_10526461 | 3300015280 | Switchgrass Phyllosphere | MCPEAKAQIYSVNENLPADQVARM*DILDQLERTRRKEKKSCEV |
| Ga0182101_10067411 | 3300015284 | Switchgrass Phyllosphere | MHPEAKAQIYSVNKNLPADQVARM*GVLDQLERTRRKEKKSGEVAEK* |
| Ga0182101_10531581 | 3300015284 | Switchgrass Phyllosphere | *IDLNEATAMRPEAKAQIYSVNENLPVDQVSRM*CVFDQLERTRRKEKKSGEVVEK* |
| Ga0182101_10542611 | 3300015284 | Switchgrass Phyllosphere | MRLEGKAQIYSVNEDLPANHVARMLGILDRLERTREKENGEAADGKK* |
| Ga0182105_10725261 | 3300015290 | Switchgrass Phyllosphere | MRPEAKAQIYSLNKDLPANQVAQM*GVLDQLERTRRKEKGW |
| Ga0182103_10635091 | 3300015293 | Switchgrass Phyllosphere | MRPEAKAQIYSVNENLPANQVARM*GVLDLLERTRGKKKKDGDVA |
| Ga0182104_10116871 | 3300015297 | Switchgrass Phyllosphere | MRPEAKAQIYLVNENLLADQLARM*GVLDQLEKTRRKEKKSGEVAEK* |
| Ga0182180_10620322 | 3300015306 | Switchgrass Phyllosphere | MRPEAKTQIYLVDENLPANQVARM*GILDQLERTHKEKEDGEVPDEKLKCK |
| Ga0182098_10185952 | 3300015309 | Switchgrass Phyllosphere | MRPEAKAQIYSVNKNLPADQVARM*DVLDQLEKTRRKEKKSGEVAEK* |
| Ga0182098_10368061 | 3300015309 | Switchgrass Phyllosphere | MRPEAKAQIYSVNKNLPANQVAQM*GVLDWLERTRRKKKMAMP |
| Ga0182098_10450021 | 3300015309 | Switchgrass Phyllosphere | MRPEGKAQIYLVDENLPANQVARM*GVLDQLERTRPKEKKSGEVAEK* |
| Ga0182098_10876032 | 3300015309 | Switchgrass Phyllosphere | MRPEAKAQIYLVNEILPVDQVARM*GVLNQLERTR |
| Ga0182162_10175481 | 3300015310 | Switchgrass Phyllosphere | MRPEAKTQIYSVNENLPADQVARM*DVIDQLKRTRRKAKKSGEVAEK* |
| Ga0182162_10355861 | 3300015310 | Switchgrass Phyllosphere | MRPEAKAQIYSVNENLPANQVARM*GILDQLKRARRKKKDGEVADEKVNC |
| Ga0182182_10517192 | 3300015311 | Switchgrass Phyllosphere | KF*IDLNEATAMRPEAKAQIYSVNENLPADQIARM*CVLDQLERTRRKEKKSGEVAEK* |
| Ga0182182_10917041 | 3300015311 | Switchgrass Phyllosphere | MRPEDKAQIYSVNKNLPANQIARMLDVLNQLERARRKKKYGEPADEKVNCK |
| Ga0182164_10712561 | 3300015313 | Switchgrass Phyllosphere | KAQIYLVNENLPADQVARM*GVLDQLERTHRKEKKSGEVAEK* |
| Ga0182121_10753431 | 3300015316 | Switchgrass Phyllosphere | MRPEAKAQIYTVNKNLPADRVARM*GVLDQLERTRRKEKKSGEVAEK* |
| Ga0182121_11153271 | 3300015316 | Switchgrass Phyllosphere | MRPEAKSQIYSVNENSPEDQAAQM*GVLDQLERTRRKG |
| Ga0182121_11249182 | 3300015316 | Switchgrass Phyllosphere | MRPEAKAQIYSVNENLPADQVARM*DVLDQLERARRKEKKSGE |
| Ga0182136_10077341 | 3300015317 | Switchgrass Phyllosphere | MRPEAKAHIYSVNENLPENQVARM*GILDQLERTREKEKDGEAVDGKVNCK* |
| Ga0182136_10760002 | 3300015317 | Switchgrass Phyllosphere | MRLEAKAQIYSVNENLPADQVAQMLGIHDQLERTRGKRK* |
| Ga0182136_10866852 | 3300015317 | Switchgrass Phyllosphere | MRPDAKAQIYSVNENLLADQVARM*CVRDQLERTRRKEKKSDKVAEK* |
