NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055290

Metagenome / Metatranscriptome Family F055290

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055290
Family Type Metagenome / Metatranscriptome
Number of Sequences 139
Average Sequence Length 106 residues
Representative Sequence MEKIIAATFDIADQKCKMYNALEWHNFIADTREECPNAPAGLEELFDYAYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDAECEAVMEMAADAGDEEEIFWAE
Number of Associated Samples 93
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 76.81 %
% of genes near scaffold ends (potentially truncated) 30.94 %
% of genes from short scaffolds (< 2000 bps) 72.66 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.80

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.856 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater
(24.460 % of family members)
Environment Ontology (ENVO) Unclassified
(44.604 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(92.086 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.34%    β-sheet: 28.36%    Coil/Unstructured: 40.30%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.80
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
d.280.1.1: Sulfolobus fructose-1,6-bisphosphatase-liked3t2ca_3t2c0.5545
b.176.1.1: AttH-liked2icha12ich0.51811
c.1.10.0: automated matchesd5c54a_5c540.50748


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF16778Phage_tail_APC 1.44
PF06305LapA_dom 0.72
PF03796DnaB_C 0.72
PF00011HSP20 0.72
PF03237Terminase_6N 0.72
PF02229PC4 0.72
PF01050MannoseP_isomer 0.72
PF03031NIF 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.72
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 0.72
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 0.72
COG3771Lipopolysaccharide assembly protein YciS/LapA, DUF1049 familyCell wall/membrane/envelope biogenesis [M] 0.72
COG5190TFIIF-interacting CTD phosphatase, includes NLI-interacting factorTranscription [K] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.93 %
UnclassifiedrootN/A10.07 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000947|BBAY92_10147148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium619Open in IMG/M
3300000949|BBAY94_10078104All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium912Open in IMG/M
3300000949|BBAY94_10103086All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium781Open in IMG/M
3300001419|JGI11705J14877_10013917All Organisms → cellular organisms → Bacteria3384Open in IMG/M
3300004097|Ga0055584_100590401All Organisms → Viruses → Predicted Viral1159Open in IMG/M
3300004097|Ga0055584_101920492All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium608Open in IMG/M
3300005433|Ga0066830_10020818All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1288Open in IMG/M
3300005510|Ga0066825_10293972All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium598Open in IMG/M
3300005512|Ga0074648_1001905All Organisms → cellular organisms → Bacteria20059Open in IMG/M
3300006402|Ga0075511_1813437All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium538Open in IMG/M
3300006402|Ga0075511_1824117All Organisms → Viruses → Predicted Viral1605Open in IMG/M
3300006403|Ga0075514_1018104All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium613Open in IMG/M
3300006404|Ga0075515_10051358Not Available2272Open in IMG/M
3300006752|Ga0098048_1020223All Organisms → cellular organisms → Bacteria2237Open in IMG/M
3300006752|Ga0098048_1086728All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium953Open in IMG/M
3300006793|Ga0098055_1016684All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3187Open in IMG/M
3300006802|Ga0070749_10110295All Organisms → Viruses → Predicted Viral1622Open in IMG/M
3300006810|Ga0070754_10259658All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium791Open in IMG/M
3300006868|Ga0075481_10126623All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium938Open in IMG/M
3300006868|Ga0075481_10270117All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium597Open in IMG/M
3300006916|Ga0070750_10031619All Organisms → cellular organisms → Bacteria2627Open in IMG/M
3300006919|Ga0070746_10437101All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium582Open in IMG/M
3300006924|Ga0098051_1130155All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium669Open in IMG/M
3300006990|Ga0098046_1062570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Phormidesmis854Open in IMG/M
3300007345|Ga0070752_1119313All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1111Open in IMG/M
3300007345|Ga0070752_1150669All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium956Open in IMG/M
3300007539|Ga0099849_1279571All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium607Open in IMG/M
3300007539|Ga0099849_1315577All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium561Open in IMG/M
