NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055284

Metagenome / Metatranscriptome Family F055284

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055284
Family Type Metagenome / Metatranscriptome
Number of Sequences 139
Average Sequence Length 40 residues
Representative Sequence FSTYVIGRMMHRVLVENWEAEKAVEEAHKKVAEIYARHQEA
Number of Associated Samples 110
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.72 %
% of genes near scaffold ends (potentially truncated) 93.53 %
% of genes from short scaffolds (< 2000 bps) 93.53 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.086 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(21.583 % of family members)
Environment Ontology (ENVO) Unclassified
(27.338 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.446 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 55.07%    β-sheet: 0.00%    Coil/Unstructured: 44.93%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF01547SBP_bac_1 12.23
PF00378ECH_1 5.04
PF01494FAD_binding_3 4.32
PF02182SAD_SRA 3.60
PF13416SBP_bac_8 3.60
PF00296Bac_luciferase 2.16
PF02518HATPase_c 1.44
PF13378MR_MLE_C 1.44
PF01799Fer2_2 1.44
PF00691OmpA 1.44
PF07947YhhN 1.44
PF00528BPD_transp_1 1.44
PF07992Pyr_redox_2 1.44
PF05685Uma2 1.44
PF01594AI-2E_transport 1.44
PF05598DUF772 1.44
PF03401TctC 1.44
PF00144Beta-lactamase 0.72
PF13673Acetyltransf_10 0.72
PF13450NAD_binding_8 0.72
PF00753Lactamase_B 0.72
PF02738MoCoBD_1 0.72
PF13676TIR_2 0.72
PF12697Abhydrolase_6 0.72
PF03400DDE_Tnp_IS1 0.72
PF14863Alkyl_sulf_dimr 0.72
PF01989AcnX_swivel_put 0.72
PF064393keto-disac_hyd 0.72
PF02515CoA_transf_3 0.72
PF07685GATase_3 0.72
PF03404Mo-co_dimer 0.72
PF01740STAS 0.72
PF09754PAC2 0.72
PF00588SpoU_methylase 0.72
PF02900LigB 0.72
PF00903Glyoxalase 0.72
PF02775TPP_enzyme_C 0.72
PF12680SnoaL_2 0.72
PF13592HTH_33 0.72
PF03703bPH_2 0.72
PF09992NAGPA 0.72
PF08028Acyl-CoA_dh_2 0.72
PF13561adh_short_C2 0.72
PF00496SBP_bac_5 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 8.63
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 4.32
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 4.32
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 4.32
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 2.16
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 1.44
COG3714Uncharacterized membrane protein YhhNFunction unknown [S] 1.44
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 1.44
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.44
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.72
COG3428Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.72
COG3402Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.72
COG2367Beta-lactamase class ADefense mechanisms [V] 0.72
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.72
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.72
COG1786Mevalonate 5-phosphate dehydratase subunit 2, swiveling domain (modified mevalonate pathway)Lipid transport and metabolism [I] 0.72
COG0219tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domainTranslation, ribosomal structure and biogenesis [J] 0.72
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.72
COG1662Transposase and inactivated derivatives, IS1 familyMobilome: prophages, transposons [X] 0.72
COG0566tRNA G18 (ribose-2'-O)-methylase SpoUTranslation, ribosomal structure and biogenesis [J] 0.72
COG0565tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferaseTranslation, ribosomal structure and biogenesis [J] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.09 %
UnclassifiedrootN/A7.91 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000443|F12B_10032727All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_181320Open in IMG/M
3300001431|F14TB_100370762Not Available784Open in IMG/M
