 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F055343 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VPLFQRDRELPILDPVACVIAFKLHGEGIRGSQALSIALQG |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 57.97 % |
| % of genes near scaffold ends (potentially truncated) | 97.10 % |
| % of genes from short scaffolds (< 2000 bps) | 100.00 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (62.319 % of family members) |
| Environment Ontology (ENVO) | Unclassified (90.580 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (88.406 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.43% β-sheet: 0.00% Coil/Unstructured: 69.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 62.32% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 26.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.07% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 2.17% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
| 3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
| 3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028057 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028139 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028140 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028464 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028466 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028471 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028474 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032468 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032823 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032845 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070666_112815381 | 3300005335 | Switchgrass Rhizosphere | YSAPLFQRDRELPILDPVACVIAFKLHGEGIRESQVLSIALPG* |
| Ga0070671_1017523382 | 3300005355 | Switchgrass Rhizosphere | VPLFQLYRELPILDPVA*VIAFKLHGEGIRGSQALSIALQG |
| Ga0068864_1010096281 | 3300005618 | Switchgrass Rhizosphere | VPLFQQERELPILDPVACVIAFKLHGEGIRGSQVLSIALP |
| Ga0068858_1012329222 | 3300005842 | Switchgrass Rhizosphere | MPLLQRDRELPILELVA*VIAFKLHGEGIRGSKALSITLQG*APVE |
| Ga0068858_1018857001 | 3300005842 | Switchgrass Rhizosphere | VLLFQRDQELPIMDPVA*VIAFKLHGEGIRGSQAL |
| Ga0068858_1020647782 | 3300005842 | Switchgrass Rhizosphere | VPLFQWDRELPILDPVALVIAFKLHGDGIRGSQALSITLQGR |
| Ga0068860_1010855521 | 3300005843 | Switchgrass Rhizosphere | FVPQFQRDRELPILDPVACVIAFKLHGEGIRGSQALSIAL* |
| Ga0068860_1019711571 | 3300005843 | Switchgrass Rhizosphere | MPLFQRDRELPILDPVACVIAFKLHGEGIRGSQVLSI |
| Ga0105135_1292591 | 3300009980 | Switchgrass Associated | VPLFQRDRELPILDPVALVTAFKLHGEGIRGSQALSIALQG |
