NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055254

Metagenome / Metatranscriptome Family F055254

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055254
Family Type Metagenome / Metatranscriptome
Number of Sequences 139
Average Sequence Length 46 residues
Representative Sequence AMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Number of Associated Samples 113
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.72 %
% of genes near scaffold ends (potentially truncated) 95.68 %
% of genes from short scaffolds (< 2000 bps) 93.53 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (55.396 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(36.691 % of family members)
Environment Ontology (ENVO) Unclassified
(38.849 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.079 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 58.70%    Coil/Unstructured: 41.30%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF12697Abhydrolase_6 21.58
PF04909Amidohydro_2 10.07
PF00155Aminotran_1_2 5.04
PF08240ADH_N 2.16
PF01568Molydop_binding 2.16
PF03328HpcH_HpaI 1.44
PF05199GMC_oxred_C 1.44
PF12695Abhydrolase_5 1.44
PF02515CoA_transf_3 1.44
PF00118Cpn60_TCP1 0.72
PF00582Usp 0.72
PF01494FAD_binding_3 0.72
PF03237Terminase_6N 0.72
PF00884Sulfatase 0.72
PF00082Peptidase_S8 0.72
PF07859Abhydrolase_3 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 1.44
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.44
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 1.44
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 1.44
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 1.44
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 1.44
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.72
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.72
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.72
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.72
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A55.40 %
All OrganismsrootAll Organisms44.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035918004|FACENC_F56XM5W01CD0LFAll Organisms → cellular organisms → Bacteria → Proteobacteria505Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10140846Not Available501Open in IMG/M
3300004268|Ga0066398_10226177All Organisms → cellular organisms → Bacteria → Proteobacteria504Open in IMG/M
3300004635|Ga0062388_100353278All Organisms → cellular organisms → Bacteria → Proteobacteria1255Open in IMG/M
3300005184|Ga0066671_10063476All Organisms → cellular organisms → Bacteria → Proteobacteria1923Open in IMG/M
3300005290|Ga0065712_10661326Not Available563Open in IMG/M
3300005332|Ga0066388_106762098Not Available578Open in IMG/M
3300005363|Ga0008090_10037454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria822Open in IMG/M
3300005435|Ga0070714_100162156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2023Open in IMG/M
3300005436|Ga0070713_100439481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1224Open in IMG/M
3300005458|Ga0070681_11499401All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300005543|Ga0070672_100492170Not Available1060Open in IMG/M
3300005563|Ga0068855_101906421Not Available602Open in IMG/M
3300005576|Ga0066708_10394960All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300005764|Ga0066903_106229830Not Available623Open in IMG/M
3300005843|Ga0068860_100718394Not Available1009Open in IMG/M
3300006028|Ga0070717_11002221All Organisms → cellular organisms → Bacteria → Proteobacteria761Open in IMG/M
3300006032|Ga0066696_10738141All Organisms → cellular organisms → Bacteria → Proteobacteria631Open in IMG/M
3300006163|Ga0070715_10022140All Organisms → cellular organisms → Bacteria2474Open in IMG/M
3300006175|Ga0070712_100746984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → unclassified Aestuariivirga → Aestuariivirga sp. YIM B02566837Open in IMG/M
3300006578|Ga0074059_11946370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria677Open in IMG/M