3300004463|Ga0063356_103363271All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300005289|Ga0065704_10630629All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300005332|Ga0066388_104758303All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300005445|Ga0070708_100313120All Organisms → cellular organisms → Bacteria → Proteobacteria1479Open in IMG/M
3300005552|Ga0066701_10056510All Organisms → cellular organisms → Bacteria2176Open in IMG/M
3300005552|Ga0066701_10411160All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300005555|Ga0066692_10468941All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300005559|Ga0066700_10917475All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium581Open in IMG/M
3300005569|Ga0066705_10013879All Organisms → cellular organisms → Bacteria3949Open in IMG/M
3300005586|Ga0066691_10621732All Organisms → cellular organisms → Bacteria → Proteobacteria641Open in IMG/M
3300005598|Ga0066706_10337728All Organisms → cellular organisms → Bacteria → Proteobacteria1192Open in IMG/M
3300005713|Ga0066905_100851553All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300005843|Ga0068860_100131848All Organisms → cellular organisms → Bacteria → Proteobacteria2398Open in IMG/M
3300005937|Ga0081455_10590787All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300006574|Ga0074056_11285216All Organisms → cellular organisms → Bacteria → Proteobacteria720Open in IMG/M
3300006794|Ga0066658_10375999All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300006797|Ga0066659_11584628All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300006844|Ga0075428_100347438All Organisms → cellular organisms → Bacteria1592Open in IMG/M
3300006845|Ga0075421_100958397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales972Open in IMG/M
3300006845|Ga0075421_101783580All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300006846|Ga0075430_100516148All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300006847|Ga0075431_100609143All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1075Open in IMG/M
3300006853|Ga0075420_100861708All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300006871|Ga0075434_100763778All Organisms → cellular organisms → Bacteria → Acidobacteria983Open in IMG/M
3300006880|Ga0075429_100679543All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300006880|Ga0075429_101256854All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300006904|Ga0075424_101842566All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium640Open in IMG/M
3300007255|Ga0099791_10667562All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300009012|Ga0066710_101858078All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300009012|Ga0066710_102531601All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium741Open in IMG/M
3300009012|Ga0066710_103067664All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300009012|Ga0066710_104249293All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium535Open in IMG/M
3300009012|Ga0066710_104858204Not Available503Open in IMG/M
3300009089|Ga0099828_11705683All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron554Open in IMG/M
3300009090|Ga0099827_10354031All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1249Open in IMG/M
3300009090|Ga0099827_10699853All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300009090|Ga0099827_10767402All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300009090|Ga0099827_11273030All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300009090|Ga0099827_11597769All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium568Open in IMG/M
3300009094|Ga0111539_10487483Not Available1436Open in IMG/M