| Ga0182181_10340401 | 3300015318 | Switchgrass Phyllosphere | MRLEAKAQIYSVNENLPADQVARM*GVLDQLERTR*KEKKSGEVAEK* |
| Ga0182181_10367972 | 3300015318 | Switchgrass Phyllosphere | EAKAQIYSVNENLPADQVARM*CVLDQLERTRRKEKKSGEVSEK* |
| Ga0182130_10261801 | 3300015319 | Switchgrass Phyllosphere | F*IDLNEAIAMRPEAKAQIYLVNENLLADQLARM*GVLDQLERTRRKEKKSGEVTEK* |
| Ga0182130_11023981 | 3300015319 | Switchgrass Phyllosphere | MCPEAKAQVYSVNENLPANQVARM*DVIDQLERTRRKEKR |
| Ga0182130_11213891 | 3300015319 | Switchgrass Phyllosphere | MLPEAKAQIYSVNENLPANQVARM*GVLDQLERTRE |
| Ga0182134_11110681 | 3300015324 | Switchgrass Phyllosphere | RSEAKAQIYSVNEKLPANQLAQM*DVLDRLERAREKKKDGEAADEKVNCK* |
| Ga0182134_11409691 | 3300015324 | Switchgrass Phyllosphere | MHLEAKAQIYSVNEDLPANQVA*M*GVLDQLERTREKEKVGEVADRKVN |
| Ga0182134_11446851 | 3300015324 | Switchgrass Phyllosphere | MRPEAKAQIYSVNKNLPANQVARM*DVFDQLERTRRK |
| Ga0182148_10645502 | 3300015325 | Switchgrass Phyllosphere | MKEATTIRPEAKAQIYSVNENLAADQVARM*GVLDQLERTRRKE |
| Ga0182166_10642811 | 3300015326 | Switchgrass Phyllosphere | MRPEAKAQIYSVNENLPANQVARM*GVLDQLERTREKAKDGEAADEKSKLQVE* |
| Ga0182114_10961241 | 3300015327 | Switchgrass Phyllosphere | MRPEAKAQIYSVNKNLPADRVARM*GVLDQLERTRRKAI |
| Ga0182114_11337361 | 3300015327 | Switchgrass Phyllosphere | MRPETKAQIYSVNENLPANQVALM*GVLDQLERTRGKEK |
| Ga0182152_11334081 | 3300015330 | Switchgrass Phyllosphere | MRLEAKAHIYSVNKNLPADQVARM*GVLDQLERTRRKEKKS |
| Ga0182117_10306651 | 3300015332 | Switchgrass Phyllosphere | RPESKAQIYSVNEILPADEVARM*GVLDQLERTRRKEKKSGEVAEK* |
| Ga0182117_11184081 | 3300015332 | Switchgrass Phyllosphere | MRPEAKAQIYSVNENLPADQVARM*GVLDQLERTRRKEKKSGKVAEK |
| Ga0182116_10259251 | 3300015335 | Switchgrass Phyllosphere | MRPEAKAQIYSVNKNLPANQVARM*DVQDQLERTRRKKKDGEAAD |
| Ga0182116_10545451 | 3300015335 | Switchgrass Phyllosphere | MMRPEAKAQIYSVNENLPADGVARM*DFLDQLERTRRKEKKSGEVAEK* |
| Ga0182116_11275271 | 3300015335 | Switchgrass Phyllosphere | MRLEAKAQIYSINENLPADQVARM*GVLDQLERTLRKEKKSGEVAEK* |
| Ga0182116_11350421 | 3300015335 | Switchgrass Phyllosphere | RPEAKAQIHSVNEHLPANQVARM*GVLDRLERTREKENGEAADGKK* |
| Ga0182150_10615011 | 3300015336 | Switchgrass Phyllosphere | *IDLNEATAMRPEAKAQIYSVNENLPADQVARM*CVLDQLERTHRKEKKSGEVAEK* |
| Ga0182150_10708481 | 3300015336 | Switchgrass Phyllosphere | LNEVTAMRPEAKTQIYSVNENLRVDQVARM*GVLDQLERTLRKEKKSGEVAEK* |
| Ga0182150_11532111 | 3300015336 | Switchgrass Phyllosphere | MRPEAKAQIYSVNENLPADQVARM*GVLDQLERTR |
| Ga0182151_10688661 | 3300015337 | Switchgrass Phyllosphere | PEAKAQIYSVNENLPANQVARM*GVHAKKEKHGEVADRKVNCK* |