3300008012|Ga0075480_10036773All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2933Open in IMG/M
3300008012|Ga0075480_10121664Not Available1443Open in IMG/M
3300008012|Ga0075480_10144416All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1297Open in IMG/M
3300010149|Ga0098049_1060902All Organisms → Viruses → Predicted Viral1198Open in IMG/M
3300010150|Ga0098056_1011044All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3309Open in IMG/M
3300010296|Ga0129348_1155667All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium789Open in IMG/M
3300010296|Ga0129348_1182623All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium718Open in IMG/M
3300010296|Ga0129348_1261914All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium580Open in IMG/M
3300011254|Ga0151675_1213223All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium887Open in IMG/M
3300011258|Ga0151677_1059307Not Available1456Open in IMG/M
3300012936|Ga0163109_10022680All Organisms → cellular organisms → Bacteria4637Open in IMG/M
3300016776|Ga0182046_1457689All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium699Open in IMG/M
3300017710|Ga0181403_1003162All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3698Open in IMG/M
3300017719|Ga0181390_1074592All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium948Open in IMG/M
3300017726|Ga0181381_1047953All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium940Open in IMG/M
3300017734|Ga0187222_1093715All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium681Open in IMG/M
3300017739|Ga0181433_1010572All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2547Open in IMG/M
3300017741|Ga0181421_1043878All Organisms → Viruses → Predicted Viral1195Open in IMG/M
3300017743|Ga0181402_1046365All Organisms → Viruses → Predicted Viral1180Open in IMG/M
3300017750|Ga0181405_1139495All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium602Open in IMG/M
3300017752|Ga0181400_1032118All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1687Open in IMG/M
3300017756|Ga0181382_1040579All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1373Open in IMG/M
3300017762|Ga0181422_1179065All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium645Open in IMG/M
3300017770|Ga0187217_1142916All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium803Open in IMG/M
3300017781|Ga0181423_1323059All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium565Open in IMG/M
3300017782|Ga0181380_1034871All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1834Open in IMG/M
3300017783|Ga0181379_1084444All Organisms → Viruses → Predicted Viral1176Open in IMG/M
3300017824|Ga0181552_10347559All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium720Open in IMG/M
3300017824|Ga0181552_10575967All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium525Open in IMG/M
3300017951|Ga0181577_10040053Not Available3368Open in IMG/M
3300017951|Ga0181577_10043931All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3199Open in IMG/M
3300017951|Ga0181577_10300123All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1043Open in IMG/M
3300017951|Ga0181577_10312180All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1018Open in IMG/M
3300017951|Ga0181577_10646058All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium648Open in IMG/M
3300017967|Ga0181590_10012074Not Available7011Open in IMG/M
3300018410|Ga0181561_10497796All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium547Open in IMG/M
3300018413|Ga0181560_10074469All Organisms → Viruses → Predicted Viral1900Open in IMG/M
3300018415|Ga0181559_10209723All Organisms → Viruses → Predicted Viral1114Open in IMG/M
3300018415|Ga0181559_10337332All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium835Open in IMG/M
3300018415|Ga0181559_10477334All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium679Open in IMG/M
3300018416|Ga0181553_10021145All Organisms → cellular organisms → Bacteria4807Open in IMG/M
3300018416|Ga0181553_10035519All Organisms → cellular organisms → Bacteria3459Open in IMG/M
3300018416|Ga0181553_10080399All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2060Open in IMG/M
3300018417|Ga0181558_10274904All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium930Open in IMG/M
3300018420|Ga0181563_10015425All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium6162Open in IMG/M
3300018420|Ga0181563_10020657All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5149Open in IMG/M
3300018426|Ga0181566_10677416All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium711Open in IMG/M
3300018428|Ga0181568_10444616All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1039Open in IMG/M
3300018876|Ga0181564_10351813All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium811Open in IMG/M
3300019751|Ga0194029_1019365All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1032Open in IMG/M