3300009100|Ga0075418_11972014All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300009100|Ga0075418_12467920All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300009137|Ga0066709_101548377All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium953Open in IMG/M
3300009137|Ga0066709_102174715All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300009147|Ga0114129_11886265All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300009162|Ga0075423_11600902All Organisms → cellular organisms → Bacteria → Proteobacteria700Open in IMG/M
3300009444|Ga0114945_10033129All Organisms → cellular organisms → Bacteria → Proteobacteria2782Open in IMG/M
3300009553|Ga0105249_10956106Not Available925Open in IMG/M
3300009691|Ga0114944_1010132All Organisms → cellular organisms → Bacteria3099Open in IMG/M
3300009691|Ga0114944_1063535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1369Open in IMG/M
3300009792|Ga0126374_10356012All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300009792|Ga0126374_10577280All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300009795|Ga0105059_1028448Not Available654Open in IMG/M
3300009807|Ga0105061_1080732All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium543Open in IMG/M
3300010043|Ga0126380_11924468All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300010047|Ga0126382_10132219All Organisms → cellular organisms → Bacteria1677Open in IMG/M
3300010047|Ga0126382_10314532All Organisms → cellular organisms → Bacteria1182Open in IMG/M
3300010047|Ga0126382_10994693All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300010047|Ga0126382_11185536All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300010047|Ga0126382_12215790All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300010114|Ga0127460_1054222All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300010166|Ga0126306_11385756All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300010359|Ga0126376_12958324Not Available525Open in IMG/M
3300010362|Ga0126377_11871277All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300010362|Ga0126377_12722489All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300010362|Ga0126377_13459464All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300010391|Ga0136847_11942537All Organisms → cellular organisms → Bacteria1454Open in IMG/M
3300010398|Ga0126383_11439370All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300010399|Ga0134127_10568367All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300011270|Ga0137391_10195826All Organisms → cellular organisms → Bacteria1759Open in IMG/M
3300011271|Ga0137393_10815801All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300012199|Ga0137383_10145675All Organisms → cellular organisms → Bacteria → Proteobacteria1733Open in IMG/M
3300012205|Ga0137362_11423790All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300012209|Ga0137379_11275721All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300012210|Ga0137378_10140437All Organisms → cellular organisms → Bacteria2235Open in IMG/M
3300012211|Ga0137377_11322462All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300012349|Ga0137387_10907946All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Tautonia → Tautonia rosea636Open in IMG/M
3300012349|Ga0137387_11297590All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300012351|Ga0137386_10632927All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300012353|Ga0137367_10750173All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300012355|Ga0137369_10217877All Organisms → cellular organisms → Bacteria1464Open in IMG/M
3300012363|Ga0137390_11611804All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium586Open in IMG/M
3300012392|Ga0134043_1291387All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium540Open in IMG/M
3300012532|Ga0137373_10274006All Organisms → cellular organisms → Bacteria1352Open in IMG/M