| Ga0182151_10821981 | 3300015337 | Switchgrass Phyllosphere | MHPEAKTQIYLVNENLPANQVA*M*GVLDQLERTREKEKDG |
| Ga0182151_11335272 | 3300015337 | Switchgrass Phyllosphere | RPEAKAQIYSVNKNFPVNQVARM*DVLDQLEIARGKKKDGEAADEKVNCK* |
| Ga0182151_11560871 | 3300015337 | Switchgrass Phyllosphere | MPPEAKTQIYLVNEDLPANQVARM*GVLDQLERTREKKKDGEV |
| Ga0182137_10295241 | 3300015338 | Switchgrass Phyllosphere | SVNENLPADQVA*M*DVLDQLERTRRKEKTSDEVVEK* |
| Ga0182137_10312204 | 3300015338 | Switchgrass Phyllosphere | AKAQIYSVNENLPADQVARM*GVLDQLERTRRKEKKSGEIAEK* |
| Ga0182137_11071931 | 3300015338 | Switchgrass Phyllosphere | MHPEAKAQIYSVDENLPANQVARM*GVLDQLERTRIKLYYYYS |
| Ga0182137_11332991 | 3300015338 | Switchgrass Phyllosphere | CPEAKAQIYSVNENLPANQVTRM*GVLDQLERTREKEKDGEAADGKVNCEKSKVL* |
| Ga0182149_11138471 | 3300015339 | Switchgrass Phyllosphere | MRPEAKAQIYSVNENLPANQVARM*GVLDQLERTREKEKDGEAADEKSKLQVE* |
| Ga0182149_11560531 | 3300015339 | Switchgrass Phyllosphere | PEAKAQIYSVNENLPANQVARM*GVLDQLKRTREKEKMGEAADEKVNCT* |
| Ga0182115_10243381 | 3300015348 | Switchgrass Phyllosphere | MRPEAKAQIYSVNENLPVDHVARM*GVLDQLERARRKEKKSDEVAEK* |
| Ga0182115_10753201 | 3300015348 | Switchgrass Phyllosphere | F*IDLNEATAMRPEAEAQIYSVNENLPADQVARM*CVLDQLERTCRKEKKSGEVAEK* |
| Ga0182185_10374732 | 3300015349 | Switchgrass Phyllosphere | F*IDLNEATAMRPEAKAQIYSVNENLPADQVARM*DVLDQLERARRKEKKSGEVAEK* |
| Ga0182185_12255961 | 3300015349 | Switchgrass Phyllosphere | MRPEVKAQIYSVNENLPANQVARM*DVLDQLERTRRKKKDG |
| Ga0182185_12837521 | 3300015349 | Switchgrass Phyllosphere | LDNF*IDLNEATAMGPEAKAQIYSVNEKLPADKVARM*CVLDQLERTHRKEKKSGEVTEK |
| Ga0182163_10667823 | 3300015350 | Switchgrass Phyllosphere | F*IDLNEASAMRPEAKAQIYLVNKNLPADQVART*GILDQLERTRRKEKKSGEVAEK* |
| Ga0182163_10988951 | 3300015350 | Switchgrass Phyllosphere | SVNENLPADQVARM*CVLDQLERTRRKEKKSGEVAEK* |
| Ga0182163_12697831 | 3300015350 | Switchgrass Phyllosphere | MRPVAKAPIYSVNENLPADQVARM*GVLDQLERTR |
| Ga0182163_12884461 | 3300015350 | Switchgrass Phyllosphere | MRPEAKAQIYLVNENLPANQVARM*GVLDQLERTRGKEKDGEV |
| Ga0182169_11916051 | 3300015352 | Switchgrass Phyllosphere | C*IDLNEATVMRPEAKAQIYLVNENLPADQVARM*CILDQLERTHRKEKKSGEVAEK* |
| Ga0182169_12001371 | 3300015352 | Switchgrass Phyllosphere | MRPETKAQIYSVNENLPANQVALM*GVLDQLERTRGKEKDG |
| Ga0182179_11309991 | 3300015353 | Switchgrass Phyllosphere | AMRLEAKAQIYSVNENLPADQIAQMLGIHDQLERTRGKRK* |
| Ga0182179_12633481 | 3300015353 | Switchgrass Phyllosphere | MRPEAKAQIYSVNENLKANQVAGM*GILDRLERTRRKKKDGEAA |
| Ga0182179_12723781 | 3300015353 | Switchgrass Phyllosphere | MRPETKAQIYSVNENLPANQVALM*GVLDQLERTRGKEKRMAKSP |