| Ga0105131_1322602 | 3300009989 | Switchgrass Associated | MPLFQRVRELPIFDPVA*VIAFKLHGEGIRGSQALSIALQG* |
| Ga0105132_1356701 | 3300009990 | Switchgrass Associated | MPLLQRDRELPILDPVA*VIAFKPHGEGIRGSQALSIALQG*APDE |
| Ga0134125_116496931 | 3300010371 | Terrestrial Soil | VPLFQRDRELPILDPVA*VIAFKLHGEGIQGSQALSIALQG* |
| Ga0134121_113235301 | 3300010401 | Terrestrial Soil | FQRDRELLILDPVA*VIAFKLNGEGIRGSQALSIAL* |
| Ga0163162_114818111 | 3300013306 | Switchgrass Rhizosphere | QFQRGRELPTLDPVACIIAFKLHWEGIRGSLAMSIALQG* |
| Ga0157379_124525151 | 3300014968 | Switchgrass Rhizosphere | MPLFQWDRELPILDPVA*VIAFKLHGEGIRGSQALSIAL |
| Ga0182102_10376931 | 3300015273 | Switchgrass Phyllosphere | VPLFQQDRERPILDHVACVLVFKLHGEGFRGSQALSIALQGCAPDESL |
| Ga0182099_10509301 | 3300015278 | Switchgrass Phyllosphere | MPLFQRDRELPIFDPVASVIAFKLHGGGIWGSQALYIALQG* |
| Ga0182100_10756561 | 3300015280 | Switchgrass Phyllosphere | DRELPIFYPVALIIAFKLHGEGIRGSQALSIALQG* |
| Ga0182101_10490341 | 3300015284 | Switchgrass Phyllosphere | MPLFQRDRELPILDPVACVIAFKLHGEGIRGSQVLSIALPG*APDEYFL |
| Ga0182101_10978821 | 3300015284 | Switchgrass Phyllosphere | MPLFQRD*ELPILNPVA*VIAFRLHGEGIRGSQALSIALQG |
| Ga0182105_10666841 | 3300015290 | Switchgrass Phyllosphere | VPLFQWDRELPILDPVE*VMAFKQHMEGIRVSQALSIAQ* |
| Ga0182103_10878771 | 3300015293 | Switchgrass Phyllosphere | MPLFQQDRELLILDIVA*VIAFKLHGEGIRGALALSIALQGYAPDES |
| Ga0182184_10874231 | 3300015301 | Switchgrass Phyllosphere | VPLFQRDRELPILDPVARVIAFKLHGKGIRGSQDLSITLK |
| Ga0182098_10991971 | 3300015309 | Switchgrass Phyllosphere | MPLFQLVRELPILDPVA*FIAFKLHGQGIRGSQALSIGLQG* |
| Ga0182162_10601921 | 3300015310 | Switchgrass Phyllosphere | VPLFQRDRELPILDPVELVIAFKLHGESIRGSQALSIALQG* |
| Ga0182168_11196261 | 3300015312 | Switchgrass Phyllosphere | MHLFQRDRELPILNHVA*VIAFNLHGEGIRGSQALSIAL |
| Ga0182168_11202151 | 3300015312 | Switchgrass Phyllosphere | LFQRD*ELPILDPVA*VIAFKLHTEGIRGSQALSITQ* |
| Ga0182164_11000391 | 3300015313 | Switchgrass Phyllosphere | VTQFQRDRELPILDPVA*VIAFKLHGEGIRASQALSMALQG*APDE |
| Ga0182164_11332071 | 3300015313 | Switchgrass Phyllosphere | MYSVPLFQWDRELPILDPVA*VIAIKLHGEGIRGAQA |
| Ga0182120_10148401 | 3300015315 | Switchgrass Phyllosphere | VPLFQRDRQLPILDPVA*VIAFKLHGEGIRGSQALSIALQG* |
| Ga0182120_11291541 | 3300015315 | Switchgrass Phyllosphere | ELQILDPVA*VIAFKLHGEGIRGSQALSIILQG*APD* |
| Ga0182121_10440491 | 3300015316 | Switchgrass Phyllosphere | VPLFQRDRELPILDPVACVIAFKLHGEGIRGSQALSIALQG* |
| Ga0182136_11062731 | 3300015317 | Switchgrass Phyllosphere | VPPFQQGRERSILDPVA*VIAFKLHEEGIRGSQALSI |
| Ga0182181_10719951 | 3300015318 | Switchgrass Phyllosphere | PLFQQDRELPILDPVACVIAFKLHGKGIRGSQVLSIALPG* |
