NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055226

Metagenome / Metatranscriptome Family F055226

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055226
Family Type Metagenome / Metatranscriptome
Number of Sequences 139
Average Sequence Length 48 residues
Representative Sequence GAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Number of Associated Samples 119
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.56 %
% of genes from short scaffolds (< 2000 bps) 87.77 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.417 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(23.741 % of family members)
Environment Ontology (ENVO) Unclassified
(18.705 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.288 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.32%    β-sheet: 0.00%    Coil/Unstructured: 50.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF00155Aminotran_1_2 30.22
PF08837DUF1810 10.07
PF01243Putative_PNPOx 6.47
PF00583Acetyltransf_1 5.04
PF02566OsmC 2.16
PF02467Whib 2.16
PF09350DJC28_CD 1.44
PF13411MerR_1 1.44
PF07690MFS_1 1.44
PF01494FAD_binding_3 1.44
PF01979Amidohydro_1 1.44
PF10604Polyketide_cyc2 0.72
PF01047MarR 0.72
PF08240ADH_N 0.72
PF03486HI0933_like 0.72
PF03176MMPL 0.72
PF01323DSBA 0.72
PF13594Obsolete Pfam Family 0.72
PF04542Sigma70_r2 0.72
PF00107ADH_zinc_N 0.72
PF08281Sigma70_r4_2 0.72
PF00390malic 0.72
PF03583LIP 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG5579Uncharacterized conserved protein, DUF1810 familyFunction unknown [S] 10.07
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 4.32
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 2.16
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 2.16
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 2.16
COG0493NADPH-dependent glutamate synthase beta chain or related oxidoreductaseAmino acid transport and metabolism [E] 1.44
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.44
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 1.44
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.72
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.72
COG3634Alkyl hydroperoxide reductase subunit AhpFDefense mechanisms [V] 0.72
COG2509FAD-dependent dehydrogenaseGeneral function prediction only [R] 0.72
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.72
COG2081Predicted flavoprotein YhiNGeneral function prediction only [R] 0.72
COG2072Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcDInorganic ion transport and metabolism [P] 0.72
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.72
COG1249Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductaseEnergy production and conversion [C] 0.72
COG0029Aspartate oxidaseCoenzyme transport and metabolism [H] 0.72
COG1053Succinate dehydrogenase/fumarate reductase, flavoprotein subunitEnergy production and conversion [C] 0.72
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.72
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.72
COG0492Thioredoxin reductasePosttranslational modification, protein turnover, chaperones [O] 0.72
COG0446NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductaseLipid transport and metabolism [I] 0.72
COG0281Malic enzymeEnergy production and conversion [C] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.42 %
UnclassifiedrootN/A21.58 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q01BWT75Not Available521Open in IMG/M
2170459023|GZGNO2B01DZMEWNot Available517Open in IMG/M
2189573003|GZIR7W401EHA9LNot Available502Open in IMG/M
3300001593|JGI12635J15846_10438376Not Available781Open in IMG/M
3300003219|JGI26341J46601_10106084Not Available815Open in IMG/M
3300003368|JGI26340J50214_10000976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9662Open in IMG/M
3300005367|Ga0070667_100239794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1619Open in IMG/M
3300005435|Ga0070714_101315810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia705Open in IMG/M
3300005455|Ga0070663_100120587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1980Open in IMG/M
3300005457|Ga0070662_101175966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia659Open in IMG/M
3300005459|Ga0068867_101431440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia642Open in IMG/M
3300005537|Ga0070730_10478418All Organisms → cellular organisms → Bacteria → Terrabacteria group801Open in IMG/M
3300005554|Ga0066661_10293553All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300006028|Ga0070717_11435182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia626Open in IMG/M
3300006052|Ga0075029_100214964Not Available1204Open in IMG/M
3300006163|Ga0070715_10754118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae586Open in IMG/M
3300006605|Ga0074057_12268826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia791Open in IMG/M
3300009162|Ga0075423_10928662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia923Open in IMG/M
3300009545|Ga0105237_11792963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300009700|Ga0116217_10035619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3738Open in IMG/M
3300009700|Ga0116217_10739513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia607Open in IMG/M
3300009824|Ga0116219_10460353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria706Open in IMG/M
3300009824|Ga0116219_10826902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300010333|Ga0134080_10421515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae621Open in IMG/M
3300010359|Ga0126376_13108338Not Available513Open in IMG/M
3300010379|Ga0136449_100159166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4404Open in IMG/M
3300010379|Ga0136449_100965169All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300010379|Ga0136449_101437505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1061Open in IMG/M
3300010379|Ga0136449_102509195All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300010403|Ga0134123_10023473All Organisms → cellular organisms → Bacteria4400Open in IMG/M
3300012189|Ga0137388_10164331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1977Open in IMG/M
3300012200|Ga0137382_10283127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1154Open in IMG/M
3300012206|Ga0137380_10423757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1179Open in IMG/M
3300012207|Ga0137381_10359755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1269Open in IMG/M
3300012207|Ga0137381_10386781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1220Open in IMG/M
3300012209|Ga0137379_11325628Not Available625Open in IMG/M
3300012210|Ga0137378_11028096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia738Open in IMG/M
3300012349|Ga0137387_11025876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
3300012685|Ga0137397_10682540All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300012958|Ga0164299_11186911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia576Open in IMG/M
3300012975|Ga0134110_10344717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia651Open in IMG/M
3300013105|Ga0157369_11821335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia618Open in IMG/M
3300013296|Ga0157374_12700399Not Available524Open in IMG/M
3300014165|Ga0181523_10113700Not Available1617Open in IMG/M
3300014495|Ga0182015_10555553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia731Open in IMG/M
3300015357|Ga0134072_10384052Not Available549Open in IMG/M
3300016404|Ga0182037_11906135Not Available532Open in IMG/M
3300016422|Ga0182039_10973203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300016445|Ga0182038_11117246Not Available701Open in IMG/M
3300017946|Ga0187879_10112429All Organisms → cellular organisms → Bacteria1556Open in IMG/M
3300017972|Ga0187781_10990965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia614Open in IMG/M
3300017975|Ga0187782_10863985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia701Open in IMG/M
3300018034|Ga0187863_10331502Not Available846Open in IMG/M
3300018037|Ga0187883_10320468All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300018037|Ga0187883_10320951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia791Open in IMG/M
3300018044|Ga0187890_10309791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria886Open in IMG/M
3300018044|Ga0187890_10488988Not Available692Open in IMG/M
3300020140|Ga0179590_1055773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1025Open in IMG/M
3300021363|Ga0193699_10343280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia622Open in IMG/M
3300021401|Ga0210393_11276154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia590Open in IMG/M
3300021402|Ga0210385_10105046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1976Open in IMG/M
3300021433|Ga0210391_10725249Not Available778Open in IMG/M
3300021478|Ga0210402_10469803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1168Open in IMG/M
3300024222|Ga0247691_1004609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2420Open in IMG/M
3300024225|Ga0224572_1071910Not Available639Open in IMG/M
3300024254|Ga0247661_1112810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia518Open in IMG/M
3300025134|Ga0207416_1110229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria973Open in IMG/M
3300025898|Ga0207692_10940845Not Available569Open in IMG/M
3300025911|Ga0207654_10511932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia849Open in IMG/M
3300025915|Ga0207693_10357428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1143Open in IMG/M
3300025922|Ga0207646_11207067All Organisms → cellular organisms → Bacteria → Terrabacteria group663Open in IMG/M
3300025929|Ga0207664_10959255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia767Open in IMG/M
3300025937|Ga0207669_11130843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae662Open in IMG/M
3300025944|Ga0207661_11811985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300027824|Ga0209040_10005316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9566Open in IMG/M
3300027824|Ga0209040_10058356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2298Open in IMG/M
3300028773|Ga0302234_10305417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300028781|Ga0302223_10306662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae525Open in IMG/M
3300028789|Ga0302232_10316878All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300028808|Ga0302228_10313598All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300028877|Ga0302235_10135552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1104Open in IMG/M
3300028877|Ga0302235_10140512All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300028877|Ga0302235_10174929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria952Open in IMG/M
3300028879|Ga0302229_10270641Not Available766Open in IMG/M
3300029882|Ga0311368_10224902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1468Open in IMG/M
3300029951|Ga0311371_10458616All Organisms → cellular organisms → Bacteria1702Open in IMG/M
3300029951|Ga0311371_10843106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1120Open in IMG/M
3300030007|Ga0311338_10115629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3289Open in IMG/M
3300030007|Ga0311338_12062781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300030013|Ga0302178_10163954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1092Open in IMG/M
3300030053|Ga0302177_10173428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1202Open in IMG/M
3300030053|Ga0302177_10353825All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300030056|Ga0302181_10195559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria939Open in IMG/M
3300030056|Ga0302181_10425270All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300030057|Ga0302176_10019643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2551Open in IMG/M
3300030399|Ga0311353_10289013All Organisms → cellular organisms → Bacteria1506Open in IMG/M
3300030490|Ga0302184_10007797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6348Open in IMG/M
3300030520|Ga0311372_10485167All Organisms → cellular organisms → Bacteria1823Open in IMG/M
3300030520|Ga0311372_10613414All Organisms → cellular organisms → Bacteria1550Open in IMG/M
3300030580|Ga0311355_10877864All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300030617|Ga0311356_10787839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria903Open in IMG/M
3300030739|Ga0302311_10423013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria932Open in IMG/M
3300031027|Ga0302308_10365999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria873Open in IMG/M
3300031028|Ga0302180_10457143Not Available631Open in IMG/M
3300031233|Ga0302307_10424053Not Available676Open in IMG/M
3300031233|Ga0302307_10699731All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300031234|Ga0302325_10042093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9216Open in IMG/M
3300031236|Ga0302324_100132470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4132Open in IMG/M
3300031236|Ga0302324_101068399All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300031545|Ga0318541_10404599All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300031723|Ga0318493_10214122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1020Open in IMG/M
3300031748|Ga0318492_10357977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia764Open in IMG/M
3300031751|Ga0318494_10587103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia651Open in IMG/M
3300031779|Ga0318566_10124021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1275Open in IMG/M
3300031819|Ga0318568_10336181All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300031833|Ga0310917_10892612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia598Open in IMG/M
3300031845|Ga0318511_10170634All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300031846|Ga0318512_10099689All Organisms → cellular organisms → Bacteria1364Open in IMG/M
3300031912|Ga0306921_11485750Not Available741Open in IMG/M
3300031938|Ga0308175_102756286Not Available549Open in IMG/M
3300031942|Ga0310916_11338698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia588Open in IMG/M
3300031954|Ga0306926_11057677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia962Open in IMG/M
3300031954|Ga0306926_12675045Not Available542Open in IMG/M
3300032001|Ga0306922_10106493All Organisms → cellular organisms → Bacteria2970Open in IMG/M
3300032008|Ga0318562_10591278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia641Open in IMG/M
3300032044|Ga0318558_10509770Not Available600Open in IMG/M
3300032044|Ga0318558_10639243Not Available532Open in IMG/M
3300032059|Ga0318533_11206068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → unclassified Streptomycetaceae → Streptomycetaceae bacterium554Open in IMG/M
3300032060|Ga0318505_10144978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1098Open in IMG/M
3300032074|Ga0308173_10904993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia816Open in IMG/M
3300032076|Ga0306924_12552797Not Available511Open in IMG/M
3300032090|Ga0318518_10046806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2043Open in IMG/M
3300032828|Ga0335080_11888503Not Available581Open in IMG/M
3300032829|Ga0335070_10088461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3274Open in IMG/M
3300032897|Ga0335071_10482276All Organisms → cellular organisms → Bacteria1193Open in IMG/M
3300033158|Ga0335077_10424867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1422Open in IMG/M
3300034820|Ga0373959_0056803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia858Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa23.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.83%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.19%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.76%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.32%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.32%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.44%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil1.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.44%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.44%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.72%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.72%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.72%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.72%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.72%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.72%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.72%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.72%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.72%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.72%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.72%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459023Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)EnvironmentalOpen in IMG/M
2189573003Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300003219Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3EnvironmentalOpen in IMG/M
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024222Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32EnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300025134Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_120679102170459005Grass SoilAGTGQDPDFWVVEAVEALGAAGQAADMMTAALAQAGKTTGELRPAR
FA3_113836302170459023Grass SoilDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
FE2_044925602189573003Grass SoilDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
JGI12635J15846_1043837623300001593Forest SoilGEAIEALASAGQAADMMTAALAQARRTSGELRPAR*
JGI26341J46601_1010608413300003219Bog Forest SoilEEGQITQDRGQDPDFWVVEVVQALADAGQAADMMTAALTQARRTSAELRSPR*
JGI26340J50214_1000097613300003368Bog Forest SoilLVVQREEGQITQDRGQDPDFWVVEVVQALADAGQAADMMTAALTQARRTSAELRSPR*
Ga0070667_10023979413300005367Switchgrass RhizosphereAAGAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0070714_10131581023300005435Agricultural SoilREESQLAAGAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0070663_10012058733300005455Corn RhizosphereQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0070662_10117596613300005457Corn RhizosphereGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0068867_10143144023300005459Miscanthus RhizosphereLARILVVQREESQLAAGAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0070730_1047841813300005537Surface SoilRLTADTGHDPDFWVVEAVEALAAAGRAADMMAAALGQAGQTAGELRPAR*
Ga0066661_1029355323300005554SoilQLTAGTGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0070717_1143518223300006028Corn, Switchgrass And Miscanthus RhizosphereEESQLTAGTGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0075029_10021496413300006052WatershedsGQDPDFWVVEVVEALAAAGQAADMMTAALTQARMTSAELRPAR*
Ga0070715_1075411813300006163Corn, Switchgrass And Miscanthus RhizosphereEESQLAAGAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0074057_1226882623300006605SoilEDGQVAAGTGQDPDFWVVEAVEALGAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0075423_1092866213300009162Populus RhizosphereQLAAGAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGRTAGELRPAR*
Ga0105237_1179296313300009545Corn RhizosphereFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0116217_1003561913300009700Peatlands SoilPGQDPDFWVVEAVQALAAAGQAADMMTAALTQARRTSAELRSAG*
Ga0116217_1073951313300009700Peatlands SoilWVVEAVQALAAAGQAADMMTAALNQARRTSAELRPAG*
Ga0116219_1046035313300009824Peatlands SoilDFWVVEAVQALAAAGQAADMMTAALSQARRTSAELRPAG*
Ga0116219_1082690213300009824Peatlands SoilTQGPGQDPDFWVVEAVQALAAAGQAADMMTAALTQARRTSAELRSAR*
Ga0126318_1045731423300010152SoilVEALAAAGQAADMLTAALAEAGKTSAELRPRSAGR*
Ga0134080_1042151513300010333Grasslands SoilGQLAAGTGQDPDFWVVEAVEALAAAGQAADMMTASLAQAGKTAGELRPAR*
Ga0126376_1310833823300010359Tropical Forest SoilARILVVQREESQLVAGAGQDPDFWMVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0136449_10015916613300010379Peatlands SoilEAVQALAAAGQAADMMTAALNQARRTSAELRPAG*
Ga0136449_10096516913300010379Peatlands SoilGQITQSPGQDPDFWVVEAVQALAAAGQAADMMTAALTQARTTSAELRSAG*
Ga0136449_10143750513300010379Peatlands SoilTSGPGRDPDFWVAEAVETLAAAGQAADMLAASLSQAGKISAELRSSP*
Ga0136449_10250919533300010379Peatlands SoilPDFWVVEAVQALAAAGQAADMMTAALTQARRTSAELRSAG*
Ga0134123_1002347363300010403Terrestrial SoilVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0137388_1016433113300012189Vadose Zone SoilRDPDFWVVEVVEALAAAGQAADMMTAALTQAGRTSAELSPAR*
Ga0137382_1028312713300012200Vadose Zone SoilDFWVVEAVEALGAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0137380_1042375713300012206Vadose Zone SoilGAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0137381_1035975513300012207Vadose Zone SoilQLARILVVQREESQLAAGAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0137381_1038678123300012207Vadose Zone SoilVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0137379_1132562823300012209Vadose Zone SoilDPDFWVVEAVEALAQAGQAADMMTAALAQAGKTAGELRPAR*
Ga0137378_1102809613300012210Vadose Zone SoilEEGQVAAGAGQDPDFWVVEAVEALAAAGQAADMMTAALTQAGKTAGELRPAR*
Ga0137387_1102587623300012349Vadose Zone SoilAGTGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0137397_1068254013300012685Vadose Zone SoilLARILVVQREENQLTAGTGQDPDFWVVEAVEALGAAGQAADMMTAALAQAGKTTGELRPAR*
Ga0164299_1118691123300012958SoilRLAADAGQDLDFWVVEAVEALAAAGRAADMMTAALAQAGKTAGELRRAR*
Ga0134110_1034471723300012975Grasslands SoilREDGRLAAGTGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPSR*
Ga0157369_1182133523300013105Corn RhizosphereEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0157374_1270039913300013296Miscanthus RhizosphereQLAAGAGQDPDFWVVEVVEALAAAGQAADMMTAALAQAGKTAGELRPAR*
Ga0181523_1011370013300014165BogEVVQALADAGRAADMMTAALTQARRTSAELRSPR*
Ga0182015_1055555323300014495PalsaGQITPGPGQDPDFWVVEAVEALAAATQAADMMTAALTQACKTSAELRPAR*
Ga0134072_1038405213300015357Grasslands SoilRILVVQREDGRLAAGTGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPSR*
Ga0182037_1190613513300016404SoilAQREEGQFGAGAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0182039_1097320323300016422SoilPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0182038_1111724613300016445SoilDFWVVEAVEALAAAGQAADMMTAALGQAGKTSGELRSAR
Ga0187879_1011242913300017946PeatlandQIAPGSGQDPDFWVVEVVEALAAAGQAADMMTAALNQAGKTSAELRPAR
Ga0187781_1099096523300017972Tropical PeatlandAGPGQDPDFWVAEAVESLAAAGQAADMLTAALAQAGKTSAELRSW
Ga0187782_1086398523300017975Tropical PeatlandTPGPAQDPDFWVAEAVEALGAAGQAADMLAATLSQAGKISAELRSS
Ga0187863_1033150223300018034PeatlandWVVEVVEALAAAGQAADMMTAALNQAGQTSAELRSA
Ga0187883_1032046813300018037PeatlandQREEGQIAPGSGQDPDFWVVEVVEALAAAGQAADMMTAALNQAGKTSAELRPAR
Ga0187883_1032095123300018037PeatlandGAGQDPDFWIVEAVEALAAAGRAADMMTAALSQAGKTAGELRPAR
Ga0187890_1030979133300018044PeatlandQDPDFWVVEVVEALAAAGQAADMMTAALNQAGKTSAELKSPR
Ga0187890_1048898823300018044PeatlandSDPDFWVVEVVEALAAAGQAADMMTAALNQAGKTSAELRPAR
Ga0179590_105577323300020140Vadose Zone SoilLVVQREENQLTAGTGQDPDFWVVEAVEALGAAGQAADMMTAALAQAGKTAGELRPAR
Ga0193699_1034328013300021363SoilVVEAVEAPAAAGQAADMMTAALAQAGKTAGELKPGR
Ga0210393_1127615413300021401SoilGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0210385_1010504613300021402SoilQIAPGPGRNPDFWVREAVEALDAAGQAADMMTAALVQADRTSGELRPAR
Ga0210391_1072524913300021433SoilFWVVEAVQALAAAGQAADMMTAALTQARKTSAELRPAR
Ga0210402_1046980323300021478SoilGQLGAAAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPTR
Ga0247691_100460933300024222SoilVVQREESQLAAGAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0224572_107191023300024225RhizosphereIAPGSGQDPDFWVVEVVEALAAAGQAADMMTAALNQAGKTAAELKPAR
Ga0247661_111281013300024254SoilFWVVEAVEALAAAGRAADMMTAALAQAGKTAGELRRAR
Ga0207416_111022913300025134Iron-Sulfur Acid SpringREDGHPGPDPEFWVIDAVEALAAAGQAADMMAAALAQAGQTPSELRPLS
Ga0207692_1094084513300025898Corn, Switchgrass And Miscanthus RhizosphereEESELAAGAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0207684_1022583113300025910Corn, Switchgrass And Miscanthus RhizosphereHPGPDAEFWVTDAVEALAAAGQAADMMTAALTQAGQAPSELRRSS
Ga0207654_1051193213300025911Corn RhizosphereRILVVQREESQLAAGAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0207693_1035742823300025915Corn, Switchgrass And Miscanthus RhizosphereAGAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0207646_1120706723300025922Corn, Switchgrass And Miscanthus RhizospherePDFWVVEAVEALGAAGQAADMMTAALAQAGKTAGELRPAR
Ga0207664_1095925523300025929Agricultural SoilAAGTGQDPDFWVVEAVEALGAAGQAADMMTAALAQAGKTAGELRPAR
Ga0207669_1113084323300025937Miscanthus RhizosphereREESQLAAGAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0207661_1181198513300025944Corn RhizosphereRLAAGAGQDLDFWVVEAVEALAAAGRAADMMTAALAQAGKTAGELRRAR
Ga0209040_10005316123300027824Bog Forest SoilVVQREEGQITQDRGQDPDFWVVEVVQALADAGQAADMMTAALTQARRTSAELRSPR
Ga0209040_1005835653300027824Bog Forest SoilVVQREEGQITQDRGQDPDFWVVEVVQALADAGRAADMMTAALTQARRTSAELRPAR
Ga0302234_1030541713300028773PalsaREEGQIAPGPGQDPDFWVVEVVEALAAAGQAADMMTAALNQAGKTAAELKPAR
Ga0302223_1030666223300028781PalsaLVVQREEGQIAPGSGEDPDFWVIEVVEALAAAGQAADMMTAALNQAGKTSAELRPTR
Ga0302232_1031687823300028789PalsaQIAPGPGQDPDFWVVEVVEALAAAGQAADMMTAALNQAAKTSAELKPTR
Ga0302228_1031359823300028808PalsaGPGQDPDFWVVEVVEALAAAGQAADMMTAALNQAAKTSAELKPTR
Ga0302235_1013555213300028877PalsaLCEQLARILVVQREEGQIAPGSGQDPDFWVVEVVEALAAAGQAADMMTAALNQAGKTSAELRPAR
Ga0302235_1014051213300028877PalsaDQDPDFWVVEVVEALAAAGQAADMMTAALTQARKTSAELKSTR
Ga0302235_1017492913300028877PalsaILVVQREEGQIAPGSGQDPDFWVVEVVEALAAAGQAADMMTAALNQAAKTSAELKPTRQKTR
Ga0302229_1027064123300028879PalsaQREEGQIAPGSGEDPDFWVVEVVEALAAAGQSADMMTAALNQAGKTSAELRPARLRTR
Ga0311368_1022490243300029882PalsaQIAPGSGQDPDFWVVEVVEALAAAGQAADMMTAALNQAGKTSAELRPTRQKTR
Ga0311371_1045861623300029951PalsaQGADQDPDFWVVEVVEALAAAGQAADMMTAALTQARKTSAELKSTR
Ga0311371_1084310613300029951PalsaREEGQIAPGSGQDPDFWVVEVVEALAAAGQAADMMTAALNQAGKTAAELKPAR
Ga0311338_1011562913300030007PalsaEGQIAPGSGQDPDFWVVEVVEALAAAGQAADMMTAALNQAGKTSAELRPTRQKTR
Ga0311338_1206278113300030007PalsaEGQIAPGSGQDPDFWVVEVVEALAAAGQAADMMTAALNQAGKTAAELKPAR
Ga0302178_1016395413300030013PalsaREEGQIAPGSGQDPDFWVVEVVEALAAAGQAADMMTAALNQAAKTSAELKPTRQKTR
Ga0302177_1017342833300030053PalsaQIAPGSGQDPDFWVVEVVEALAAAGQAADMMTAALNQAAKTSAELKPTRQKTR
Ga0302177_1035382513300030053PalsaGADQDPDFWVVEVVEALAAAGQAADMMTAALTQARKTSAELKSTR
Ga0302181_1019555913300030056PalsaPGSGQDPDFWVVEVVEALAAAGQAADMMTAALNQARKTSAELKPTR
Ga0302181_1042527023300030056PalsaQDPDFWVVEVVEALAAAGQAADMMTAALNQAAKTSAELKPTRQKTR
Ga0302176_1001964313300030057PalsaDPDFWVVEVVEALAAAGQAADMMTAALNQAGKTAAELKPAR
Ga0311353_1028901343300030399PalsaEEGQIAPGPGQDPDFWVVEVVEALAAAGQAADMMTAALNQAAKTSAELKPTR
Ga0302184_1000779713300030490PalsaVQREEGQIAPGSGQDPDFWVVEVVEALAAAGQAADMMTAALNQAGKTAAELKPAR
Ga0311372_1048516713300030520PalsaVEVVEALAAAGQAADMMTAALTQARKTSAELKSTR
Ga0311372_1061341423300030520PalsaDFWVVEVVEALAAAGQAADMMTAALTQARKTSAELKSTR
Ga0311355_1087786433300030580PalsaREEGQIAPGSGQDPDFWVVEVVEALAAAGQAADMMTAALNQAGKTSAELRPTRQKTR
Ga0311356_1078783933300030617PalsaSGQDPDFWVVEVVEALAAAGQAADMMTAALNQARKTSAELKPTR
Ga0302311_1042301333300030739PalsaEQLARLLVVQREEGQIAPGSGEDPDFWVIEVVEALAAAGQAADMMTAALNQAGKTSAELRPTR
Ga0302308_1036599933300031027PalsaAPGPGQDPDFWVVEVVEALAAAGQAADMMTAALNQAAKTSAELKPTR
Ga0302180_1045714313300031028PalsaVIEVVEALAAAGQAADMMTAALNQAGKTSAELRPTR
Ga0302307_1042405323300031233PalsaPDFWVVEVVEALAAAGQAADMMTAALNQAGKTSAELKPARLKDALQTR
Ga0302307_1069973113300031233PalsaVVEVVEALAAAGQAADMMTAALNQAAKTSAELKPTR
Ga0302325_10042093133300031234PalsaEEGQIAPGSGQDPDFWVVEVVEALAAAGQAADMMTAALNQAGKTSAELRPAR
Ga0302324_10013247013300031236PalsaREEGQIAPGSGQDPDFWVVEVVEALAAAGQAADMMTAALNQARKTSAELKPTR
Ga0302324_10106839913300031236PalsaSGQDPDFWVVEVVEALAAAGQAADMMTAALNQAGKTSAELRPTRQKAR
Ga0318541_1040459913300031545SoilVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0318493_1021412213300031723SoilDQDPDFWVVEAVEALAAAGQAADMMTAALAQASKTAGELRPAR
Ga0318492_1035797713300031748SoilILVVQREEGQVGAGADQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0318494_1058710313300031751SoilFWVVEAVEALAAAGRAADMMTAALDQAGKTSGELRSAR
Ga0318566_1012402113300031779SoilGAGADQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0318568_1033618113300031819SoilWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0310917_1089261223300031833SoilGAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0318511_1017063423300031845SoilVLAGAGQDLDFWVVEAVEALAAAGRAADMMTAALGQAGKTAGELRRAR
Ga0318512_1009968913300031846SoilILVVQREEGQVAAGAGQDPDFWVVEAIEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0306921_1148575023300031912SoilRILVVQSEEGQVARDPGQDPDFWVVEAVEALAAAGQAADMMTAALGQAGKTSGELRSAR
Ga0308175_10275628613300031938SoilLCEQLARILVVQREESQLAAGTSQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0310916_1133869823300031942SoilPDFWVVEAIEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0306926_1105767713300031954SoilQVGAGADQDPDFWVVEAVEALAAAGQAADMMTAALAQASKTAGELRPAR
Ga0306926_1267504523300031954SoilGAGAGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0306922_1010649313300032001SoilAGADQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0318562_1059127823300032008SoilVVQREERQVGAGADQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0318558_1050977013300032044SoilVQREEGQVAAGAGQDPDFWVVEAIEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0318558_1063924313300032044SoilDQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0318533_1120606813300032059SoilGQVAAGAGQDPDFWVVEAIEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0318505_1014497813300032060SoilGQDPDFWVVEAIEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0308173_1090499313300032074SoilLAAGAGQDLDFWVVEAVEALAAAGRAADMMTAALAQARKTAGELRRAR
Ga0306924_1255279723300032076SoilGQDPDFWVVEAVEALAAAGQAADMMTAALGQAGKTSGELRSAR
Ga0318518_1004680633300032090SoilCEQLARILVVQREEGQVAAGAGQDPDFWVVEAIEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0335080_1188850313300032828SoilVVQREEGQLGAGAGQDPDFWLVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0335070_1008846133300032829SoilVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0335071_1048227623300032897SoilAPGAGQDLDFWVVEAVEALAAAGRAADMMAATLDQAGKTAGELRPGR
Ga0335077_1042486713300033158SoilVQREEGQLGAGAGQDPDFWLVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR
Ga0373959_0056803_690_8573300034820Rhizosphere SoilVQREESQLTAGTGQDPDFWVVEAVEALAAAGQAADMMTAALAQAGKTAGELRPAR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.