3300020055|Ga0181575_10117957All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1626Open in IMG/M
3300020404|Ga0211659_10011295All Organisms → cellular organisms → Bacteria4474Open in IMG/M
3300020440|Ga0211518_10025379Not Available3672Open in IMG/M
3300020440|Ga0211518_10148403All Organisms → Viruses → Predicted Viral1190Open in IMG/M
3300020442|Ga0211559_10023255Not Available3122Open in IMG/M
3300021185|Ga0206682_10426471All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium557Open in IMG/M
3300021335|Ga0213867_1003095All Organisms → cellular organisms → Bacteria7252Open in IMG/M
3300021335|Ga0213867_1004695All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5911Open in IMG/M
3300021335|Ga0213867_1055372All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1504Open in IMG/M
3300021356|Ga0213858_10528831All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium542Open in IMG/M
3300021364|Ga0213859_10000422Not Available19154Open in IMG/M
3300021364|Ga0213859_10238027All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium835Open in IMG/M
3300021364|Ga0213859_10258354All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium795Open in IMG/M
3300021368|Ga0213860_10007319All Organisms → cellular organisms → Bacteria4509Open in IMG/M
3300021368|Ga0213860_10079606All Organisms → Viruses → Predicted Viral1420Open in IMG/M
3300021368|Ga0213860_10463672All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium544Open in IMG/M
3300021373|Ga0213865_10003864All Organisms → cellular organisms → Bacteria9102Open in IMG/M
3300021373|Ga0213865_10004488Not Available8349Open in IMG/M
3300021373|Ga0213865_10005748Not Available7284Open in IMG/M
3300021373|Ga0213865_10063647All Organisms → cellular organisms → Bacteria2021Open in IMG/M
3300021373|Ga0213865_10075779All Organisms → cellular organisms → Bacteria1826Open in IMG/M
3300021373|Ga0213865_10142918All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1233Open in IMG/M
3300021373|Ga0213865_10525424All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium500Open in IMG/M
3300021379|Ga0213864_10037967All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2270Open in IMG/M
3300021379|Ga0213864_10041498All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2177Open in IMG/M
3300021425|Ga0213866_10030870All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3125Open in IMG/M
3300021425|Ga0213866_10112437All Organisms → Viruses → Predicted Viral1474Open in IMG/M
3300021425|Ga0213866_10176902All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1118Open in IMG/M
3300021425|Ga0213866_10181480All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1101Open in IMG/M
3300021425|Ga0213866_10253299All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium896Open in IMG/M
3300021425|Ga0213866_10395411All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium675Open in IMG/M
3300021958|Ga0222718_10017043All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5135Open in IMG/M
3300022074|Ga0224906_1198537All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium548Open in IMG/M
3300022183|Ga0196891_1085971All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium556Open in IMG/M
3300022925|Ga0255773_10386490All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium536Open in IMG/M
3300022929|Ga0255752_10046036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2773Open in IMG/M
3300024228|Ga0228633_1060926All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium931Open in IMG/M
3300024229|Ga0233402_1013783All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1824Open in IMG/M
3300024296|Ga0228629_1001599Not Available5872Open in IMG/M
3300025084|Ga0208298_1014666All Organisms → cellular organisms → Bacteria1837Open in IMG/M
3300025151|Ga0209645_1066301All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1228Open in IMG/M
3300025653|Ga0208428_1000504Not Available17731Open in IMG/M
3300025653|Ga0208428_1027757All Organisms → Viruses → Predicted Viral1825Open in IMG/M
3300025653|Ga0208428_1123796All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium711Open in IMG/M
3300025751|Ga0208150_1045337Not Available1509Open in IMG/M
3300025751|Ga0208150_1133696All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium794Open in IMG/M
3300026462|Ga0247568_1066556All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium703Open in IMG/M
3300026470|Ga0247599_1130844All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium522Open in IMG/M
3300026503|Ga0247605_1170652All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium520Open in IMG/M
3300026513|Ga0247590_1192319All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium519Open in IMG/M
3300028076|Ga0247562_1027419All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium615Open in IMG/M