| Ga0182181_10744961 | 3300015318 | Switchgrass Phyllosphere | MPLFQQDQELPILDPVA*VIAFKLHGEGIRGSQAL |
| Ga0182181_10778841 | 3300015318 | Switchgrass Phyllosphere | FQRDRELPILDPVAGVISFKLNGEGIRGPQALSIALQG* |
| Ga0182130_10360451 | 3300015319 | Switchgrass Phyllosphere | RELPILDPVACVIAFKLHGEGIRGSQVMSITLPG* |
| Ga0182130_10897121 | 3300015319 | Switchgrass Phyllosphere | VPLFQQDQELPILDPVA*VIAFKLHAEGIRGSQALSIAL |
| Ga0182165_10619731 | 3300015320 | Switchgrass Phyllosphere | LLQRDRELPILEPVA*VIAFKLHGEGIRGSQALSIALQG*AQD* |
| Ga0182165_10840971 | 3300015320 | Switchgrass Phyllosphere | VPLFQRDRALPILDPVACVIAFKLHGEGTRGSQALS |
| Ga0182165_10857751 | 3300015320 | Switchgrass Phyllosphere | RDRELPILDPIACVIAFKLHGEGIRGSQVLSIAL* |
| Ga0182165_10995402 | 3300015320 | Switchgrass Phyllosphere | MPIFQWDRELLILDPVACVIAFKLHGEGIRGSQALSIAL |
| Ga0182165_11458621 | 3300015320 | Switchgrass Phyllosphere | VPLVQRDRELPILGPVARVLAFELHGEGIRGSQALSIALQG* |
| Ga0182134_10784991 | 3300015324 | Switchgrass Phyllosphere | LFQRDRELPILDPVACVIAIKLHEEGIRGSQVLSIALLG* |
| Ga0182148_10992251 | 3300015325 | Switchgrass Phyllosphere | MPLFQRDRELPILDPVACVIAFKLHGEGIRGSQVLSIALPG |
| Ga0182148_11002661 | 3300015325 | Switchgrass Phyllosphere | VPLLQRDRELPILEPVA*AIAFKLHGQGIRGPKALSITLQG*APDESL |
| Ga0182148_11134961 | 3300015325 | Switchgrass Phyllosphere | MPLFQWDRELLILDPVA*VIAFKLHGEGIRGSQALSIAL |
| Ga0182166_11334011 | 3300015326 | Switchgrass Phyllosphere | VPLLQRDQELPILEPVA*VIAFKLHGEGIRGYKALSIT |
| Ga0182114_10870301 | 3300015327 | Switchgrass Phyllosphere | SVLVFQRDRELPILDPVARVIAFKLHGKGIRGSQDLSITLKG* |
| Ga0182135_10917411 | 3300015329 | Switchgrass Phyllosphere | SILPLFQRDRVLSILDLVARVIAFKLHVEGIRGSQALSIAL* |
| Ga0182152_11231551 | 3300015330 | Switchgrass Phyllosphere | VPLFQQDRELQILDPVARVIAFKLHGEGIRGSQALSIAL |
| Ga0182117_10952851 | 3300015332 | Switchgrass Phyllosphere | MGKYSMPLSQRDRELPILDPIA*VIAFKLHGEGIRGSQ |
| Ga0182117_11352691 | 3300015332 | Switchgrass Phyllosphere | QWDRELPILDPVA*VIAFKLHREGIRGSQALSIAL* |
| Ga0182150_10674191 | 3300015336 | Switchgrass Phyllosphere | QRDRELQILDPVA*VIAFKLHGEGIRGSQALSIILLG*ALD* |
| Ga0182150_10870511 | 3300015336 | Switchgrass Phyllosphere | VPLFQRDRELPILDPVACVIAFKLHGEGIRGSQALSIAL |
| Ga0182137_10676341 | 3300015338 | Switchgrass Phyllosphere | QWDRELPILDPIA*VIAIKLHGEGIRGSQALSIALQG* |
| Ga0182133_11773822 | 3300015340 | Switchgrass Phyllosphere | SVPLFQRDRELPILDPVA*VIAFKLHGEGIPDSQAQSIAL* |
| Ga0182115_11948391 | 3300015348 | Switchgrass Phyllosphere | VPLLQQDRELPILEPVA*VIAFKLHGEGIQGSKALSITLQG |
| Ga0182115_12427391 | 3300015348 | Switchgrass Phyllosphere | MPLFQRDQELPILDPVA*VIAFKLHEEGIRGSQAL |