| Ga0182179_12867101 | 3300015353 | Switchgrass Phyllosphere | MRPETKAQIYSVNENLPANQVARM*GVLDQLERTREKK |
| Ga0182167_12040121 | 3300015354 | Switchgrass Phyllosphere | AQIYSVNEKLPADKVARM*CVLDQLERTHRKEKKSGEVTEK* |
| Ga0182167_12817871 | 3300015354 | Switchgrass Phyllosphere | MRPEAKAQIYSVNENLKANQVARM*GILDRLERTRRKKKDGEAA |
| Ga0182197_11061132 | 3300017408 | Switchgrass Phyllosphere | EAKAQIYSVNEDLPANQVSRMQGVLDQLERTHIKEKRMAKSSMEK |
| Ga0182195_10836531 | 3300017414 | Switchgrass Phyllosphere | SVNKNLPANQVAQMXYVLDRLKRAREKKKDGEVADKKVNCE |
| Ga0182213_12131751 | 3300017421 | Switchgrass Phyllosphere | RPEAKAQIYSVNKNLPANQVARMXDILDHLERTRRKKKDGEAADGKINYK |
| Ga0182201_10373271 | 3300017422 | Switchgrass Phyllosphere | MHPEAKVQIYSVNEKLPADQVARMXCVLDQLERTRRKEKKSGEVAEK |
| Ga0182201_10976421 | 3300017422 | Switchgrass Phyllosphere | MRPEVKAQIYSVNEYLPADQVARMXCILDQLERTRRK |
| Ga0182196_11001291 | 3300017432 | Switchgrass Phyllosphere | MRPETKAQIYSVNENLPANQVALMXGVLDQLERTRGKEKDGDATDGKVNCEKSKVLLV |
| Ga0182196_11489581 | 3300017432 | Switchgrass Phyllosphere | LDNFXIDLNEATAMRLEAKAQIYSVNENLPADQVARMXCVLDQLERTHRKEKKSGEVAER |
| Ga0182194_10466792 | 3300017435 | Switchgrass Phyllosphere | EATAMRPEAKAQIYSVNESLPANQVARMXDILDLLERAHEKKKDGEIADKKVNCE |
| Ga0182194_10589941 | 3300017435 | Switchgrass Phyllosphere | MRPGAKAQIYLVNKNLPADQVARTXGILDQLERTRRKEKKSGEVVEK |
| Ga0182200_10890211 | 3300017439 | Switchgrass Phyllosphere | MRPEAKAQIYSVNKNLPVNQVARMXDVLDQLEIARGKKKDGE |
| Ga0182214_11472181 | 3300017440 | Switchgrass Phyllosphere | MRPVAKAQIYSVNENLLADQVTRMXGVLDQLERTRRKEKKSG |
| Ga0182198_10204592 | 3300017445 | Switchgrass Phyllosphere | MRPEAKAKIYSVNENLLVDQVARMXGILDQLERTRR |
| Ga0182198_11239921 | 3300017445 | Switchgrass Phyllosphere | MRPKAKAQIYSVNEDLLANQVARMXGVLDQLERTRRKKKKDSEVADEKVNCK |
| Ga0182198_11330051 | 3300017445 | Switchgrass Phyllosphere | MRPEAKAQIYSVNENLPADQVARMXGILDQLERTRRKEKKSGEVAEK |
| Ga0182215_11587541 | 3300017447 | Switchgrass Phyllosphere | MRPEAKAQIYSVNENLPADQVARMXGVLDQLERTRR |
| Ga0182216_10481601 | 3300017693 | Switchgrass Phyllosphere | MRPEAKAQIYSVNENLLVDHVARMXGVLDQLERARRKEKKSDEVAEK |
| Ga0182216_10485291 | 3300017693 | Switchgrass Phyllosphere | MRPDAKAQIYSINENLLADQVARMXGILDQLERTRRKEKKSGEVAEK |
| Ga0182216_11698992 | 3300017693 | Switchgrass Phyllosphere | MRPEAKAHIYSVDENLPADQVARMXGILDQLERTRRKEKKSGEVAEK |
| Ga0182216_11965111 | 3300017693 | Switchgrass Phyllosphere | MRPKAKAEIYSVNENLPANQVARMXDVLDQLERTRRKKKDG |
| Ga0182216_12126591 | 3300017693 | Switchgrass Phyllosphere | FDNFXIDLNKSTAMRPEAKAQIYSVNENLPADQVARMXGVLDQLERTRRKEKKSGEVAEK |
| Ga0182211_11698511 | 3300017694 | Switchgrass Phyllosphere | MRPEAKAQIYLVNEDLPANQVGRMQGVLDQLERTHIKEKRM |