3300028115|Ga0233450_10285992All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium709Open in IMG/M
3300028115|Ga0233450_10307562All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium670Open in IMG/M
3300028333|Ga0247595_1006400All Organisms → Viruses → Predicted Viral1711Open in IMG/M
3300029448|Ga0183755_1083640All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium674Open in IMG/M
3300031766|Ga0315322_10260076All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1198Open in IMG/M
3300031774|Ga0315331_10216095All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1423Open in IMG/M
3300031851|Ga0315320_10342703All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1053Open in IMG/M
3300032277|Ga0316202_10079111All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1525Open in IMG/M
3300032277|Ga0316202_10133299All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1152Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater24.46%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh20.86%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous16.55%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater11.51%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine7.91%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.60%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater2.88%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.16%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface2.16%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.44%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.44%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.44%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.72%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.72%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.72%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment0.72%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001419Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m)EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005433Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45BEnvironmentalOpen in IMG/M
3300005510Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45EnvironmentalOpen in IMG/M
3300005512Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_waterEnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300011254Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02EnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020440Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022925Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaGEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300024228Seawater microbial communities from Monterey Bay, California, United States - 41DEnvironmentalOpen in IMG/M
3300024229Seawater microbial communities from Monterey Bay, California, United States - 54DEnvironmentalOpen in IMG/M
3300024296Seawater microbial communities from Monterey Bay, California, United States - 36DEnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028076Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 10R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028115Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly)EnvironmentalOpen in IMG/M
3300028333Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
BBAY92_1014714823300000947Macroalgal SurfaceLEWHNFIADTREQAQAATRPAAGTLEDLFDEVYGDEFWFEVSPDPKAVYQIAFDLRSEEFIVCHSDAECEAVMALAADTGDEDEIFWAE*
BBAY94_1007810413300000949Macroalgal SurfaceMEKIIAATFDIADQCVRTYNALEWHNFLADTLEYLVADGGPSDLTLEEMLDEYYGDEFWFEVSPDPKAVYQIAFDLRSEEFIVCHSDAECEAVMALAADTGDEDEIFWAE*
BBAY94_1010308613300000949Macroalgal SurfaceFDIADQKCKMYNALEWHNFIADTREQAEDPSASLEDLFDEAYGDEFWFEVAPKAFVLYDVAFDLRSEEFILCHSDADCEAVMAMAADTGDEDEIFWAE*
JGI11705J14877_1001391793300001419Saline Water And SedimentMNQIIALTFDIADQKCKMYNALEWHNFIADTREECPNAPAGLEELFDYAYGDEFWFEVAPYSKNVYQAGFDLRSEEFFICDSDAECEFVMEMAADAGDEDEIFWAE*
Ga0055584_10059040133300004097Pelagic MarineMNQIIAATFDIADQKCKMYNALEWHNFIADTREQAEDPSASLEDLFDEVYGDEFWFEDCKWSQKLVYAVAFDLRSETFVICNGDAECEAVMAMAEECGDEEEIFWAE*
Ga0055584_10192049223300004097Pelagic MarineMKEIVAVTFDIAEQKCVAYNALEWHNFIADTLEMLETEVYSTLEELFDYAYGDEFWFEVVPNPFAVYQAGFGLRTEEFVLCQNDSECEFVQALLKDSGDQEEFFWAE*
Ga0066830_1002081823300005433MarineMEKIIAATFDIADQKCKMYNALEWHNFIADTREECPNAPAGLEELFDYAYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDADCEAVMEMAAEAGDEEEIFWAE*
Ga0066825_1029397213300005510MarineMNQIIAATFDIADQKCKMYNALEWHNFIADTREECPNAPAGLEELFDYAYGDEFWFEVIPNPFAVYQVAFDLRSETFVHCKSDVECEFVMAMAEDAGDEEEIFW
Ga0074648_1001905113300005512Saline Water And SedimentMNQIIALTFDIADQKCKMYNALEWHNFIADTREECPNAPAGLEELFDYAYGDEFWFEVAPYSKNVYQAGFDLRSEEFFICDSDAECEFVMATAEECGDEDEIFWAE*
Ga0075511_181343723300006402AqueousDQKCKMYNALEWHNFIADTREQAQAATRPAAGTLEELFDEVYGDEFWFELIPNPFAVYDVAFDLRSETFVHCKSDAESEMYMEMAWASGCQDEIFWAD*
Ga0075511_182411753300006402AqueousMEKIIAVTFDIADQKCKMYNALEWHNFIANTRELVTNDWDDDVLSLEDLFELAYGDEFWFQVIPNAFVVYGVAFDLRSEEFVLCRDDADIDFIMEMAADAGDEDEIFWAE*
Ga0075514_101810423300006403AqueousHNFIADTREQAQAATRPAAGTLEELFDEVYGDEFWFELIPNPFAVYDVAFDLRSETFVHCKSDAESEMYMEMAWASGCQDEIFWAE*
Ga0075515_1005135813300006404AqueousMEKIIAVTFDIADQKCKMYNALEWHNFIADTRELVTNDWDDDVLSLEDLFELAYGDEFWFQVIPNAFVVYGVAFDLRSEEFVMCRDDADIDFIMEMAADAGDEDEIFWAE*
Ga0098048_102022323300006752MarineMEKIIAVTFDIADQKCKMYNALEWHNFIADTREYLADGGEPADLTLEELFDEYYGDEFWFELAPSPFVVYDVAFDLRSEEFVLCHNDTDIEFIMEMARDSGDEDEIFWAE*
Ga0098048_108672813300006752MarineMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDSHYGDEFWFEVSPDPKAVYQIAFDLRSEEFIVCHSDAECEAVMEMAADAGDEEEIFWAE*
Ga0098055_1016684113300006793MarineMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDSYYGDEFWFEVSPDPKAVYQIAFDLRSETFIVCHSDAECEAVMALAEDTGDEEEIFWAE*
Ga0070749_1011029513300006802AqueousMEKIIAVTFDIADQKCKMYNALEWHNFIADTREQCPNAPAGLEELFDYAYGDEFWFEVIPNPFAIYQVAFDLRSEEFVLCQSDTECEFVMAMAEASGDEDEIFWAE*
Ga0070754_1025965823300006810AqueousMEKIIAVTFDIADQKCKMYNALEWHNFIADTREMLQTEVDYTLEELFDYAYGDEFWFEANSWSQKMVYAVAFDLRSEEFVVCNSDNECEMYMEMAWASGCQDEIFWAE*
Ga0075481_1012662323300006868AqueousMEKIIAATFDIADQKCKMYNALEWHNFIADTREQAQAATRPAAGTLEELFDEVYGDEFWFEVSPDPKAVYQIAFDLRSEEFIVCHSDADCEAVMAMAEDTGDEEEIFWAE*
Ga0075481_1027011713300006868AqueousMEKIIAATFDIADQKCKMYNALEWHNFIADTREQAQQGCLEDDASASLPLDELFDYVYGDEFWWEANEWSQKLVYAVAFDLCSETFVVCNSDAECEMYWEVAQAAGQEEEIFWAE*
Ga0070750_1003161933300006916AqueousMEKIIAVTFDIADQKCKMYNALEWHNFIADTREQCPNAPAGLEELFDYAYGDEFWFEVIPNPFAIYQVAFDLRSEEFVLCQSDTECEFVMAMAEDSGDEDEIFWAE*
Ga0070746_1043710113300006919AqueousEKIIAVTFDIADQKCKMYNALEWHNFIADTRELVTNDWDDDVLSLEDLFELAYGDEFWFQVIPNAFVVYGVAFDLRSEEFVLCRDGADIDFIMEMAADAGDEDEIFWAE*
Ga0098051_113015513300006924MarineIADQKCKMYNALEWHNFIADTRENCEAEDADLTLEELFDSYYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDAECEAVMEMAADTGDEEEIFWAE*
Ga0098046_106257013300006990MarineMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDTYYGDEFWFEVSPDPKAVYQIAFDLRSEEFIVCHSDAECEAVMEMAADAGDEEEIFWAE*
Ga0070752_111931323300007345AqueousMEKIIAVTFDIADQKCKMYNALEWHNFIADTREMLQTEVDYTLEELFDYAYGDEFWFEANSWSQKMVYAVAFDLRSEEFVVCNSDNECEMYMEMAWASGCQDEVFWAE*
Ga0070752_115066943300007345AqueousWHNFIADTREYLADGGEPADLTLEELFDEYYGDEFWFEVAPYAKNVYQVAFDLRSEEFVICDSDTEVDFVMEMAADAGDEDEIFWAE*
Ga0099849_127957113300007539AqueousMNQIIAVTFDIADQKCKMYNALEWHNFIADTREECPNAPAGLEELFDYAYGDEFWFEVSPDPKAVYQIAFDLRSEEFIVCHSDAECEAVMAMAEDCGDEDE
Ga0099849_131557713300007539AqueousMEKIIAATFDLADQTCKMYNALEWHNFIADTREENPEWADLSLDEMFEMCYGDEFWWEANEWSQKFVYAVAFDLRSEEFVVCNSDAECEMYWEMAQASGCQDEVFWAE*
Ga0075480_1003677383300008012AqueousGDLAMEKIIAVTFDIADQKCKMYNALEWHNFIADTREMLQTEVDYTLEELFDYAYGDEFWFEVAPKPFVVYDIAFDLRSEEFVLCHNDTDIEFIMEMARDSGDEDEIFWAE*
Ga0075480_1012166443300008012AqueousDIADQKCKMYNALEWHNFIADTREQAQAATRPAAGTLEELFDEVYGDEFWFELIPNPFAVYDVAFDLRSETFVHCKSDAESEMYMEMAWASGCQDEIFWAE*
Ga0075480_1014441633300008012AqueousMFTLNEERYMEKIIAVTFDIADQKCKMYNALEWHNFIANTRELVTNDWDDDVLSLEDLFELAYGDEFWFEVIPNPFAVYQVGFDLRTEEFVLCQSDNECEFVQSMLEDSGDEDEIFWAE*
Ga0098049_106090243300010149MarineIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDSYYGDEFWFEVSPDPKAVYQIAFDLRSETFIVCHSDAECEAVMEMAADAGDEEEIFWAE*
Ga0098056_101104413300010150MarineMFTLNERRQKMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDSYYGDEFWFEVSPDPKAVYQIAFDLRSEEFIVCHSDAECEAVMEMAADAGDEEEIFWAE*
Ga0129348_115566713300010296Freshwater To Marine Saline GradientMEKIIAVTFDIADQKCKMYNALEWHNFIADTREYCEAEDADLTLEELFDSYYGDEFWFEVIPNPFAVYQVGFDLRTEEFVLCQSDNECEFVQSMLEDSGDEEE
Ga0129348_118262313300010296Freshwater To Marine Saline GradientMEKIIAVTFDIADQKCKMYNALEWHNFIADTREMLQTEVDYTLEELFDYAYGDEFWFEVAPKPFVVYDIAFDLRSEEFVLCHNDTD
Ga0129348_126191413300010296Freshwater To Marine Saline GradientALEWHNFIADTREENPEWADLSLDEMFEMCYGDEFWWEANEWSQKFVYAVAFDLRSEEFVVCNSDAECEMYWEMAQASGCQDEVFWAE*
Ga0151675_121322333300011254MarinePIYIADQKCKMYNALEWHNFIADTREQAQAATRPAAGTLEELFDEVYGDEFWFEISPDPKVVYQIAFDLRSEEFIVCHSDAECEAVMEMAADAGDEEEIFWAE*
Ga0151677_105930713300011258MarineMEKIIAATFDIADQKCKMYNALEWHNFIADTREQAQAATRPAAGTLEELFDEVYGDEFWFEISPDPKVVYQIAFDLRSEEFIVCHSDAECEAVMEMAADAGDEEEIFWAE*
Ga0163109_1002268013300012936Surface SeawaterMEKIIAVTFDIADQKCKMYNALEWHNFIADAREQSEDPSASLEDLFDELYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDADCEAVMEMAADAGDEEEIFWAE*
Ga0182046_145768923300016776Salt MarshIAVTFDIADQKCKMYNALEWHNFIADTREYCEAEDADLTLEELFDSYYGDEFWFEVAPYAKNVYQVAFDLRSEEFVICDSDTEVDFVMEMAADAGDEDEIFWAE
Ga0181403_1003162103300017710SeawaterMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDEYYGDEFWFEVSPDPKVVYQIAFDLRSETFIVCHSDAECEAVMEMAAEAGDEEEIFWAE
Ga0181390_107459213300017719SeawaterMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDAYYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDAECEAVMEMAADAGDEEEIFWAG
Ga0181381_104795313300017726SeawaterMFTLNERRQKKNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDSYYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDAECEAVMEMAADAGDEEEIFWAE