| Ga0182115_12665821 | 3300015348 | Switchgrass Phyllosphere | MPLFERDRELPILDPVAIVIAFKLHGEGIRGSQALSITLQG*APDE |
| Ga0182185_12620182 | 3300015349 | Switchgrass Phyllosphere | MPLFQRDRERPILDPVAQVMAFKLHREGIRGSQAMSIALQG* |
| Ga0182185_12797881 | 3300015349 | Switchgrass Phyllosphere | PLFQRDRELPILDPVAQVIAFKLHAEGIRGSQALSIALQG* |
| Ga0182185_12840871 | 3300015349 | Switchgrass Phyllosphere | PLFQRDRELPILDPVACVIAFKLHGEGIRGSQALSIALQG* |
| Ga0182163_11626531 | 3300015350 | Switchgrass Phyllosphere | PLFQRDRELPILDPVA*VIAFKLHGEGIRGSQAMSITL* |
| Ga0182163_12455671 | 3300015350 | Switchgrass Phyllosphere | MPLFQRD*QLPILDPVA*VIAFKLHGEGIRGSHALSIALQG*AP |
| Ga0182169_11238401 | 3300015352 | Switchgrass Phyllosphere | MPLLQRDRELPILDPVACIIAFKLHGEGIRGSQVLSIALQG |
| Ga0182169_11238402 | 3300015352 | Switchgrass Phyllosphere | FQRDRELPILDPVACVIAFKLHGEGIRGSQVLSIALPG* |
| Ga0182169_11976861 | 3300015352 | Switchgrass Phyllosphere | MPLFERDRELPILDPVALVIAFKLHGEGIRGSQALSIALQG |
| Ga0182169_12059721 | 3300015352 | Switchgrass Phyllosphere | VPLFQQDRERQILDPVARVIAFKLHGEGIRGSQALSIALQG* |
| Ga0182169_12456621 | 3300015352 | Switchgrass Phyllosphere | VPLFQRNRELPVLDPVASVIAFKQYGEGIRGSQDLSITL |
| Ga0182179_10682452 | 3300015353 | Switchgrass Phyllosphere | QRDRELPISDPVA*DISFKLHGEGIRGSQALSIALQG*APDESF* |
| Ga0182179_11692091 | 3300015353 | Switchgrass Phyllosphere | QDRELPILDPVA*VIAFKLHGEGIRGSQALSIAL* |
| Ga0182179_12051211 | 3300015353 | Switchgrass Phyllosphere | MPLFQRDQELPILDPVA*VIAFKLHGEGIRGSQAL |
| Ga0182179_12115482 | 3300015353 | Switchgrass Phyllosphere | SVPLFQWDRELPILDPVARVISFKLHGEGIRGSQALSIALQG* |
| Ga0182167_13051681 | 3300015354 | Switchgrass Phyllosphere | QQDRELPILDAVA*VIAFKLHVEGIRGSQALSIAL* |
| Ga0182167_13082111 | 3300015354 | Switchgrass Phyllosphere | QWDRELPILDPVA*VIAFKLHGEGIRGYQALSIAL* |
| Ga0182197_10797051 | 3300017408 | Switchgrass Phyllosphere | VPLFQRDRELPILDHVAYVIALKLHGEGIRGSQAMSITLQGXVIDEPFL |
| Ga0182197_11208761 | 3300017408 | Switchgrass Phyllosphere | FEQDRELPILDPVALVIAFKLHGEGIRGSQALSIALQG |
| Ga0182201_10863451 | 3300017422 | Switchgrass Phyllosphere | VPLFQRDRELPIFDPVAKVIAFKLHREGIRGSQALSIILQGRVPD |
| Ga0182196_11302321 | 3300017432 | Switchgrass Phyllosphere | VPPFQRDRECPILDPVAXVMVFKLHGEGIRGSEALSIAL |
| Ga0182194_11430171 | 3300017435 | Switchgrass Phyllosphere | MPLFQWDRELPILDPVAXVIVFEMHGEGIRGSQALSIA |
| Ga0182200_10643811 | 3300017439 | Switchgrass Phyllosphere | MPLFQRDRELPILDPVAXVIAFKLNGEGIPGSQALS |
| Ga0182200_10820601 | 3300017439 | Switchgrass Phyllosphere | MPLFQHDRELPVLDPVAXVIAFKLHGEGIRGSQAL |
| Ga0182214_10928181 | 3300017440 | Switchgrass Phyllosphere | VPLFERDRELPILDPVAXVIAYKMHGEGIRGSQALSIALQ |