| Ga0207641_120992281 | 3300026088 | Switchgrass Rhizosphere | DLNEATAMRPEGKAQIYSVNENLPANQVARMXDILDQLERTRRKKKDGDVADEKVNCK |
| Ga0268344_10045632 | 3300028051 | Phyllosphere | NEATAMCLEAKAQIYSVNENLPADQVARMXCVLDQLERTRRKEKKSGEVAEK |
| Ga0268344_10142591 | 3300028051 | Phyllosphere | MRPEAKAHIYSVNVNLPAGQVTRMXGVLDQLERTRRKKKMAKS |
| Ga0268306_10253222 | 3300028054 | Phyllosphere | MHPEAKAHIYSVNEDLLENQVARMXGVLDHLERTREKEKDGEVADXKVNCK |
| Ga0268330_10574611 | 3300028056 | Phyllosphere | KAQIYSVNENLPADQVARMXGVLDQLERTRRKEKKSGEVVEK |
| Ga0268332_10341201 | 3300028058 | Phyllosphere | MCPEAKAQIYSVNENLPADQVARMXGILDQLERTRRKEKKSGEVAEK |
| Ga0268332_10574321 | 3300028058 | Phyllosphere | MCPEAKAQIYSVNEDLPANQVAQMXGVLDQLERTRRKKKKG |
| Ga0268342_10368701 | 3300028062 | Phyllosphere | MRLEGKAQIYSVNEDLPANQVARIXGILNQLERNREKE |
| Ga0268340_10256751 | 3300028064 | Phyllosphere | MRPEAKAQIYSVNENLLADQVARMXGVLDQLERTR |
| Ga0268334_10050881 | 3300028140 | Phyllosphere | MRPEAKAQIYSADENLPVDHVARMXGILDQLERTHRK |
| Ga0268326_10023031 | 3300028141 | Phyllosphere | DLNEATAMRPKAKSQIYSVNENLPVDQVARMGCVLDQLERTRRKKSGEVVEK |
| Ga0268347_10243671 | 3300028142 | Phyllosphere | MRPEVKAQIYSINEDLPANQVAQMXGVLDQLERTRGKEKDGEVA |
| Ga0268345_10194631 | 3300028144 | Phyllosphere | AMRPEVKSQIYSVNENLPADQVARMXGVLDQLERTRRKEKKSGEVAEK |
| Ga0268308_10095572 | 3300028151 | Phyllosphere | EATAMRPEAKAQIYSVNENLPADQVARMXCVLDQLERTRRKEKKSGEVAEK |
| Ga0268312_10075722 | 3300028248 | Phyllosphere | MHPEAKAQIYSVNEDLPANQFARMXDVLDQLEKTHEKEKDGDAADEEVNCK |
| Ga0268312_10195812 | 3300028248 | Phyllosphere | MRPEAKAQIYLVNENLLADQLARMXGVLDQLEKTRRKEKKSGEVAEK |
| Ga0268324_10080311 | 3300028251 | Phyllosphere | EATAMRPEAKAQIYSVNENLPADQVARMXDVLDQLERARRKEKKSGEVAEK |
| Ga0268307_10227771 | 3300028470 | Phyllosphere | MRPEVKVQIYSVNENLPADQVARMXGVLDQLERTRRKEKKSG |
| Ga0268323_10166331 | 3300028471 | Phyllosphere | MRLEAKAQIYSVNENLPANQVARMXGVLDRLERTRRKKKMAKPP |
| Ga0268313_10140521 | 3300028523 | Phyllosphere | MRPKAKSQIYSVNEDLPENQVAXMXGILDQLERTRGKEKKDGEVADE |
| Ga0268311_10109431 | 3300028529 | Phyllosphere | EAKAQIYSVNENLPVDQVARMXCVIDQLERTRRKEKKSGEVAEK |
| Ga0268311_10174141 | 3300028529 | Phyllosphere | MRPETKAQIYSVNENLPANQVALMXGVLDQLERTRGKEKDGDATDG |
| Ga0214500_12100671 | 3300032589 | Switchgrass Phyllosphere | PEAKAQIYSVNKNLPADQVARMXGVLDQLERTRRKEKKSGEVAEK |
| Ga0314731_10852801 | 3300032790 | Switchgrass Phyllosphere | XIDLNEATAMRPEAKAQIYSVNENSPANQVARMXGVLDQLERTRRKRKKGGEVADKKVNY |
| Ga0314736_10442172 | 3300032843 | Switchgrass Phyllosphere | MRPEAKAQIYSVNENLPANQVAXMXGVLDQLERTRGKEKDGEAA |
| ⦗Top⦘ |