Ga0187222_109371513300017734SeawaterMNQIIAVTFDIADQQCKMYNVLEWHNFIADTRENCEAEDADLTLEELFDSYYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDAECEAVMEMAAD
Ga0181433_101057213300017739SeawaterMEKIIAATFDIADQKCKMYNALEWHNFIADTREECPNAPAGLEELFDYAYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDAECEAVMEMAADAGDEEEIFWAE
Ga0181421_104387823300017741SeawaterMNQIIAVTFDIAEQECITYSALEWHNFIADTRENCEAEDADLTLEELFDAYYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDAECEAVMERAADAGDEEEIFWAE
Ga0181402_104636523300017743SeawaterMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDAYYGDEFWFEVSSDPKAVYQIAFDLRSEEFVVCHSDAECEAVMEMAADAGDEEEIFWAE
Ga0181405_113949523300017750SeawaterMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEADDADLTLEELFDAYYSDEFWFEVAPDPKAVYQIAFDLRSETFIVCHSDAECEAVMEMAADAGDEEEIFWAK
Ga0181400_103211823300017752SeawaterMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDSYYGDEFWFEVAPTSKAIYNVAFDLRSEEFVICDSDTEVEFVMEMVADSGDEDEIFWAN
Ga0181382_104057933300017756SeawaterMEKIIAATFDIADQKCKMYNALEWHNFIADTREWLADGEEPADLTLQELFDEAFGDEFWWEANEWSQKLVYAVAFDLRSETFVVCNSDAECEMYWEVAQASGCQEEIFWAE
Ga0181422_117906513300017762SeawaterMNQIIAVTFDIADQKCKMYNALEWHNLIANCREDLAHDDDPLAEGSLEEVFDACMGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDAECEAVMEMAADAGDEEEIFW
Ga0187217_114291613300017770SeawaterMNQIIAVTFDIADQKCKMYNALEWHNLIANCREDLAHDDDPLAEGSLEEVFDACMGDEFWFEVSPDPKAVYQIAFDLRSEEFIVCHSDADCEAVMAMAADAGDEEEIFWAE
Ga0181423_132305913300017781SeawaterMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDAYYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDAE
Ga0181380_103487123300017782SeawaterMEKIIAVTFDIADQKCKMYNALEWHNFIADTRELASEYGEEAPAELDELFDWAYGDEFWFDVVPNPFAVYDVAFDLRSEEFVLCQSDTDIEFIMEMARDSGDEEEIFWAE
Ga0181379_108444443300017783SeawaterMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDSYYGDEFWFEVSPDPKAVYQIAFDLRSETFIVCHSDAECEAVMEMAADAGDEEEIFWAE
Ga0181552_1034755913300017824Salt MarshMEKIIAVTFDIADQKCKMYNALEWHNFIADTREECPNAPAGLEELFDYAYGDEFWFEVVPNPFAVYQVGFDLRTEEFVLCQSDNECEFVQSMLEDSGDEEEFFWAE
Ga0181552_1057596713300017824Salt MarshMEKIIAVTFDIADQKCKMYNALEWHNFIADTREYCEAEDADLTLEELFDSYYGDEFWFEVAPYAKNVYQVAFDLRSEEFVICDSDTEVDFVMEMAADAGDEDEIFWAE
Ga0181577_1004005353300017951Salt MarshMNKIIAVTFDIADQQCKMYNALEWHNFIADTRHMLSNGDDADLPLEELFNAMYGDEFWFEIAPYAKNVYQVGFDLRSEEFVICEDDNEVDFIMEMAADSGDEEEIFWAE
Ga0181577_1004393163300017951Salt MarshMEKIIAVTFDIADQKCKMYNALEWHNFIADTREACELNGVYPPMGLEELFDYAYGDEFWFEVAADPFFERWGMGRVVYDIAFDLRSEEFIVCHSDAECEAVMAMAEETGDEEEIFWAE
Ga0181577_1030012313300017951Salt MarshMEKIIAATFDIADGRCRLYNALEWHNFIADTREACPNAPDGLEELFDYAYGDEFWFEVIPNPFAVYQAGFDLRTEEFVLCQSDSECEFVQSMLEDAGDEEEFFWAE
Ga0181577_1031218023300017951Salt MarshMEKIVAVTFDIADQCCKMYNALEWHNFIADTREACELNEVYPPMGLEELLDYAYGDEFWFELAPYSKNVYAVAFDLQSEEFVICDSDTEVEFVMEMAQDAGSEEEIFWAE
Ga0181577_1064605813300017951Salt MarshQKCKMYNALEWHNFIADTREWVADGEEPTDLTLEELFDDAFGDEFWFDVAPQPFVVYDVAFDLRSEEFILCRNDDDIEFIRATAEECGDEDEIFWAE
Ga0181590_1001207473300017967Salt MarshMEKIIAVTFDIADQKCKMYNALEWHNFIADTREACELNGVYPPMGLEELFDYAYGDEFWFEVAADPFFERWGMGRVVYDIAFDLRSEEFIVCHSDAECEAVMAMAEETGDEEEIFWAELNLFL
Ga0181561_1049779623300018410Salt MarshMEKIIAVTFDIADQKCKMYNALEWHNFIADPREECPNAPAGLEELFDYAYGDEFWFEVVRNPFAVYQVGFDLRTEEFVLCQSDNECEFVQSMLEDSGDEEEFFWAE
Ga0181560_1007446953300018413Salt MarshADQKCKMYNALEWHNFIADTRERLLEEGTYPDHELDELFEEVYGDEFWFEVAPYAKNVYQVAFDLRSEEFVICDSDTEVDFVMEMAADAGDEDEIFWAE
Ga0181559_1020972333300018415Salt MarshMNKIIAVTFDIADQQCKMYNALEWHNFIADTRHMLSNGDDADLPLEELFDAMYGDEFWFEIAPYAKNVYQVAFDLRSEEFVICEDDNEVDFIMEMAADSGDEEEIFWAE
Ga0181559_1033733213300018415Salt MarshMEKIIAVTFDIADQKCKMYNALEWHNFIADTRERLLEEGTYPDHELDELFEEVYGDEFWFEVAPYAKNVYQVAFDLRSEEFVICDSDTEVDFVMEMAADAGDEDEIFWAE
Ga0181559_1047733423300018415Salt MarshMEKIVAVTFDIADQCCKMYNALEWHNFIADTRENCEAEDRDLTLDELFDEYYGDEFWYEVAPKAFQLYDVAFHLPTERFILCHSDHDCEALVAWAEDIGCPEDIFWAE
Ga0181553_1002114533300018416Salt MarshMEKIIAVTFDIADQTCKMYNALEWHNFIADTREACELNGVYPPMGLEELFDYAYGDEFWFEVSPKAFALYDVAFHLPTERFILCHSDHDCEAIVAWAEDIGDPEDIFWAE
Ga0181553_1003551913300018416Salt MarshMEKIVAVTFDIADQCCKMYNALEWHNFIADTRENCEAEDRDLTLDELFDEYYGDEFWYEVAPKAFQLYDVAFHLPTERFILCHSDHDCEALVAWAEDIGDPEDIFWAE
Ga0181553_1008039983300018416Salt MarshMNKIIAVTFDIADQQCNMYNALEWHNFIADTRLHMLSKGDDADLPLDELFDAMYGNEFWYEVAPYAKNVYQVAFDLRSEEFVICEDDNEVDFIMEMAADSGDEEEIFWAE
Ga0181558_1027490413300018417Salt MarshMEKIIAVTFDIADQKCKMYNALEWHNFIADTREYCEAEDADLTLEELFDSYYGDEFWFEVAPYAKNVYQVAFDLRSEEFVICDSDTECEFVMAMAEDAGDEDEIFWAE
Ga0181563_1001542583300018420Salt MarshMEKIIAVTFDIADQQCNMYNALEWHNFIADTRLHMLSKGDDADLPLDELFDAMYGDEFWYEVAPYAKNVYQVAFDLRSEEFVICEDDNEVDFIMEMAADSGDEEEIFWAE
Ga0181563_1002065723300018420Salt MarshMEKIIAVTFDIADQKCKMYNALEWHNFIADTREACELNGVYPPMGLEELFDYAYGDEFWFEVSPKAFALYDVAFHLPTERFILCHSDADCEALVAWAEDIGDPEDIFWAE
Ga0181566_1067741613300018426Salt MarshMEKIIAVTFDIADQKCKMYNALEWHNFIADTREACPNAPDGLEELFDYAYGDEFWFEVIPNPFAVYQAGFDLRTEEFVLCQSDSECEFVQSMLEDAGDEEEFFWAE
Ga0181568_1044461623300018428Salt MarshMEKIGAVTFDIADQCCKMYNALEWHNFIADTREACELNEVYPPMGLEELLDYAYGDEFWFELAPYSKNVYAVAFDLQSEEFVICDSDTEVEFVMEMAQDAGSEEEIFWAE
Ga0181564_1035181313300018876Salt MarshMEKIIAVTFDIADQKCKMYNALEWHNFIADTREYCEAEDADLTLEELFDSYYGDEFWFEVAPYAKNVYQVAFDLRSEEFVICDSDTEVDFVME
Ga0194029_101936513300019751FreshwaterMEKIIAVTFDIADQKCKMYNALEWHNFIADTREQASKASRPAKGTLEDLFDEVYGDEFWFEVIPNPFAIYQVAFDLRSEEFVLCQSDTECEFVMAMAEDSGDEDEIFWAE
Ga0181575_1011795713300020055Salt MarshMEKIIAVTFDIADQKCKMYNALEWHNFIADTREWVADGEEPADLTLEELFDEAFGDEFWFDVAPQPFVVYDVAFDLRSEEFILCRNDDDIEFIRATAEECGDEDEIFWAE
Ga0211659_1001129543300020404MarineMEKIIAVTFDIADQKCKMYNALEWHNFIADAREQSEDPSASLEDLFDELYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDADCEAVMEMAADAGDEEEIFWAE
Ga0211518_1002537933300020440MarineMEKIIAVTFDIADQKCRMYNALEWHNFIADTREYLADGGEPADLTLEELFDEYYGDEFWYEVVPSPFAVYQIAFDLSSGEFIHCQSDAECEAVMADAEECGDEEEIFWAE
Ga0211518_1014840313300020440MarineMEKIIAVTFDIADQKCKMYNALEWHNFIADTITISSEYGEEAPTELEELFDWAYGYEFWFELIPNPFAVYQVGFDLRTEEFVLCQSDSECEFVQSMLEDSGDEEEFFWAE
Ga0211559_1002325553300020442MarineMEKIIAATYDIADQKCKMYNALEWHNFIADTREECPNAPAGLEELFDYAYGDEFWFEVSPDPKVVYQIAFDLRSEEFIVCHSDADCEAVMAMAEEAGDEEEIFWAE
Ga0206682_1042647123300021185SeawaterTFDIANQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDAYYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDAECEAVMEMAADAGDEEEIFWAE
Ga0213867_1003095223300021335SeawaterMEKIVAVTFDIADQRCKMYNALEWHNFLADTRERASKASRPAKGTLEDLFDEMYGDEFWFELAPYSKNVYAVAFDLQSEEFVICDSDTEVDFVMEMAQDAGSEEEIFWAS
Ga0213867_100469543300021335SeawaterMEKIIAVTFDIADQKCKMYNALEWHNFLADTREQAQAATRPAAGTLEDLFDEVYGDEFWFEVIPNPFAVYQVGFDLRTEEFVLCQSDNECEFVQALLEDSGDEEEFFWAD
Ga0213867_105537263300021335SeawaterMEKIIAVTFDIADQCVKMYNALEWHNFIADTREMFQAAPSDLPLDELFEECYGDEFWYEVAPKAFQLYDVAFHLPTERFMLCHSDHDCEAIVAWAEDIGDPEDIFWAE
Ga0213858_1052883113300021356SeawaterMEKIIAATFDIADQKCKMYNALEWHNFIADAREQSEDPSASLEDLFDELYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCRSDADCEAVMEMAADAGDEEEIFWAE
Ga0213859_10000422453300021364SeawaterIADQKCKMYNALEWHNFIADTREFVDEPDATLEDLFEIAYGDEFWFELAPYPKAVYQMAFDLRCEEFIICSSDAECEMIQDMAAESGDDEEIFWAE
Ga0213859_1023802723300021364SeawaterMEKIIAVTFDIADQKCKMYNALEWHNFIADTREFVDEPDATLEDLFDIAYGDEFWFELAPYPKAVYQMAFDLRCEEFIICSSDAECEMI
Ga0213859_1025835413300021364SeawaterMEKIIAVTFDIADQKCKMYNALEWHNFIADTREQCPNAPAGLEELFDYAYGDEFWFEVIPNPFAIYQVGFDLRTEEFVLCQNDSECEFVQSMLEDSGDEEEFFWAE
Ga0213860_1000731993300021368SeawaterMEKIIAVTFDIADQKCKMYNPLEWHNFIADTREQCPNAPAGLEELFDYAYGDEFWFEVIPNPFAVYQVAFDLRSEEFVVCSDDNECEFVMAMAEDAGDEDEIFWAE
Ga0213860_1007960613300021368SeawaterMEKIIAVTFDIADQKCKMYNALEWHNFIADTRERLLEEGTYPDHELDELFEEVYGDEFWFEVIPNPFAIYQVAFDLRSEEFVLCQSDTECEFVMAMAEDAGDEDEIFWAE
Ga0213860_1046367213300021368SeawaterIADQKCKMYNALEWHNFIADTRERLLEEGTYPDHELDELFEEVYGDEFWFEVAPYAKNVYQVAFDLRSEEFVICDSDTECEFVMEMAADAGDEEEIFWAE
Ga0213865_1000386423300021373SeawaterMEKIVAVTFDLADQCCKMYNALEWHNFIADTRENCEAEDRDLTLDELFDEYYGDEFWFEVAPEPFVVYDVAFDLRSEEFVLCHNDTDIEFIMEMARDSGDEEEIFWAE
Ga0213865_10004488103300021373SeawaterMEKIIAVTFDIADQKCKMYNALEWHNFIADTREECPNAPAELEELFDYAYGDEFWFEVVPNPFAVYQVGFDLRTEEFVLCQSDNECEFVQSMLEDSGDEEEFFWAE
Ga0213865_1000574873300021373SeawaterMEKIIASTFDIADGRCRLYNALEWHNFIADTREACPNAPEGLEELFDYAYGDEFWFEVAPEPLVVYDIAFDLRSESFIVCHNDTDIEFVMEMARDCGDEDEIFWAE
Ga0213865_1006364713300021373SeawaterMDKIIAVTFDIADQKCKMYNALEWHNFIADTREACELNGVYPPMGLEELFDYAYGDEFWFEVAPEPFVLYDVAFDLRSEEFVLCQSDTDIEFIMEMARDSGDEEEIFWAE
Ga0213865_1007577943300021373SeawaterMEKIIAVTFDIADGRCRLYNALEWHNFIADTREACPNAPAGLEELFDYAYGDEFWFEVIPNPFAIYQVGFDLRTEEFVLCQNDSECEFVQSMLEDSGDEEEFFWAE
Ga0213865_1014291813300021373SeawaterMEKIIAVTFDIADQKCKMYNALEWHNFIADTRERLLEEGTYPDHELDELFEEVYGDEFWFEVAPYAKNVYQVAFDLRSEEFVICDSDTEVDFVMEMAADAGDEDEIFWAER
Ga0213865_1052542413300021373SeawaterMEKIIAVTFDIADQKCKMYNALEWHNFIADTREYCEAEDADLTLEELFDSYYGDEFWFEVIPNPFAVYQVGFDLRTEEFVLCQSDNECEFVQSMLEDSGDEE
Ga0213864_1003796723300021379SeawaterMKKIIAATFDIADGRCRLYNALEWYNFIADTREACPNAPAALEELFDYAYGDEFWFEANQWSQKSVYQVAFDLRSEEFVVCNSDAECEMVMAMAEEAGDEEEIFWAE
Ga0213864_1004149863300021379SeawaterMEKIVAVTFDIADQKCKMYNALEWHNFLADTREQAQAATRPAAGTLDDLFDEIYGDEFWYEIVPNPFAVYQVAFDLRSEEFVVCNSDAECEAVMAMAEEAGDEE
Ga0213866_10030870103300021425SeawaterMEKIIAVTYDIADQKCKMYNALEWHNFIADTRERLLEEGTYPDHELDELFEEVYGDEFWFEVAPYAKNVYQVAFDLRSEEFIICESDTECEFVMAMAEDAGDEEEIFWAE
Ga0213866_1011243713300021425SeawaterMEKIIAVTFDISDQKCKMYNALEWHNFIADTREQCPNAPAGLEELFDYAYGDEFWFEVIPNPFAIYQVGFDLRTEEFVLCQNDSECEFVQSMLEDSGDEEEFFWAE
Ga0213866_1017690213300021425SeawaterMEKIIAVTFDIADQKCKMYNALEWHNFIADTREYLADGGEPADLTLEELFDEYYGDEFWFEVAPYAKNVYQVAFDLRSEEFVICDSDTEVDFVMEMAADAGDEDEIFWAE
Ga0213866_1018148043300021425SeawaterRCRLYNALEWHNFIADTREACPNAPEGLEELFDYAYGDEFWFEVAPEPLVVYDIAFDLRSESFIVCHNDTDIEFVMEMARDCGDEDEIFWAE
Ga0213866_1025329923300021425SeawaterMEKIIAATFDIADGRCRLYNALEWHNFIADTREACPNAPEGLEELFDYAYGDEFWFEANEWSQKSVYQVAFDLRSEEFIVCNSDVECEMVMAMAEETGDEEEIFWAE
Ga0213866_1039541113300021425SeawaterMEKIIAVTFDIADQKCKMYNALEWHNFIADTREECPNAPAELEELFDYAYGDEFWFEVVPNPFAVYQVGFDLRTEEFVLCQSDNECEFVQSMLEDSGDEEE
Ga0222718_1001704313300021958Estuarine WaterMEKIIAVTFDIADQKCKMYNALEWHNFIADTREQAQAATRPAAGTLEDLFDEVYGDEFWFEVAPYAKNVYQVAFDLRSEEFVICNSDAECEAVMAMAEECGDEEEIFWAE
Ga0224906_119853713300022074SeawaterMEKIIAATFDIADQKCKMYNALEWHNFIADTREECPNAPAGLEELFDYAYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDADCEAVMAMAEDVGDEEEIFWAE
Ga0196891_108597113300022183AqueousMEKIIAVTFDIADQKCKMYNALEWHNFIADTREQCPNAPAGLEELFDYAYGDEFWFEVIPNPFAIYQVAFDLRSEEFVLCQSDTECEFVMAMAEDSGDEDEIFWAE
Ga0255773_1038649013300022925Salt MarshMEKIIAVTFDIADQKCKMYNALEWHNFIADTRERLLEEGTYPDHELDELFEEVYGDEFWFEVAPYAKNVYQVAFDLRSEEFVICDSDTECEFVMAMAEDAGDEDEIFWAE
Ga0255752_10046036113300022929Salt MarshKIVAVTFDIADQQCNMYNALEWHNFIADTRLHMLSKGDDADLPLDELFDAMYGDEFWYEVAPYAKNVYQVAFDLRSEEFVICEDDNEVDFIMEMAADSGDEEEIFWAE
Ga0255752_1032297113300022929Salt MarshMEKIVAVTFDIADQCCKMYNALEWHNFIADTRENCEAEDRDLTLDELFDEYYGDEFWYEVAPKAFQLYDVAFHLPTERFILCHSD
Ga0228633_106092633300024228SeawaterNALEWHNFIADTRENCEAEDADLTLEELFDAYYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDADCEAVMAMAADAGDEDEIFWAE
Ga0233402_101378353300024229SeawaterMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDAYYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDADCEAVMAMAADAGDEDEIFWAE
Ga0228629_1001599113300024296SeawaterMEKIIAATFDIADQKCKMYNALEWHNFIADTREECPNAPAGLEELFDYAYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDADCEA
Ga0208298_101466623300025084MarineMEKIIAVTFDIADQKCKMYNALEWHNFIADTREYLADGGEPADLTLEELFDEYYGDEFWFELAPSPFVVYDVAFDLRSEEFVLCHNDTDIEFIMEMARDSGDEDEIFWAE
Ga0209645_106630123300025151MarineMEKIIAVTFDIADQKCKMYNPLEWHNFIADTREECPNAPAGLEELFDYAYGDEFWFEVIPNPFAVYQVAFDLRSETFVHCKSDVECEFVMAMAEDAGDEEEIFWAE
Ga0208428_100050413300025653AqueousMEKIIAVTFDIADQKCKMYNALEWHNFIADTREMLQTEVDYTLEELFDYAYGDEFWFEVAPKPFVVYDIAFDLRSEEFVLCHNDTDIEFIMEMARDSGDEDEIFWAE
Ga0208428_102775763300025653AqueousMEKIIAVTFDIADQKCKMYNALEWHNFIADTREYCEAEDADLTLEELFDSYYGDEFWFEVIPNPFAVYQVGFDLRTEEFVLCQSDNECEFVQSMLEDSGDEEEFFWAE
Ga0208428_112379623300025653AqueousMEKIIAATFDIADQKCKMYNALEWHNFIADTREQAQAATRPAAGTLEELFDEVYGDEFWFELIPNPFAVYDVAFDLRSETFVHCKSDAESEMYMEMAWASGCQDEIFWAE
Ga0208150_104533753300025751AqueousMEKIIAVTFDIADQKCKMYNALEWHNFIADTREQAQAATRPAAGTLEELFDEVYGDEFWFELIPNPFAVYDVAFDLRSETFVHCKSDAESEMYMEMAWASGCQDEIFWAE
Ga0208150_113369613300025751AqueousMEKIIAATFDIADQKCKMYNALEWHNFIADTREQAQAATRPAAGTLEELFDEVYGDEFWFEVSPDPKAVYQIAFDLRSEEFIVCHSDADCEAVMAMAEDTGDEEEIFWAE
Ga0247568_106655613300026462SeawaterMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDAYYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDADCEAVMAMAEDVGDEEEIFWAE
Ga0247599_113084413300026470SeawaterDKKMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDAYYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDADCEAVMAMAADAGDEDEIFWAE
Ga0247605_117065213300026503SeawaterQKMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDAYYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDADCEAVMAMAADAGDEDEIFWAE
Ga0247590_119231913300026513SeawaterKMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDSYYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDADCEAVMAMAADAGDEDEIFWAE
Ga0247562_102741923300028076SeawaterGDLAMEKIIAATFDIADQKCKMYNALEWHNFIADTREECPNAPAGLEELFDYAYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDADCEAVMAMAEDVGDEEEIFWAE
Ga0233450_1028599213300028115Salt MarshMEKIIAVTFDIADQKCKMYNALEWHNFIADTRERLLEEGTYPDHELDELFEEVYGDEFWFEVAPYAKNVYQVAFDLRSEEFVICDSDTEVDFVMEMAADAGDEEEFFWAE
Ga0233450_1030756213300028115Salt MarshMEKIVAVTFDIADQCCKMYNALEWHNFIADTRENCEAEDRDLTLDELFDEYYGDEFWYEVAPKAFQIYDVAFHLPTERFILCHSDHDCEALVAWAEDIGDPED
Ga0247595_100640013300028333SeawaterNALEWHNFIADTRENCEAEDADLTLEELFDAYYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDADCEAVMAMAEDVGDEEEIFWAE
Ga0183755_108364013300029448MarineMEKIVAVTFDIADQQCKMYNALEWHNFIADTREQAEDPSASLEDLFDEVYGDELWFEVIPNPFAIYQVGFDLRTEEFVLCQSDSECEFVQSMLEDSGDEEEFFWAE
Ga0315322_1026007623300031766SeawaterMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDAYYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDAECEAVMEMAADAGDE
Ga0315331_1021609513300031774SeawaterMNQIIAVTFDIADQKCKMYNALEWHNLIANCREDLAHDDDPLAEGSLEEVFDACMGDEFWFEVSPDPKAVYQIAFDLRSEEFIVCHSDADCEAVMAMAEDAGDEDEIFWAE
Ga0315320_1034270313300031851SeawaterMNQIIAVTFDIADQQCKMYNALEWHNFIADTRENCEAEDADLTLEELFDAYYGDEFWFEVSPDPKAVYQIAFDLRSEEFVVCHSDAECEAVMEMAADAGDEEEIFWAE
Ga0316202_1007911133300032277Microbial MatMEKIIAVTFNIADQKCVAYNALEWHNFIADTREMLQTEVDYTLEELFDYAYGDEFWFEANEWSQKLVYDVAFDLQSESFIICDSDTEVDFIMEMAADAGSEEEIFWAFNE
Ga0316202_1013329923300032277Microbial MatMEKIIAVTFDIADQKCKMYNALEWHNFIADTREMLQTEVDYTLEELFDYAYGDEFWFEANSWSQKMVYAVAFDLRSEEFVVCNSDNECEMYMEMAWASGCQDEIFWAE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.