| Ga0182214_11023081 | 3300017440 | Switchgrass Phyllosphere | FQRDRELPILDPVACVIAFKLHGEGIRGSQALSIALQG |
| Ga0182214_11117751 | 3300017440 | Switchgrass Phyllosphere | MLLFQRDRELPILDPVAXVIAFKLHGEGIRGSQALS |
| Ga0182214_11221151 | 3300017440 | Switchgrass Phyllosphere | MPLFQRDRELPILDPVAXVIAFKLHGEGIRGSQALSIAQQGLG |
| Ga0182198_10945081 | 3300017445 | Switchgrass Phyllosphere | MPPFQQDRERPILDPVVWVIAFKLHREGTRGFQALSIALY |
| Ga0182198_11273511 | 3300017445 | Switchgrass Phyllosphere | PLFQQDRELPILDHVAXVIAFKLHMEGIRGSQALSIAL |
| Ga0182216_10815151 | 3300017693 | Switchgrass Phyllosphere | LFQQNXEFLILDPVAXVIAFKLHGEGIRGSQALSIAL |
| Ga0182216_11364641 | 3300017693 | Switchgrass Phyllosphere | VPIFQRDRDPPILDPVAXVTAFKLHMEGIRRTQALSIALQGXAPDESY |
| Ga0182216_11417882 | 3300017693 | Switchgrass Phyllosphere | MQLFQRDRELPILDPVAXVIAFKLHGEGIWGSQALSIALQGXAPD |
| Ga0182216_11641321 | 3300017693 | Switchgrass Phyllosphere | VPLFQQDXELPILDPVACVIAFELHGEGIRGSQALSIALKGXALDESF |
| Ga0182216_11760201 | 3300017693 | Switchgrass Phyllosphere | VPLFKWDLELPILDPVAXVAFKLHGEGIRGSQALSI |
| Ga0182216_12154101 | 3300017693 | Switchgrass Phyllosphere | VPLFQRDRELPILDPVAXVIAFKLHGEGIQGSQALSIAL |
| Ga0182211_11008241 | 3300017694 | Switchgrass Phyllosphere | MPLFQRDRELLILDPVAXVIAFKLHGQGIRGSQALSIAL |
| Ga0182178_10080761 | 3300020023 | Switchgrass Phyllosphere | VPLFQRDQELPILDPVACVMAFKLHGEGIRGSQVLSIALP |
| Ga0182178_10146431 | 3300020023 | Switchgrass Phyllosphere | LFQWDRELPILDPVAXVIAFKLHREGIRGSQALSIAL |
| Ga0207703_121351621 | 3300026035 | Switchgrass Rhizosphere | MPLFQQDRELPILDPVAXVIAFKLHRKGIRGSQAL |
| Ga0268328_10332121 | 3300028050 | Phyllosphere | VPLLQQDRELPILEPVAXVIAFKLHGEGIRGSKALSITLQGXAIVESF |
| Ga0268328_10333611 | 3300028050 | Phyllosphere | SVPLFQQDQELPILDPIACVIAFKLHGEGIRGSQVLSIALLG |
| Ga0268328_10440041 | 3300028050 | Phyllosphere | MPLFQRGRELPILDPVAXVIAFKLHGEGIRGSQALSIAL |
| Ga0268328_10522631 | 3300028050 | Phyllosphere | VTLFQQDRELPILDPVAXVIAFKLHGEGIRGSQALSIAL |
| Ga0268328_10537821 | 3300028050 | Phyllosphere | VPLFQRDRELPILDPIARVIAFKLHGEGIRGSQALS |
| Ga0268330_10165671 | 3300028056 | Phyllosphere | VPLFQRDGELPILDPVACVIAFKLHGEGIRGSQALSIALQ |
| Ga0268330_10173661 | 3300028056 | Phyllosphere | RDRELPILDPVACVIGFKLHGEGIRGSQALSIALQG |
| Ga0268330_10205921 | 3300028056 | Phyllosphere | PILIWDXELPILDPVAXVIAFKLHEEGIRGSQALSIAL |
| Ga0268330_10482161 | 3300028056 | Phyllosphere | VPLFQRDRELPILDPVAXVIAFKLHGEGIRGSQALSIALQGXA |
| Ga0268352_10418041 | 3300028057 | Phyllosphere | MPLLQQDRELPILDPVAXVIAFKLQGEGIRASQALSIILQG |
| Ga0268332_10053061 | 3300028058 | Phyllosphere | VPLFQQDQELPILDPVAXVIAFKLHGEGIRGSQAL |
| Ga0268332_10239091 | 3300028058 | Phyllosphere | MPLFQQDRELPILDPEARVIAIKLHGEGIRGSQALSIALQG |