3300006606|Ga0074062_10037932Not Available837Open in IMG/M
3300006854|Ga0075425_100588337All Organisms → cellular organisms → Bacteria → Proteobacteria1280Open in IMG/M
3300006904|Ga0075424_101421362All Organisms → cellular organisms → Bacteria → Proteobacteria737Open in IMG/M
3300006954|Ga0079219_10806105All Organisms → cellular organisms → Bacteria → Proteobacteria739Open in IMG/M
3300009093|Ga0105240_10680539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1125Open in IMG/M
3300009174|Ga0105241_12011120Not Available569Open in IMG/M
3300009545|Ga0105237_10691001Not Available1027Open in IMG/M
3300010042|Ga0126314_10464062Not Available917Open in IMG/M
3300010044|Ga0126310_11464895All Organisms → cellular organisms → Bacteria → Proteobacteria559Open in IMG/M
3300010046|Ga0126384_10333694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1258Open in IMG/M
3300010046|Ga0126384_11348820Not Available663Open in IMG/M
3300010341|Ga0074045_11058286Not Available508Open in IMG/M
3300010358|Ga0126370_11144714All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300010366|Ga0126379_10744494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → unclassified Aestuariivirga → Aestuariivirga sp. YIM B025661076Open in IMG/M
3300010366|Ga0126379_11600051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria757Open in IMG/M
3300010371|Ga0134125_11683368Not Available690Open in IMG/M
3300010373|Ga0134128_12259801Not Available599Open in IMG/M
3300010376|Ga0126381_100541973All Organisms → cellular organisms → Bacteria → Proteobacteria1647Open in IMG/M
3300010376|Ga0126381_102202341Not Available793Open in IMG/M
3300010376|Ga0126381_102403191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium756Open in IMG/M
3300010376|Ga0126381_103742021All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300010400|Ga0134122_12545754Not Available561Open in IMG/M
3300012986|Ga0164304_10719870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → unclassified Aestuariivirga → Aestuariivirga sp. YIM B02566760Open in IMG/M
3300014497|Ga0182008_10704151Not Available577Open in IMG/M
3300015372|Ga0132256_102129541All Organisms → cellular organisms → Bacteria → Proteobacteria666Open in IMG/M
3300015373|Ga0132257_102334447Not Available693Open in IMG/M
3300015374|Ga0132255_103530266Not Available665Open in IMG/M
3300016387|Ga0182040_10357278Not Available1134Open in IMG/M
3300016422|Ga0182039_10508631Not Available1041Open in IMG/M
3300016422|Ga0182039_11243145Not Available674Open in IMG/M
3300016445|Ga0182038_10063562All Organisms → cellular organisms → Bacteria2528Open in IMG/M
3300016445|Ga0182038_11891283All Organisms → cellular organisms → Bacteria → Proteobacteria539Open in IMG/M
3300017792|Ga0163161_10632506Not Available885Open in IMG/M
3300017959|Ga0187779_11117335Not Available551Open in IMG/M
3300017972|Ga0187781_10306971Not Available1126Open in IMG/M
3300017973|Ga0187780_11473212Not Available503Open in IMG/M
3300019362|Ga0173479_10616606Not Available570Open in IMG/M
3300019887|Ga0193729_1246727Not Available569Open in IMG/M
3300020581|Ga0210399_10429871Not Available1100Open in IMG/M
3300020583|Ga0210401_11523545Not Available526Open in IMG/M
3300021168|Ga0210406_11124990All Organisms → cellular organisms → Bacteria → Proteobacteria576Open in IMG/M
3300021171|Ga0210405_10411098Not Available1065Open in IMG/M
3300021171|Ga0210405_10600742Not Available857Open in IMG/M
3300021403|Ga0210397_10040453All Organisms → cellular organisms → Bacteria2951Open in IMG/M
3300021403|Ga0210397_11298162All Organisms → cellular organisms → Bacteria → Proteobacteria565Open in IMG/M
3300021404|Ga0210389_10374638All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300021406|Ga0210386_10535408Not Available1012Open in IMG/M
3300021420|Ga0210394_11159839All Organisms → cellular organisms → Bacteria → Proteobacteria664Open in IMG/M
3300021560|Ga0126371_11750440All Organisms → cellular organisms → Bacteria → Acidobacteria744Open in IMG/M
3300021560|Ga0126371_13133177Not Available559Open in IMG/M
3300021560|Ga0126371_13589116Not Available523Open in IMG/M
3300022525|Ga0242656_1122328Not Available528Open in IMG/M
3300022718|Ga0242675_1023587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp.885Open in IMG/M
3300025906|Ga0207699_10409736Not Available967Open in IMG/M
3300025917|Ga0207660_11018883Not Available675Open in IMG/M
3300025928|Ga0207700_10663976Not Available930Open in IMG/M
3300025928|Ga0207700_10733696Not Available882Open in IMG/M
3300025928|Ga0207700_11314158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales644Open in IMG/M
3300025939|Ga0207665_10331601Not Available1144Open in IMG/M
3300025961|Ga0207712_11322383Not Available644Open in IMG/M
3300026308|Ga0209265_1115532Not Available679Open in IMG/M
3300026550|Ga0209474_10250246All Organisms → cellular organisms → Bacteria → Proteobacteria1092Open in IMG/M
3300027109|Ga0208603_1061899All Organisms → cellular organisms → Bacteria → Proteobacteria562Open in IMG/M
3300027371|Ga0209418_1015356Not Available1248Open in IMG/M
3300027855|Ga0209693_10018289All Organisms → cellular organisms → Bacteria3354Open in IMG/M
3300028379|Ga0268266_10323554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_111444Open in IMG/M
3300029636|Ga0222749_10736871All Organisms → cellular organisms → Bacteria → Proteobacteria539Open in IMG/M
3300031543|Ga0318516_10016900All Organisms → cellular organisms → Bacteria3652Open in IMG/M
3300031544|Ga0318534_10388737Not Available802Open in IMG/M
3300031546|Ga0318538_10051586All Organisms → cellular organisms → Bacteria2011Open in IMG/M
3300031561|Ga0318528_10417652Not Available720Open in IMG/M
3300031561|Ga0318528_10614805Not Available582Open in IMG/M
3300031708|Ga0310686_103258966Not Available773Open in IMG/M
3300031723|Ga0318493_10184129Not Available1096Open in IMG/M
3300031723|Ga0318493_10307604Not Available856Open in IMG/M
3300031724|Ga0318500_10193324Not Available972Open in IMG/M
3300031744|Ga0306918_11295832Not Available560Open in IMG/M
3300031747|Ga0318502_10704295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium610Open in IMG/M
3300031753|Ga0307477_10313346Not Available1082Open in IMG/M
3300031764|Ga0318535_10548014Not Available513Open in IMG/M
3300031781|Ga0318547_10088184All Organisms → cellular organisms → Bacteria1751Open in IMG/M
3300031781|Ga0318547_10317419Not Available948Open in IMG/M
3300031794|Ga0318503_10082630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp.1009Open in IMG/M
3300031795|Ga0318557_10008360All Organisms → cellular organisms → Bacteria3688Open in IMG/M
3300031796|Ga0318576_10395270Not Available653Open in IMG/M
3300031797|Ga0318550_10095875Not Available1394Open in IMG/M
3300031797|Ga0318550_10390020Not Available674Open in IMG/M
3300031798|Ga0318523_10094061Not Available1465Open in IMG/M
3300031833|Ga0310917_10608090All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium742Open in IMG/M
3300031879|Ga0306919_10420484Not Available1026Open in IMG/M
3300031890|Ga0306925_10343016All Organisms → cellular organisms → Bacteria1604Open in IMG/M
3300031890|Ga0306925_10912619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium902Open in IMG/M
3300031897|Ga0318520_10712697Not Available627Open in IMG/M
3300031910|Ga0306923_10267721Not Available1954Open in IMG/M
3300031910|Ga0306923_10574142Not Available1268Open in IMG/M
3300031910|Ga0306923_11780402Not Available633Open in IMG/M
3300031912|Ga0306921_10312071All Organisms → cellular organisms → Bacteria → Proteobacteria1840Open in IMG/M
3300031912|Ga0306921_10587357Not Available1289Open in IMG/M
3300031912|Ga0306921_11059110All Organisms → cellular organisms → Bacteria → Proteobacteria911Open in IMG/M
3300031941|Ga0310912_10325186All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300031942|Ga0310916_10499996All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300031942|Ga0310916_10893187All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300031945|Ga0310913_10134969All Organisms → cellular organisms → Bacteria1695Open in IMG/M
3300031946|Ga0310910_10623742All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300032051|Ga0318532_10014597All Organisms → cellular organisms → Bacteria2471Open in IMG/M
3300032055|Ga0318575_10603272Not Available556Open in IMG/M
3300032059|Ga0318533_10255710Not Available1265Open in IMG/M
3300032063|Ga0318504_10038214Not Available1955Open in IMG/M
3300032064|Ga0318510_10275780All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300032076|Ga0306924_11629168Not Available679Open in IMG/M
3300032089|Ga0318525_10241472Not Available928Open in IMG/M
3300032091|Ga0318577_10516599Not Available569Open in IMG/M
3300032094|Ga0318540_10529511Not Available568Open in IMG/M
3300033289|Ga0310914_11343559Not Available617Open in IMG/M
3300033289|Ga0310914_11554057Not Available565Open in IMG/M
3300033290|Ga0318519_10103196All Organisms → cellular organisms → Bacteria → Proteobacteria1538Open in IMG/M
3300033290|Ga0318519_10356262Not Available865Open in IMG/M
3300033290|Ga0318519_10481127Not Available746Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil36.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.51%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.16%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.16%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.16%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.16%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.16%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.44%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.44%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.44%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.44%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.44%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.72%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.72%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.72%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.72%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2035918004Soil microbial communities from sample at FACE Site 2 North Carolina CO2-EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022525Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027109Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes)EnvironmentalOpen in IMG/M
3300027371Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACENCA_33675202035918004SoilTVTLSSFASGAMLSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
AF_2010_repII_A001DRAFT_1014084623300000793Forest SoilWIMVQIAVMPFVVVAGVAVLWWRHRDASATAMLRPAEPV*
Ga0066398_1022617713300004268Tropical Forest SoilGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV*
Ga0062388_10035327823300004635Bog Forest SoilSSFASGAMLSGAGWIMVQIAIVPFVVVAGVTVLWWRHRDASGTAMLRPAEPV*
Ga0066671_1006347633300005184SoilFASGAMLSGAGWITVQIAVMPFVVIAGIAVLWWRHRDANGTAMLRPAAPV*
Ga0065712_1066132633300005290Miscanthus RhizosphereFASGAMLSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDASGTAMLRPAEPM*
Ga0066388_10676209813300005332Tropical Forest SoilMLSGAGWILVQIAVMPFVVVAGAAVLWWRYRDANGTAILRPAEPM*
Ga0008090_1003745413300005363Tropical Rainforest SoilWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV*
Ga0070714_10016215633300005435Agricultural SoilMLSGAGWILVQIAVMPFVLVAGAAVLWWRYRDASGTAMLRPAEPV*
Ga0070713_10043948113300005436Corn, Switchgrass And Miscanthus RhizosphereAMLSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDASATAMLRPAEPV*
Ga0070681_1149940113300005458Corn RhizosphereMLSGAGWIMVQIAVMPFVMVAVAAVLWRRHCDARGSAMLHPAEPV*
Ga0070672_10049217023300005543Miscanthus RhizosphereLSGAGWIMVQIAVMPFVIVAGVAVLWWRYRDANGTAMLRPAEPV*
Ga0068855_10190642123300005563Corn RhizosphereMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV*
Ga0066708_1039496033300005576SoilMLSGAGWITVQIAVMPFVVIAGIAVLWWRHRDANGTAMLRPAAPV*
Ga0066903_10622983013300005764Tropical Forest SoilAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV*
Ga0068860_10071839423300005843Switchgrass RhizosphereGWIMVQIAVMPFVVVAGVAVLWWRHRDASGTAMLRPAEPV*
Ga0070717_1100222113300006028Corn, Switchgrass And Miscanthus RhizosphereSGAMLSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDASATAMLRPAEPV*
Ga0066696_1073814113300006032SoilMVQIVVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV*
Ga0070715_1002214033300006163Corn, Switchgrass And Miscanthus RhizosphereSFASGAMLSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDASGTAMLRPAEPV*
Ga0070712_10074698413300006175Corn, Switchgrass And Miscanthus RhizosphereWILVQIAVIPFVVVAGAAVLWWRYRDANGTAILRPAEPV*
Ga0074059_1194637023300006578SoilSGAGWIMVQIAVVPFVVVAGVAVLWWRHHDASGTAMLRPAEPV*
Ga0074062_1003793223300006606SoilVQIAVVPFVVVAGVAVLWWRHHDASGTAMLRPAEPV*
Ga0075425_10058833723300006854Populus RhizosphereSSFASGAMLSGAGWILVQIAVIPFVVVAGAAVLWWRYRDANGTAILRPAEPV*
Ga0075424_10142136213300006904Populus RhizosphereGWIMVQIAVVPFVVVAGAAVLWWRHRDASGTAMLRPAEPV*
Ga0079219_1080610523300006954Agricultural SoilSFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV*
Ga0105240_1068053913300009093Corn RhizosphereGWIMVQIAVMPFVVVAGVAVLWWRHRDASGTAMLRPAEPA*
Ga0105241_1201112033300009174Corn RhizosphereMVQIAVMPFVVVAVVAVLWWRQRNASGTAMLRPAEPV*
Ga0105237_1069100113300009545Corn RhizosphereIAVMPFVVVAGVAVLWWRHRDASATAMLRPAEPV*
Ga0126314_1046406213300010042Serpentine SoilLSSFPSGAMLSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDASGTAMLRPAEPM*
Ga0126310_1146489533300010044Serpentine SoilVQIAVMPFVVVAGVAVLWWRQRDASGTAMLRPAEPV*
Ga0126384_1033369413300010046Tropical Forest SoilMLSGAGWILVQIAVMPFVVVAGAAVLWWRYRDANGTAILRPAEPV*
Ga0126384_1134882023300010046Tropical Forest SoilASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASDTAMLRPAEPV*
Ga0074045_1105828613300010341Bog Forest SoilLSSFASGAMLSGAGWIMVQIAVIPFVVVAGVAVLWWRHRDASGTAMLRPAEPV*
Ga0126370_1114471413300010358Tropical Forest SoilAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRSAEPV*
Ga0126379_1074449423300010366Tropical Forest SoilVLVRLGAMLSGAGWILVQIAVMPFVMVAGAAVLWWRYRNASGTAMLRPAEPV*
Ga0126379_1160005123300010366Tropical Forest SoilVTLSSFASGAMLSGAGWIMVQIAVVPFVGVAGVAVLWWRHRDASGTAMLRPAEPV*
Ga0134125_1168336813300010371Terrestrial SoilMLSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDASGTAMLRPAEPV*
Ga0134128_1225980123300010373Terrestrial SoilWMMVQIAVVPFVVVAGLAVLWWRHRDARGTAMLRPAEPV*
Ga0126381_10054197313300010376Tropical Forest SoilLSGAGWIIVQIAVMPFVVVAGVAVLWWRHRDASGTAMLRPAEPV*
Ga0126381_10220234123300010376Tropical Forest SoilVTLSSFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPA*
Ga0126381_10240319123300010376Tropical Forest SoilMLSGAGWIMVQIAVVPFVLVAGVAVLWWRHRDASSTAMLRPAEPV*
Ga0126381_10374202113300010376Tropical Forest SoilSGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV*
Ga0134122_1254575413300010400Terrestrial SoilGAGWIMVQIAVMPFVMVAGVAVLWWRYHDANGTAMLRTAEPV*
Ga0164304_1071987013300012986SoilIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV*
Ga0182008_1070415123300014497RhizosphereGAMLSGAGWILVQIAVIPFVVVAGAAVLWWRYRDANGTAILRPAEPV*
Ga0132256_10212954123300015372Arabidopsis RhizosphereLSGAGWIMVQIAVLPFVVVAGVAVLWWRHRDASGTAMLRPAEPV*
Ga0132257_10233444713300015373Arabidopsis RhizosphereQIEVTPFVVVAGVAVLWWRHRDASGTAMLRPSEPV*
Ga0132255_10353026623300015374Arabidopsis RhizosphereVTLSSFASGAMLSGAGWMMVQIAVMPFVVVAGLAVLWWRHRDANGTAMLRPAEPV*
Ga0182040_1035727813300016387SoilSFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASATAILRPAEPV
Ga0182039_1050863123300016422SoilSGAMLSGAGWIVVRIAVVPFVVVAVAAVLWWRHRDASGTAMLRPAEPV
Ga0182039_1124314513300016422SoilTVTLSSFASGAMLSGAGWIMVQIAVVPFVVVAGGAVLWWCHRDASGTAILRPVEPV
Ga0182038_1006356213300016445SoilTLSSFASGAMLSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDPSATAMLRPAEPV
Ga0182038_1189128323300016445SoilSFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHHDASGTAMLRPAEPV
Ga0163161_1063250623300017792Switchgrass RhizosphereAMLSGAGWIMVQIAVMPFVVAAGVAVLWWRHRDASGTAMLRPAEPV
Ga0187779_1111733523300017959Tropical PeatlandSSFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASATAMLRPAEPV
Ga0187781_1030697123300017972Tropical PeatlandIMVQIAVMPFVVVAGVAVLWWRHRDASATAMLRPAEPV
Ga0187780_1147321223300017973Tropical PeatlandFGTVTLSSFASGAMLSGAGWIMVQIAVVPFVVVAGGTVLWWRHRDASGTAMLRPAAPG
Ga0173479_1061660623300019362SoilAMLSGAGWIMVQIAVMPFVVVAAVAVLWWRYRDANGTAMLRPAEPV
Ga0193729_124672713300019887SoilAMLSGAGWIMVQIAVMPFVVVAGVAVLWWRYRDANGTAMLRPAEPG
Ga0210399_1042987123300020581SoilSSFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0210401_1152354513300020583SoilASGAMLSGAGWIMVQIAVVPFVVVAGVVVLWWRHRDASGTAMLRPAEPV
Ga0210406_1112499023300021168SoilGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0210405_1041109813300021171SoilSSFASGAMLSDAGWIMVQIAVVPFVVVAGATVLWWGHRNASGTALLRPAEPV
Ga0210405_1060074213300021171SoilLSSFASGAMLSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDASATAMLRPAEPV
Ga0210397_1004045313300021403SoilMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0210397_1129816213300021403SoilSGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0210389_1037463843300021404SoilGAMLSGAGWIMVQIAVVPFVVVAGATVLWWGHRNASGTALLRPAEPV
Ga0210386_1053540833300021406SoilSFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0210394_1115983913300021420SoilTLSSFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0126371_1175044013300021560Tropical Forest SoilMVQIAVVPFVVVAGVAVLWWRHRDASATALLRPAEPV
Ga0126371_1313317723300021560Tropical Forest SoilWGTGGIMEQIAVMRLLGVAGGAVLWWRHRDASGTAMLRPAEPV
Ga0126371_1358911613300021560Tropical Forest SoilLSSFASGAMLSGAGWIMVQIAVMPFVVVAGVVMLWWRHRDASGTAMLRPAEPV
Ga0242656_112232823300022525SoilAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0242675_102358723300022718SoilTVTLSSFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0207699_1040973623300025906Corn, Switchgrass And Miscanthus RhizosphereVQIAVMPFVVVAGVAVLWWRHRDASATAMLRPAEPV
Ga0207660_1101888323300025917Corn RhizosphereMLSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDASGTAMLRPAERV
Ga0207700_1066397623300025928Corn, Switchgrass And Miscanthus RhizosphereSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0207700_1073369613300025928Corn, Switchgrass And Miscanthus RhizosphereGAGWIMVQIAVMPFVVVAGVAVLWWRHRDASATAMLRPAEPV
Ga0207700_1131415813300025928Corn, Switchgrass And Miscanthus RhizosphereTVTLSSFASGAMLSGAGWIMVQVAVIPFVVIAGVAVLWWRHRDASSTATLRSAEPL
Ga0207665_1033160123300025939Corn, Switchgrass And Miscanthus RhizosphereTLSSFASGAMLSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDASATAMLRPAEPV
Ga0207712_1132238313300025961Switchgrass RhizosphereSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDASATAMLRPAEPV
Ga0209265_111553213300026308SoilGTVTLSSFASGAMLSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDASATAMLRPAEPV
Ga0209474_1025024623300026550SoilMVQIVVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0208603_106189913300027109Forest SoilGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0209418_101535613300027371Forest SoilSSFASGAMLSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDASATAMLRPAEPV
Ga0209693_1001828913300027855SoilGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0268266_1032355413300028379Switchgrass RhizosphereIMVQIAVMPFVVVAGVAVLWWRHRDASGTAMLRPAEPM
Ga0222749_1073687123300029636SoilGWIMVQVAVIPFVVIAGVAVLWWRHRDASGTAMLRPAEPV
Ga0318516_1001690013300031543SoilVTLSSFASGAMLSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDPSATAMLRPAEPV
Ga0318534_1038873723300031544SoilFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0318538_1005158633300031546SoilLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASATAILRPAEPV
Ga0318528_1041765213300031561SoilTFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0318528_1061480513300031561SoilSSFASGAMLSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDPSATAMLRPAEPV
Ga0310686_10325896623300031708SoilWIMVQIAVVPFVLIAGVTVLWWRHRDASGTAMLRPAEPV
Ga0318493_1018412913300031723SoilLSSFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASATAMLRPAEPV
Ga0318493_1030760423300031723SoilTFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPL
Ga0318500_1019332413300031724SoilSGAMLSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDASATAMLRPAEPV
Ga0306918_1129583233300031744SoilAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTALLRPAEPV
Ga0318502_1070429523300031747SoilVTLSSFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRNRDASGAAMLRPAAEPL
Ga0307477_1031334623300031753Hardwood Forest SoilSSFASGAMVSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0318535_1054801423300031764SoilASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASATAILRPAEPV
Ga0318547_1008818443300031781SoilGWIMVQIAVVPFVVVAGVAVLWWRNRDASGAAMLRPAAEPL
Ga0318547_1031741923300031781SoilLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0318503_1008263023300031794SoilIMVQIAVVPFVVVAGVAVLWWRHHDASGTAMLRPAEPV
Ga0318557_1000836043300031795SoilSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASATAILRPAEPV
Ga0318576_1039527013300031796SoilGWIMVQIAVMPFVLVAGAAVLWWRHRDASGTAMLRPAEPV
Ga0318550_1009587513300031797SoilVTLSTFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPL
Ga0318550_1039002013300031797SoilAGWIMVQIAVMPFVVVAGVAVLWWRHRDASATAMLRPAEPV
Ga0318523_1009406143300031798SoilMLSGAGWIMVQIAVVPFVVVAGVAVLWWRNRDASGAAMLRPAAEPL
Ga0310917_1060809013300031833SoilMLSGAGWIMVQIAVVPFVVIAGVAVLWWRHRDASGTAMLRPAEPV
Ga0306919_1042048423300031879SoilQIAVMPFVVVAGVAVLWWRHRDPSATAMLRPAEPV
Ga0306925_1034301643300031890SoilGAGWIMVQIAVVPFVVVAGVAVLWWRNRDASGAAMLRPAEPL
Ga0306925_1091261923300031890SoilSFASGAMLSGAGWIMVQIVVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0318520_1071269723300031897SoilGWIMVQIVVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0306923_1026772113300031910SoilMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0306923_1057414223300031910SoilMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASATAILRPAEPV
Ga0306923_1178040213300031910SoilSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAILRPVEPV
Ga0306921_1031207113300031912SoilFASGAMLSGAGWIMVQIAVVPFVLVAGVAVLWWRHRDASGAAMLRPAEPV
Ga0306921_1058735733300031912SoilFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTALLRPAEPV
Ga0306921_1105911013300031912SoilTVTLSSFASGAMLSGAGWIMVQIVVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0310912_1032518613300031941SoilGAMLSGAGWIMVQIAVMPFVLVAGAAVLWWRHRDASGTAMLRPAEPV
Ga0310916_1049999623300031942SoilWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0310916_1089318723300031942SoilSSFASGAMLSGAGWITVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0310913_1013496933300031945SoilSGAGWIMVQIAVVPFVVVAGVAVLWWRNRDASGAAMLRPAEPL
Ga0310910_1062374223300031946SoilFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPL
Ga0318532_1001459713300032051SoilSGAGWIMVQIAVMPFVVVAGVAVLWWRHRDPSATAMLRPAEPV
Ga0318575_1060327223300032055SoilTVTLSSFASGAMLSGAGWIMAQIVVVPFVVVAGVAVLWWRHRDASGTAMLRAAEPV
Ga0318533_1025571053300032059SoilVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0318504_1003821413300032063SoilTVTLSSFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASATAILRPAEPV
Ga0318510_1027578013300032064SoilVTLSSFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0306924_1162916823300032076SoilVTLSSFASGAMLSGAGWIMVQIAVVPFVVVAGGAVLWWRHRDASGTAILRPVEPV
Ga0318525_1024147223300032089SoilIMVQIAVVPFVVVAGVAVLWWRHRDASATAILRPAEPV
Ga0318577_1051659923300032091SoilMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPVEPV
Ga0318540_1052951123300032094SoilGTVTLSSFASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV
Ga0310914_1134355923300033289SoilSGAMLSGAGWIMVQIAVVPFVVIAGVAVLWWRHRDASGTAMLRPAEPV
Ga0310914_1155405723300033289SoilGTVTLSSFASGAMLTGAGWIMVQIAVVPFVVVAGGAVLWWRHRDASGTAMLRPVEPV
Ga0318519_1010319613300033290SoilAGWIMVQIAVVPFVVGAVAAVLWWRHRDASGTAMLRPAEPV
Ga0318519_1035626213300033290SoilIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPL
Ga0318519_1048112713300033290SoilSSLASGAMLSGAGWIMVQIAVVPFVVVAGVAVLWWRHRDASGTAMLRPAEPV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.