3300012685|Ga0137397_10696882All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300012917|Ga0137395_10183042All Organisms → cellular organisms → Bacteria1451Open in IMG/M
3300012918|Ga0137396_11071953All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300012922|Ga0137394_10724466Not Available836Open in IMG/M
3300012922|Ga0137394_11251875All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300012929|Ga0137404_11072248All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300012944|Ga0137410_11216126All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300012948|Ga0126375_11744361All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300012971|Ga0126369_12567237All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella594Open in IMG/M
3300013306|Ga0163162_10573516All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300014154|Ga0134075_10016124All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2931Open in IMG/M
3300015053|Ga0137405_1358787All Organisms → cellular organisms → Bacteria3039Open in IMG/M
3300015248|Ga0180079_1026002All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300016445|Ga0182038_11385121All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300017792|Ga0163161_11284660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium636Open in IMG/M
3300018078|Ga0184612_10409589All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria680Open in IMG/M
3300018433|Ga0066667_10316915All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300018466|Ga0190268_11559395All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Xenophilus → unclassified Xenophilus → Xenophilus sp. L33578Open in IMG/M
3300019233|Ga0184645_1002632All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300019248|Ga0180117_1403992All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300019259|Ga0184646_1182014All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300020197|Ga0194128_10155368All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300025149|Ga0209827_11082166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1859Open in IMG/M
3300025910|Ga0207684_10345954Not Available1280Open in IMG/M
3300025922|Ga0207646_10253667All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1589Open in IMG/M
3300025922|Ga0207646_10264419All Organisms → cellular organisms → Bacteria1555Open in IMG/M
3300026524|Ga0209690_1246516All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300026535|Ga0256867_10246717All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300027675|Ga0209077_1165741All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300027873|Ga0209814_10150128All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300027874|Ga0209465_10098513All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Vitiosangium → unclassified Vitiosangium → Vitiosangium sp. GDMCC 1.13241433Open in IMG/M
3300027882|Ga0209590_10405831All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium880Open in IMG/M
3300027909|Ga0209382_10571688All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300027957|Ga0209857_1060142Not Available659Open in IMG/M
3300027961|Ga0209853_1025838All Organisms → cellular organisms → Bacteria1749Open in IMG/M
3300028673|Ga0257175_1015641All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1209Open in IMG/M
3300030006|Ga0299907_11037224All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300030006|Ga0299907_11268895All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300030574|Ga0247648_1089998All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300030608|Ga0247651_10054388All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300030830|Ga0308205_1048054All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300030902|Ga0308202_1098894All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300031092|Ga0308204_10006111All Organisms → cellular organisms → Bacteria1954Open in IMG/M
3300031092|Ga0308204_10183664All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300031572|Ga0318515_10710200All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300031908|Ga0310900_10288235All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300031908|Ga0310900_10990205All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium691Open in IMG/M
3300032180|Ga0307471_100356139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1576Open in IMG/M
3300032180|Ga0307471_102286778All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300032205|Ga0307472_102408782Not Available534Open in IMG/M
3300034659|Ga0314780_178834All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300034676|Ga0314801_178557All Organisms → cellular organisms → Bacteria530Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil21.58%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.23%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.47%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.76%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.88%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.88%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.16%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.16%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.16%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.16%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.44%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.72%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.72%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.72%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.72%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.72%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009444Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009691Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009795Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50EnvironmentalOpen in IMG/M
3300009807Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010114Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012392Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015248Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT530_16_10DEnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300019233Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019248Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300025149Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027675Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027957Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027961Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030574Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030608Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030830Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034676Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F12B_1003272723300000443SoilEVLATYVIGRMMHRVLVENWNVEKAVVEAHKKAQDIYARYQGA*
F14TB_10037076213300001431SoilIGRMMHRVLVESWNVEKAVEEAHKKVAEIYARHQA*
Ga0063356_10336327123300004463Arabidopsis Thaliana RhizosphereGEVYATTVLARMVHRVVVDNWEAEKAVKEAHNKIVEIYARWPEG*
Ga0065704_1063062913300005289Switchgrass RhizosphereLATYTIGRMMHRVLVESWNVEKAVVEAHKKAQDIYNRYQGA*
Ga0066388_10475830313300005332Tropical Forest SoilEVSSTYVIGRMMHRVLVDYWAAEKAVEEAHKKAVEIYARYQEG*
Ga0070708_10031312013300005445Corn, Switchgrass And Miscanthus RhizosphereEVLATFTIGRMMHRVLVESWNVEKAVAEAHKKVAEIYARHQRG*
Ga0066701_1005651053300005552SoilGEVLATFVIGRMMHRVLVESWNVEKAVVEAHQKVVEIYKRHQAG*
Ga0066701_1041116013300005552SoilARMMHRVLVEHWEVEKAVEETHKQVAEIYARHAAG*
Ga0066692_1046894133300005555SoilASGEVLATFVIGRMMHRVLVESWNVEKAVVEAHQKVVEIYKRHQAG*
Ga0066700_1091747513300005559SoilIGRMMHRVLVENWEAEKAVEEAHKKAVEIYARYQEA*
Ga0066705_1001387953300005569SoilRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA*
Ga0066691_1062173223300005586SoilRMMHRVLVESWNVEKAVVEAHKKVAEIYKRHQAG*
Ga0066706_1033772833300005598SoilATFVIGRMMHRVLVESWNVEKAVVEAHKKVAEIYKRHQAG*
Ga0066905_10085155333300005713Tropical Forest SoilGEVSSTYVIGRMMHRVLVDYWAAEKAVEEAHKKAVEIYARYQEG*
Ga0068860_10013184833300005843Switchgrass RhizosphereVIGRMMHRVLVESWNVEKAVEEAHKKVAEIYARHQA*
Ga0081455_1059078723300005937Tabebuia Heterophylla RhizosphereRMIQRVLVESWEAEKAVEEAHKKVVEIYARYPEG*
Ga0074056_1128521613300006574SoilAASGEVLATFVIGRMMHRVLVESWNVEKAVEEAHKKVAEIYARHQT*
Ga0066658_1037599923300006794SoilVGEVSSTYMIGRMMHRVLVENWEAEKAVEEAHKKVVEIYARHQEA*
Ga0066659_1158462813300006797SoilSTYLIGRMMHRVLVENWEAEKAVEEAHKKVVEIYARHQEA*
Ga0075428_10034743843300006844Populus RhizosphereTIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA*
Ga0075421_10095839713300006845Populus RhizosphereVLATFTIGRMMHRVLVESWTAEKAVEEAHKKVAEIYARHHQGRA*
Ga0075421_10178358033300006845Populus RhizosphereLATYTIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA*
Ga0075430_10051614823300006846Populus RhizosphereATYTISRMLHRVLAENWEAERAVKEAHKKVVEIYARHQEG*
Ga0075431_10060914323300006847Populus RhizosphereIGRMMHRVLVENWEAEKAVEEAHKKIVEIYARHQEA*
Ga0075420_10086170823300006853Populus RhizosphereAAGEVIATNVLARMMHRVLVEEWEAEKAVEEAHKKIVEIYTRAAQG*
Ga0075434_10076377823300006871Populus RhizosphereAAGEVLATYVIGRMMHRVLVESWNIEKAVVEAHKKVQDIYARYQGA*
Ga0075429_10067954313300006880Populus RhizosphereRMMHRVLVDNWEAEKAVEEAHNKVVEIYARYPEG*
Ga0075429_10125685413300006880Populus RhizosphereTSVLARMMHHVLVDGWEAEKAVEEAHKKVVEIYARYPEG*
Ga0075424_10184256613300006904Populus RhizosphereRMMHRVLVESWNVEKAVVEAHKKAQDIYNRYQGA*
Ga0099791_1066756223300007255Vadose Zone SoilATFVIGRMMHRVLVESWNAEKAVGEAHKKVAEIYKRHQAG*
Ga0066710_10185807813300009012Grasslands SoilSTYLIGRMMHRVLVENWEAEKAVEEAHKKVAEIYARHQET
Ga0066710_10253160113300009012Grasslands SoilYTIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA
Ga0066710_10306766423300009012Grasslands SoilATFTIGRMMHRVLVESWAVEKAVAEAHKKVAEIYARHQKA
Ga0066710_10424929313300009012Grasslands SoilTYTIGRMMHRVLVENWNVEKAVVEAHKKVAEIYARYQGA
Ga0066710_10485820423300009012Grasslands SoilGEVLATFTIGRMMHRVLVESWNVEKAVEEAHKKVAEIYARHQKG
Ga0099828_1170568323300009089Vadose Zone SoilMMHRALVENLEAEKAVEEAHKKVVEIYAHNQGES*
Ga0099827_1035403123300009090Vadose Zone SoilMMHRALVENLEAEKAVEEAHKKVVEIYAHNQEES*
Ga0099827_1069985313300009090Vadose Zone SoilTTYVIARMMHRVLVEHWEVEKAVEETHKQVAEIYARHAAG*
Ga0099827_1076740223300009090Vadose Zone SoilTIGRMMHRVLVENWNVEKAVVEAHKKVAEIYARHQKE*
Ga0099827_1127303023300009090Vadose Zone SoilASGEVLATYTIGHMLHRVLVESWEVEKAVEETHKKVAEIYARHQEG*
Ga0099827_1159776923300009090Vadose Zone SoilGRMMHRVLVENWEAEKAVEEAHKKTVEIYARHQEG*
Ga0111539_1048748313300009094Populus RhizosphereVLGHMIQRVLVEGWEAEKAVEEAHTKVAAIYARHQEA*
Ga0075418_1197201423300009100Populus RhizosphereLARMMHHVLVDNWEPEKAVEEAHNKVVEIYARYPEG*
Ga0075418_1246792013300009100Populus RhizosphereRMVHRVLVDHWEAEKAVEDAHRQAVEIYARYPEG*
Ga0066709_10154837723300009137Grasslands SoilYTIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA*
Ga0066709_10217471523300009137Grasslands SoilVLATFVIGRMMHRVLVESWNAEKAVEEAHKKVATIYARHQAA*
Ga0114129_1188626513300009147Populus RhizosphereIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA*
Ga0075423_1160090213300009162Populus RhizosphereEVLATFTIGRMMHRVLVENWPVEKSVEEAHKKVAEIYARHNKG*
Ga0114945_1003312963300009444Thermal SpringsEVLGTYVIGRMMHRVLVESWAAENAVEEAHKKVVEIYARHQEA*
Ga0105249_1095610623300009553Switchgrass RhizosphereGHMIQRVLVEGWEAEKAVAEAHTKVAAIYARHQDA*
Ga0114944_101013233300009691Thermal SpringsMMHRVLVENWEAEKAVEEAHKKVAEIYARHQQES*
Ga0114944_106353523300009691Thermal SpringsVFATSVISRIMHRVLVENWAAEKAVEEAHKKVVEIYARQQQES*
Ga0126374_1035601233300009792Tropical Forest SoilHTYVLGRMMHRVLVENWEAEKAVEEAHKKTVEIYARHQEA*
Ga0126374_1057728013300009792Tropical Forest SoilHMMHRVLVEAWEVEKAVAEAHKKVAEIYARHQEEG*
Ga0105059_102844823300009795Groundwater SandRMMHRVLVESWEAEKAVEEAHKKVAEIYARHQES*
Ga0105061_108073213300009807Groundwater SandGEVLATFVIGRMMHRVLVENWDVEKAVVEAHKKVAEIYARHQKG*
Ga0126380_1192446813300010043Tropical Forest SoilTYVIGHMMHRVLVEAWEVEKAVAEAHKKVAEIYARHQEEG*
Ga0126382_1013221923300010047Tropical Forest SoilTIGHMIQRVLVENWEAEKAVEEAHKKVVEIYARYQEA*
Ga0126382_1031453213300010047Tropical Forest SoilVSSTYVIGRMMHRVLVDYWAAEKAVEEAHKKAVEIYARYQEG*
Ga0126382_1099469313300010047Tropical Forest SoilLATFVIGRMMHRVLVENWNAEKAVEEAHKRVAEIYARYQGT*
Ga0126382_1118553623300010047Tropical Forest SoilYTIGHMIQRVLVENWEAEKAVEEAHKKVVEIYARY*
Ga0126382_1221579013300010047Tropical Forest SoilIGRMMHRVLVENWNVEKAVVEAHKKVADIYARHNKG*
Ga0127460_105422213300010114Grasslands SoilRVMHRVLVEHWEVEKAVEETHKQVAEIYARHAAG*
Ga0126306_1138575623300010166Serpentine SoilISRMVHWVLVENWEVEKAVEEAHKKVVEIYARYGEG*
Ga0126376_1295832423300010359Tropical Forest SoilMMHRVLVENWEAEKAAEEAHKKVAEIYARQGEEG*
Ga0126377_1187127713300010362Tropical Forest SoilTFTIGHMIQRVLVENWEAEKAVEEAHKKVVEIYARYQEG*
Ga0126377_1272248913300010362Tropical Forest SoilATYVIGHMLHRVLVESWEVEKAVEEAHKKVAEIYARHQEEG*
Ga0126377_1345946423300010362Tropical Forest SoilVIGRMLHRVLVENWEAEKAVEEAHKKVVEIYARYPQG*
Ga0136847_1194253713300010391Freshwater SedimentTFVIGRMMHRVLVENWNVEKAVVEAHKKVAEIYARHQAASGR*
Ga0126383_1143937013300010398Tropical Forest SoilLGTYTIGHMIQRVLVENWEAEKAVEEAHKKVAEIYARYQEA*
Ga0134127_1056836713300010399Terrestrial SoilSGEVLATYTIGRMMHRVLVESWNVEKAVVEAHKKAQDIYSRYQGA*
Ga0137391_1019582613300011270Vadose Zone SoilTFVIGHMMHRVLVESWEAEKAVEEAHKKVVEIYARYQEG*
Ga0137393_1081580113300011271Vadose Zone SoilIGHMMHRVLVESWEAEKAVVEAHKKVVEIYARYQEG*
Ga0137383_1014567513300012199Vadose Zone SoilTYVIGHMLHRVLVDTWEAEKAVEEAHKKVAAIYARYQEE*
Ga0137362_1142379013300012205Vadose Zone SoilSGEVLATYVIGHMMHRVLVENWEAEKAVEEAHKKAVEIYARYAEG*
Ga0137379_1127572123300012209Vadose Zone SoilATYVIGHMIQRVLVESWEAEKAVAEAHKKVAEIYARYQEE*
Ga0137378_1014043723300012210Vadose Zone SoilGEVMHTYVLGRMMHRVLVENWAAEKAVEEAHKKIVEIYARYQEA*
Ga0137377_1132246223300012211Vadose Zone SoilFSTYVIGRMMHRVLVENWEAEKAVEEAHKKVAEIYARHQEA*
Ga0137387_1090794623300012349Vadose Zone SoilLGTYTIGHMIQRVLVEHWEAEKAVEETHKQVAEIYARHAAG*
Ga0137387_1129759033300012349Vadose Zone SoilVGEVMHTYVIGRMMHRVLVENWESEKAVEEAHKKSVEIYARHQEV*
Ga0137386_1063292723300012351Vadose Zone SoilATYTIGHMLHRVLVENWEAEKAVEEAHKKVVEIYARYQEA*
Ga0137367_1075017333300012353Vadose Zone SoilVMHTYVLGRMMHRVLVENWEAEKAVEEAHKKTVEIYARHQEV*
Ga0137369_1021787713300012355Vadose Zone SoilSTYVMGRMMHRVLVENWEAEKAVEEAHKKVAEIYARHQEA*
Ga0137390_1161180423300012363Vadose Zone SoilVLATFVIGRMMHRVLVESWNVEKAVVEAHKKAAEIYARHQAG*
Ga0134043_129138713300012392Grasslands SoilRMMHRVLVENWEAEKAVEEAHKQVAEIYARHQEA*
Ga0137373_1027400613300012532Vadose Zone SoilMARMMHRVLVEHWEVEKAVEETHKQVAEIYARHAAG*
Ga0137397_1069688233300012685Vadose Zone SoilVLATYVIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARYQGA*
Ga0137395_1018304233300012917Vadose Zone SoilEVMHTYVRGRMMHRVLVESWEAEKAVEEAHKKIAEIYARHQEA*
Ga0137396_1107195313300012918Vadose Zone SoilIGRMMHRVLVESWNVEKAVVEAHRKVAEIYARYQGA*
Ga0137394_1072446633300012922Vadose Zone SoilAGEVLATYVIGRMMHRVLVESWNVEKAVEEAHKKVVEIYKRHQVG*
Ga0137394_1125187523300012922Vadose Zone SoilEVLATYVLGRMMHRVLVESWNAEKAVVEAHKKVAEIYARHQAA*
Ga0137404_1107224813300012929Vadose Zone SoilEVTGTYVMGRMIQRVLVEHWEAEKAVEEAHKKVVAMYARYPEG*
Ga0137410_1121612613300012944Vadose Zone SoilLGHMIQRVLVDNWEAEKAVEEAHKKVVEIYARYPEG*
Ga0126375_1174436123300012948Tropical Forest SoilTIGHMIQRVLVENWEAEKAVEEAHKKVVEIYARYPEA*
Ga0126369_1256723713300012971Tropical Forest SoilVLQRAVVLPHTLHRVLVENWEAAQAVEEAHKKAVEIYAHHQ
Ga0163162_1057351613300013306Switchgrass RhizosphereGEVLTTYVIGRMIQRVLVESWEVEKAVEEAHKQIAEIYARYQEA*
Ga0134075_1001612453300014154Grasslands SoilGEVLATYVIGRMMHRVLVESWNVEKAVVEAHKKVAEIYARHQAG*
Ga0137405_135878763300015053Vadose Zone SoilVLATFVIGRMMHRVLVESWNAEKAVVEAHKKVAEIYKRHQAG*
Ga0180079_102600213300015248SoilVLATYTIGRMMHRVLVESWPAEKAVEEAHKKAAEIYARYQKG*
Ga0182038_1138512113300016445SoilVGTTYVIARMMHRVLVEYWEAEKAVEETHKQVAEIYARHAAG
Ga0163161_1128466023300017792Switchgrass RhizosphereTFVIGRMMHRVLVESWNVEKAVEEAHKKVAEIYARHQA
Ga0184612_1040958913300018078Groundwater SedimentSHNPASGEVLATFVLGRMMHRVLVESWNVEKAVVEAHKKVAEIYARHQAG
Ga0066667_1031691513300018433Grasslands SoilEVLATYTIGHMLHRVLVENWEAEKAVEEAHKKVAEIYARYQEA
Ga0190268_1155939513300018466SoilAAGEVLATFTIGRMMHRVLVESWPAEKAVEEAHKKVATIYARYQGG
Ga0184645_100263223300019233Groundwater SedimentVGEVGTTYVMARMMHRVLVEHWEAEKAVEETHKQVAEIYARHAAG
Ga0180117_140399213300019248Groundwater SedimentMHTYVLGRMMHRVLVENWEVEKAVEEAHKKTVEIYARHQEA
Ga0184646_118201413300019259Groundwater SedimentVTNVISRMVHWVLVENWEAEKAVEEAHKKVVEIYARYAEG
Ga0194128_1015536823300020197Freshwater LakeVVATNVLARMMHRVLIENWEVEKAVEEAHKKVVEIYARAAQAG
Ga0209827_1108216613300025149Thermal SpringsVFATSVISRIMHRVLVENWAAEKAVEEAHKKVVEIYARQQQES
Ga0207684_1034595423300025910Corn, Switchgrass And Miscanthus RhizosphereATQVISRTMHRVLVENWEAEKAVEEAHKKAAEIYARHQVGSY
Ga0207646_1025366733300025922Corn, Switchgrass And Miscanthus RhizosphereTQVISRTMHRVLVENWEAEKAVEEAHKKAAEIYARHQVGS
Ga0207646_1026441943300025922Corn, Switchgrass And Miscanthus RhizosphereVFSTYVIGRMMHRVLVETWEAEKAVEEAHKKTAEIYARHQEG
Ga0209690_124651613300026524SoilLATFVIGRMMHRVLVESWNVEKAVVEAHQKVVEIYKRHQAG
Ga0256867_1024671723300026535SoilAGEIYATGVLARMMHRVLVDNVEAEKAVEEAHKNVVEIYARWPEG
Ga0209077_116574123300027675Freshwater SedimentVTTTMARMMHRVLVENWEAEKAVEDAHKKVVDIYARYPEG
Ga0209814_1015012813300027873Populus RhizosphereAGEVLATYVIGRMMHRVLVESWNVEKAVVEAHKKAQDIYNRYQGA
Ga0209465_1009851313300027874Tropical Forest SoilVIGRMIHRVLVEHWEAEKAVEEAHKKVVEIYARYQEA
Ga0209590_1040583123300027882Vadose Zone SoilMPRMMHRALVENLEAEKAVEEAHKKVVEIYAHNQEES
Ga0209382_1057168823300027909Populus RhizosphereAGEVLATSVLARMMHRVLVESWEAEPAVEEAHKKVVEIYARYPEG
Ga0209857_106014213300027957Groundwater SandSVMSRIMHRVLVENWEAEKAVEEAHKKAAEIYARHQKG
Ga0209853_102583813300027961Groundwater SandATFVIGRMMHRVLVESWDVEKAVVEAHKKVAEIYARHQKG
Ga0257175_101564113300028673SoilVLATFVIGRMMHRVLVESWNVEKAVVEAHKKAAEIYARHQAG
Ga0299907_1103722423300030006SoilEIYATGVLARMMHRVLVDNVEAEKAVEDAHKNVVEIYARWPEG
Ga0299907_1126889523300030006SoilLARMVQQVLVENREPEKAVEEAHKRVVEIYARYQEG
Ga0247648_108999823300030574SoilGNVLARMMQRVLVESWEAEKAVEEAHKKVVEIYARSDG
Ga0247651_1005438813300030608SoilTNVIARMMHHVLVENWEAEKAVEEAHKKAVEIYARHAAGG
Ga0308205_104805413300030830SoilLIGRMMHRVLVENWEAEKAVEEAHKKTVEIYARHQEA
Ga0308202_109889423300030902SoilYMLGRMMHRVLVENWEAEKAVEEAHKKTAEIYARHQEG
Ga0308204_1000611123300031092SoilASGEVLATYTIGRMLHRVLVENWEAERAVEEAHKKVVEIYARYQEA
Ga0308204_1002525723300031092SoilATNVLSHMVQRVLVENVAAEKAVEEAHKQVVEIYARFQG
Ga0308204_1018366423300031092SoilEVYATNVLARMTQRVLIENLEAEKAVEEAHKKVAEIYARYQEV
Ga0318515_1071020023300031572SoilVIGRMMHRVLVESWNVEKAVVEAHKKVADIYARYQGA
Ga0310900_1028823513300031908SoilVLATFTLGHMMHRVLVENWEAEKAVEEAHKKVVDIYARYQEA
Ga0310900_1099020513300031908SoilSSTYVIGRMMHRVLVENWEAEKAVEEAHKKIVEIYARHQEA
Ga0307471_10035613933300032180Hardwood Forest SoilGRMMHRVLVENWNVEKAVVEAHQKVAQVYARHAKG
Ga0307471_10228677833300032180Hardwood Forest SoilTYTIGRMMHRVLVESWNAEKAVVEAHKKVAEIYARHQKG
Ga0307472_10240878223300032205Hardwood Forest SoilTDVLAHMMHRVLVENWEAEKAVEEAHHQVVAIYARYPEG
Ga0314780_178834_408_5363300034659SoilVLATYTIGRMLHHVLVENWEAEKAVEEAHKKVVEIYARYPEG
Ga0314801_178557_21_1493300034676SoilVLATYTIGRMLQRVLVENWEAEKAVEEAHKKVVEIYARYPEG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.