| Ga0268332_10466841 | 3300028058 | Phyllosphere | LQRDRELPILDPVAXVIAFKLHGEGIRGSKVLSITL |
| Ga0268332_10566071 | 3300028058 | Phyllosphere | MPLFQQDRELPILDPVACVIAFKLHGEGIRGSQVLSIALPG |
| Ga0268314_10434161 | 3300028061 | Phyllosphere | MTKELPVLDPVAXVIAFKLHGEGIRRSQALSIALQGXALDDSFL |
| Ga0268340_10554941 | 3300028064 | Phyllosphere | VPLFQPDRELPILDPAACVIAFKLHGEGIRGSQALSIVQQ |
| Ga0268340_10631161 | 3300028064 | Phyllosphere | VPLFQQDRELPILDPVAXVAFKLHGERIRGSQALSIA |
| Ga0268355_10186341 | 3300028139 | Phyllosphere | VPLLQQDRELPILEPVAXVIAFKLHGEGIQGSKALSITLQGXAPVESSIY |
| Ga0268334_10142051 | 3300028140 | Phyllosphere | VPLLQQDRELPILEPVAXVIAFKLHGEGIRGSKALSITLQGC |
| Ga0268348_10030441 | 3300028143 | Phyllosphere | VPLFQRDQELPILDPVACVIAFKLHGEGIRGSQVLSIAL |
| Ga0268348_10183871 | 3300028143 | Phyllosphere | VPQFQRDRELPILDPVACVIAFKLHGEGIRGSQALSIALQ |
| Ga0268308_10254861 | 3300028151 | Phyllosphere | DRELPILDPVAXVIAFKLHGEDIRGYQALSIALQG |
| Ga0268336_10170331 | 3300028152 | Phyllosphere | MPLFQRDRELPILDPVACVIAFKLHGEGIRGSQVLS |
| Ga0268320_10175241 | 3300028153 | Phyllosphere | VPLFKRDRELPILDPVAXVIAFKLHGEGIRGSQAQSIALQG |
| Ga0268341_10154671 | 3300028154 | Phyllosphere | RELPILDPVAXVIAFKMHGEGIRGAQALSIALQGXA |
| Ga0268341_10264561 | 3300028154 | Phyllosphere | VPLLQRDRELPILEPVAXVIAFKLHGEGIQGSKALSITLQGXAPDES |
| Ga0268310_10062161 | 3300028262 | Phyllosphere | MPLFQQDRELPILDPMARVIAFKLHGEGIRGYQTLSIALQG |
| Ga0268310_10107171 | 3300028262 | Phyllosphere | MPLFERDRELPILDPVAIVIAFKRHGEGIRGSQALSITLQ |
| Ga0268310_10125932 | 3300028262 | Phyllosphere | PLFQRDRELAVLDPVAXVIAFKLNGEGIQGSQALSIALQGXAPD |
| Ga0268302_1047461 | 3300028464 | Phyllosphere | VFQRDRELPILDPVARVIAFKLHGKGIRGSQALSIVLQG |
| Ga0268321_1085441 | 3300028466 | Phyllosphere | VPLFQQDRELPILDPVAXVIAFKLHGEGIRGSQALSIAL |
| Ga0268323_10156941 | 3300028471 | Phyllosphere | VPQFQWDRELPILDPVACVIAFKLHGEGIRGSQALSIA |
| Ga0268315_10188361 | 3300028472 | Phyllosphere | QNRELPVLDPVAXVIAFRLHGEDIRGSQALSITLQG |
| Ga0268319_10170841 | 3300028473 | Phyllosphere | VPLFQRDRELPIFYPVALIIAFKLHGEGIRGSQALSIALQG |
| Ga0268331_10149562 | 3300028474 | Phyllosphere | QRDRELPILDPVACVIAFKLHGEGIRGSQALSIALQG |
| Ga0268311_10245331 | 3300028529 | Phyllosphere | VLLFQQDRELPILDPVEXVIAYKLHKEGIRGSQALSI |
| Ga0214482_10598311 | 3300032468 | Switchgrass Phyllosphere | VPLFQRDRELPILDLVAWVIAFKLHGEGIRGSQALSIALQG |
| Ga0314723_10291511 | 3300032823 | Switchgrass Phyllosphere | VPLFQWDQELPILDPVAXVIAFKLHGEGIRGFQALSIALQGXAPDE |
| Ga0314727_10570231 | 3300032845 | Switchgrass Phyllosphere | DRELPILDPVAGVIAFKLHAEGILGSQALSIALHG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |