NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055224

Metagenome / Metatranscriptome Family F055224

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055224
Family Type Metagenome / Metatranscriptome
Number of Sequences 139
Average Sequence Length 61 residues
Representative Sequence ASSRQFQKDGPWGFYCADETAARHNASSPEDTQDGTIAYARFAPSRPTRYREGLLPG
Number of Associated Samples 129
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.76 %
% of genes near scaffold ends (potentially truncated) 89.93 %
% of genes from short scaffolds (< 2000 bps) 93.53 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.367 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.705 % of family members)
Environment Ontology (ENVO) Unclassified
(28.058 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.079 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.12%    β-sheet: 0.00%    Coil/Unstructured: 85.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF12681Glyoxalase_2 3.60
PF08241Methyltransf_11 2.88
PF02627CMD 2.16
PF09678Caa3_CtaG 2.16
PF08281Sigma70_r4_2 2.16
PF08002DUF1697 2.16
PF07883Cupin_2 2.16
PF13291ACT_4 1.44
PF01863YgjP-like 1.44
PF12840HTH_20 1.44
PF00753Lactamase_B 1.44
PF04828GFA 1.44
PF01738DLH 1.44
PF00903Glyoxalase 1.44
PF13472Lipase_GDSL_2 1.44
PF01019G_glu_transpept 1.44
PF02129Peptidase_S15 0.72
PF04020Phage_holin_4_2 0.72
PF00563EAL 0.72
PF04140ICMT 0.72
PF08031BBE 0.72
PF13391HNH_2 0.72
PF03631Virul_fac_BrkB 0.72
PF03575Peptidase_S51 0.72
PF00082Peptidase_S8 0.72
PF01386Ribosomal_L25p 0.72
PF05991NYN_YacP 0.72
PF03602Cons_hypoth95 0.72
PF02738MoCoBD_1 0.72
PF01872RibD_C 0.72
PF13367PrsW-protease 0.72
PF12697Abhydrolase_6 0.72
PF13238AAA_18 0.72
PF01047MarR 0.72
PF02126PTE 0.72
PF00326Peptidase_S9 0.72
PF027395_3_exonuc_N 0.72
PF13411MerR_1 0.72
PF13646HEAT_2 0.72
PF04011LemA 0.72
PF01790LGT 0.72
PF00231ATP-synt 0.72
PF01063Aminotran_4 0.72
PF04993TfoX_N 0.72
PF02110HK 0.72
PF00953Glycos_transf_4 0.72
PF00583Acetyltransf_1 0.72
PF12695Abhydrolase_5 0.72
PF14693Ribosomal_TL5_C 0.72
PF04542Sigma70_r2 0.72
PF01471PG_binding_1 0.72
PF02801Ketoacyl-synt_C 0.72
PF13701DDE_Tnp_1_4 0.72
PF00270DEAD 0.72
PF08818DUF1801 0.72
PF02371Transposase_20 0.72
PF04560RNA_pol_Rpb2_7 0.72
PF14333DUF4389 0.72
PF09335SNARE_assoc 0.72
PF08327AHSA1 0.72
PF00264Tyrosinase 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 2.16
COG3797Uncharacterized conserved protein, DUF1697 familyFunction unknown [S] 2.16
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 2.16
COG0115Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyaseAmino acid transport and metabolism [E] 1.44
COG1451UTP pyrophosphatase, metal-dependent hydrolase familyGeneral function prediction only [R] 1.44
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 1.44
COG3791Uncharacterized conserved proteinFunction unknown [S] 1.44
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.72
COG1735Predicted metal-dependent hydrolase, phosphotriesterase familyGeneral function prediction only [R] 0.72
COG2145Hydroxyethylthiazole kinase, sugar kinase familyCoenzyme transport and metabolism [H] 0.72
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.72
COG2242Precorrin-6B methylase 2Coenzyme transport and metabolism [H] 0.72
COG2265tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD familyTranslation, ribosomal structure and biogenesis [J] 0.72
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 0.72
COG3070Transcriptional regulator of competence genes, TfoX/Sxy familyTranscription [K] 0.72
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.72
COG3547TransposaseMobilome: prophages, transposons [X] 0.72
COG3688EndoRNase involved in mRNA decay, NYN (Nedd4-BP1/Rae1/YacP nuclease) family, contains PIN domainTranslation, ribosomal structure and biogenesis [J] 0.72
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.72
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.72
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.72
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.72
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.72
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.72
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 0.72
COG0085DNA-directed RNA polymerase, beta subunit/140 kD subunitTranscription [K] 0.72
COG0224FoF1-type ATP synthase, gamma subunitEnergy production and conversion [C] 0.72
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 0.72
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.72
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.72
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.72
COG0472UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferaseCell wall/membrane/envelope biogenesis [M] 0.72
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.72
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.72
COG1950Uncharacterized membrane protein YvlD, DUF360 familyFunction unknown [S] 0.72
COG074216S rRNA G966 N2-methylase RsmDTranslation, ribosomal structure and biogenesis [J] 0.72
COG109223S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmITranslation, ribosomal structure and biogenesis [J] 0.72
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.72
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.72
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.72
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.72
COG1704Magnetosome formation protein MamQ, lipoprotein antigen LemA familyCell wall/membrane/envelope biogenesis [M] 0.72
COG0063NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate dehydratase domainNucleotide transport and metabolism [F] 0.72
COG1825Ribosomal protein L25 (general stress protein Ctc)Translation, ribosomal structure and biogenesis [J] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.37 %
UnclassifiedrootN/A8.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_105476157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1097Open in IMG/M
3300000891|JGI10214J12806_11209829All Organisms → cellular organisms → Bacteria1347Open in IMG/M
3300000956|JGI10216J12902_104701098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300001538|A10PFW1_11819153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1011Open in IMG/M
3300002568|C688J35102_120438867Not Available1069Open in IMG/M
3300002906|JGI25614J43888_10222484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300003324|soilH2_10357479All Organisms → cellular organisms → Bacteria1677Open in IMG/M
3300004081|Ga0063454_101778351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300004153|Ga0063455_100344876All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300004156|Ga0062589_101164323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria735Open in IMG/M
3300004156|Ga0062589_102723949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300004157|Ga0062590_103066977Not Available501Open in IMG/M
3300004633|Ga0066395_10663691All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300004643|Ga0062591_102368179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300005093|Ga0062594_101312692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria727Open in IMG/M
3300005166|Ga0066674_10494009Not Available552Open in IMG/M
3300005175|Ga0066673_10190450All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300005180|Ga0066685_10599981All Organisms → cellular organisms → Bacteria → Terrabacteria group758Open in IMG/M
3300005181|Ga0066678_10776357All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium635Open in IMG/M
3300005186|Ga0066676_10884453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300005327|Ga0070658_11756031All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005337|Ga0070682_102071172All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005356|Ga0070674_101376649All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300005406|Ga0070703_10338326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300005436|Ga0070713_101207948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium732Open in IMG/M
3300005438|Ga0070701_11192730All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300005439|Ga0070711_100606128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium914Open in IMG/M
3300005441|Ga0070700_101548215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300005529|Ga0070741_10032004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei7277Open in IMG/M
3300005547|Ga0070693_100176934All Organisms → cellular organisms → Bacteria1371Open in IMG/M
3300005553|Ga0066695_10158700All Organisms → cellular organisms → Bacteria1410Open in IMG/M
3300005555|Ga0066692_10932638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300005561|Ga0066699_10597314All Organisms → cellular organisms → Bacteria → Terrabacteria group793Open in IMG/M
3300005576|Ga0066708_10413820All Organisms → cellular organisms → Bacteria → Terrabacteria group865Open in IMG/M
3300005598|Ga0066706_10493998Not Available975Open in IMG/M
3300005844|Ga0068862_101932565All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300006034|Ga0066656_10728142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces636Open in IMG/M
3300006163|Ga0070715_10778014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300006173|Ga0070716_100334809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1066Open in IMG/M
3300006175|Ga0070712_101186143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria664Open in IMG/M
3300006573|Ga0074055_11302451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium565Open in IMG/M
3300006574|Ga0074056_11291086All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300006791|Ga0066653_10493179Not Available621Open in IMG/M
3300006852|Ga0075433_10022776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5262Open in IMG/M
3300006904|Ga0075424_101671283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium674Open in IMG/M
3300009012|Ga0066710_100758439All Organisms → cellular organisms → Bacteria1484Open in IMG/M
3300009038|Ga0099829_10396478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1140Open in IMG/M
3300009089|Ga0099828_11299158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300009089|Ga0099828_11784105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300009098|Ga0105245_12963619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium526Open in IMG/M
3300009137|Ga0066709_100170204All Organisms → cellular organisms → Bacteria2819Open in IMG/M
3300009137|Ga0066709_100671454Not Available1486Open in IMG/M
3300009156|Ga0111538_12994186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. CPCC 204708590Open in IMG/M
3300009156|Ga0111538_13278758All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300009789|Ga0126307_11553772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300009840|Ga0126313_10868810All Organisms → cellular organisms → Bacteria → Terrabacteria group735Open in IMG/M
3300009840|Ga0126313_11156979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter637Open in IMG/M
3300010039|Ga0126309_11030591Not Available554Open in IMG/M
3300010041|Ga0126312_10076511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2262Open in IMG/M
3300010047|Ga0126382_11701880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter589Open in IMG/M
3300011107|Ga0151490_1467188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300011996|Ga0120156_1036839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria898Open in IMG/M
3300012014|Ga0120159_1215143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300012043|Ga0136631_10378583All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300012189|Ga0137388_10059034All Organisms → cellular organisms → Bacteria3148Open in IMG/M
3300012198|Ga0137364_10434186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium984Open in IMG/M
3300012206|Ga0137380_10432486Not Available1165Open in IMG/M
3300012207|Ga0137381_11287184Not Available624Open in IMG/M
3300012209|Ga0137379_11741673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300012210|Ga0137378_10189811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium1912Open in IMG/M
3300012357|Ga0137384_10980724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300012357|Ga0137384_11042534Not Available657Open in IMG/M
3300012363|Ga0137390_11122405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria735Open in IMG/M
3300012882|Ga0157304_1105468All Organisms → cellular organisms → Bacteria → Terrabacteria group520Open in IMG/M
3300012891|Ga0157305_10204902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300012905|Ga0157296_10436396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300012957|Ga0164303_10890041All Organisms → cellular organisms → Bacteria → Terrabacteria group622Open in IMG/M
3300012972|Ga0134077_10575758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300012977|Ga0134087_10086118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1296Open in IMG/M
3300012984|Ga0164309_10180944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1433Open in IMG/M
3300012988|Ga0164306_10097697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1908Open in IMG/M
3300013501|Ga0120154_1148379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300014058|Ga0120149_1155730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300014326|Ga0157380_12634533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300015201|Ga0173478_10030579All Organisms → cellular organisms → Bacteria1625Open in IMG/M
3300015374|Ga0132255_100892537All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300018028|Ga0184608_10438396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium563Open in IMG/M
3300018032|Ga0187788_10338487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia619Open in IMG/M
3300018052|Ga0184638_1303964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300018071|Ga0184618_10035046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1748Open in IMG/M
3300018422|Ga0190265_10100802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2706Open in IMG/M
3300018432|Ga0190275_11276865All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300018466|Ga0190268_10005298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter3121Open in IMG/M
3300018468|Ga0066662_12351927All Organisms → cellular organisms → Bacteria → Terrabacteria group560Open in IMG/M
3300018469|Ga0190270_12715304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300018469|Ga0190270_13142106All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300018476|Ga0190274_10182551All Organisms → cellular organisms → Bacteria → Terrabacteria group1820Open in IMG/M
3300018481|Ga0190271_11251680Not Available863Open in IMG/M
3300019767|Ga0190267_11063529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300020082|Ga0206353_11397747All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300021080|Ga0210382_10220544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium826Open in IMG/M
3300021363|Ga0193699_10048375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1639Open in IMG/M
3300023071|Ga0247752_1012858All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300024283|Ga0247670_1014339All Organisms → cellular organisms → Bacteria1427Open in IMG/M
3300025324|Ga0209640_10215451All Organisms → cellular organisms → Bacteria1628Open in IMG/M
3300025885|Ga0207653_10007504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3399Open in IMG/M
3300025919|Ga0207657_11008974All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300025922|Ga0207646_10568932All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300025932|Ga0207690_11857348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300025949|Ga0207667_10998896All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300026542|Ga0209805_1366528All Organisms → cellular organisms → Bacteria → Terrabacteria group550Open in IMG/M
3300027665|Ga0209983_1120331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300028380|Ga0268265_11637964All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300028608|Ga0247819_10652296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300028707|Ga0307291_1146708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300028707|Ga0307291_1205440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300028711|Ga0307293_10164641Not Available706Open in IMG/M
3300028744|Ga0307318_10207895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium678Open in IMG/M
3300028787|Ga0307323_10066401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1280Open in IMG/M
3300028787|Ga0307323_10120233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium945Open in IMG/M
3300028811|Ga0307292_10374536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300028812|Ga0247825_10508049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora narathiwatensis858Open in IMG/M
3300028881|Ga0307277_10340524All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300028884|Ga0307308_10190318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium983Open in IMG/M
3300028884|Ga0307308_10649251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300031640|Ga0318555_10413469All Organisms → cellular organisms → Bacteria → Terrabacteria group731Open in IMG/M
3300031723|Ga0318493_10224379All Organisms → cellular organisms → Bacteria → Terrabacteria group998Open in IMG/M
3300031765|Ga0318554_10459075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium722Open in IMG/M
3300031771|Ga0318546_10342061All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300031903|Ga0307407_11391548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300031995|Ga0307409_100322748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1446Open in IMG/M
3300031996|Ga0308176_11852876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300032002|Ga0307416_101362215All Organisms → cellular organisms → Bacteria → Terrabacteria group815Open in IMG/M
3300032782|Ga0335082_11278017All Organisms → cellular organisms → Bacteria → Terrabacteria group602Open in IMG/M
3300032828|Ga0335080_10973822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria865Open in IMG/M
3300033158|Ga0335077_10033963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6327Open in IMG/M
3300033550|Ga0247829_10894097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter739Open in IMG/M
3300034164|Ga0364940_0242137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300034820|Ga0373959_0105246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium676Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.79%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.91%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.60%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.60%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.88%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.16%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.16%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.16%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.16%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.44%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.72%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.72%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.72%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.72%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.72%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.72%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.72%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.72%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.72%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002906Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cmEnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011996Permafrost microbial communities from Nunavut, Canada - A39_65cm_12MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013501Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10547615713300000364SoilVGAGDGPCVILAASSRQFQKDGPWGFYSVDETAARHNASSPEETQDGKLAYARFAPSQESRYRDGWLPDSRS*
JGI10214J12806_1120982943300000891SoilQFQKDGPWGYSCADETAAKYNASSPEDTQDNAVADARFPPQRKTRYREGLLPES*
JGI10216J12902_10470109813300000956SoilFQKDGPWGYYCADETAAKYNASSPENTQDSGIAYARVAPARATRYPGDLLPG*
A10PFW1_1181915333300001538PermafrostFQKDGPWGFYSVDETAARYNASSPEETQDGTVAYARFPPSEETRYPGGLLPADGLSR*
C688J35102_12043886713300002568SoilGDEPCVILAASSRQFQKDGPWGFYCADETAAKYNASSPEETQDGSIAYARFEDAQAVRYRDGLLPD*
JGI25614J43888_1022248423300002906Grasslands SoilLCASSRQFQKDGPWGFYCFDETAAKYNAASPEDTQDGGIAYARFPPSSETRYPDGLLPD*
soilH2_1035747913300003324Sugarcane Root And Bulk SoilSRQFQKDGPWGFYCVDEAAARHNASSPEETQDNELAYARFEPAQFARYRDGLLPDD*
Ga0063454_10177835123300004081SoilGPCVLLCASSRQFQKDGPWGYYCVDETAARYNASPPEDTQDNSVAYGRFEPSRPAPYPDGLLPT*
Ga0063455_10034487623300004153SoilSRQFQKDGPWGYYCYDETAERYNAASPEDTQDGEIAYARFPDPRTAHFPGGLLPE*
Ga0062589_10116432313300004156SoilGDGPCVLLCASSRQFQKDGPWGWYCADELAARHNAAPPEDTQDAGVAGSHLRPSRETTYPGGLLPDT*
Ga0062589_10272394913300004156SoilGEGPFVLLCASSRQFQKDGPWGYSCADETAARYNASSPEDTQDSEVADARFPPQRETRYISGLLPK*
Ga0062590_10306697723300004157SoilASSRQFQKDGPWGFYCADETAARHNASSPEDTQDGTIAYARFAPSRPTRYREGLLPG*
Ga0066395_1066369123300004633Tropical Forest SoilILAASSRQFQKHGPWGFYCVDEVAARYNASSPEETQDGEIAYARFPDAELSRYRDGLLPG
Ga0062591_10236817923300004643SoilPCVILCASSRQFQKDGPWGFYCADETAARHNAASPEETQDNEIAYARFAPAEFARYRAGLLPDG*
Ga0062594_10131269223300005093SoilDGPWGFYCADETAARHNAASPEETQDNEIAYARFAPAEFARYRAGLLPDG*
Ga0066674_1049400923300005166SoilSRQFQKDGPWGFYCADETAARYNAASPEDTQDGGIAYARFAPSRETRYRDGLLPEQR*
Ga0066673_1019045013300005175SoilCASSRQFQKDGPWGFYCVDETAARYNASSPEETQDTEIADARFAEPRKTRYSSGLLPGD*
Ga0066685_1059998143300005180SoilITGDRDGPWDFYSVDETAARYNASAPVETQDGGVAYARFPPSRETRCPGGLLPGD*
Ga0066678_1077635713300005181SoilVRASLCASSRQFQKDGPWGFYCIDETAARYNAASPEETQDGRIAYARFPPAEERRYPGELLPGD*
Ga0066676_1088445323300005186SoilVQRTGPITGDRDGPWDFYSVDETAARYNASSPVETQDGGVAYARFPPSRETRYPG
Ga0070658_1175603113300005327Corn RhizosphereSSRQFQKDGPWGFCCPDEAAARHGAAAPEETQDERVAYARFGPSTPTRYRDGLLPE*
Ga0070682_10207117213300005337Corn RhizosphereCVLLCASSRQFQKDGPWGMYVADETAARYGASVPEDTDDDSAHYPSSEPVRYRDGLLPG*
Ga0070674_10137664923300005356Miscanthus RhizosphereKDGPWGYYSVDETAARYNASSPEETQDGSVAYARFPPAEETRYPGGLLPGD*
Ga0070703_1033832623300005406Corn, Switchgrass And Miscanthus RhizosphereDGPWGYYCVDETAAKYNASSPEETQDFGVAYGRFAPAEETRYPGGLLPGD*
Ga0070713_10120794813300005436Corn, Switchgrass And Miscanthus RhizosphereQFQERGPWGFYSVDETAARYNASSPEETQDGGVAYARFPPEQETRYPGGLLPGD*
Ga0070701_1119273013300005438Corn, Switchgrass And Miscanthus RhizosphereCASSRQFQKDGPWGYYSVDETAARYNASSPEETQDGSVAYARFPPAEETRYPGGLLPGD*
Ga0070711_10060612823300005439Corn, Switchgrass And Miscanthus RhizosphereCVILAASSRQFQERGPWGFYSVDERAARYNASSPEETQDFGVAYARFPPERETRYPGDLLPGDSARSSDLDA*
Ga0070700_10154821523300005441Corn, Switchgrass And Miscanthus RhizosphereRQFQKDGPWGWYCADELAARHNAAPPEDTQDAGVAGAHLRPSRETTYPGGLLPED*
Ga0070741_1003200413300005529Surface SoilPETRHAFVGAGEGPCVLLCASSRQFKKDGPWGWYCVDGTAARHNASSPEDTQDTAIADARFPPSEKTRYIDGLLPS*
Ga0070693_10017693433300005547Corn, Switchgrass And Miscanthus RhizosphereFQKDGPWGYYCVDETAAKYNASSPEETQDFGVAYGRFAPAEETRYPGGLLPGD*
Ga0066695_1015870023300005553SoilVQRTGPITGDRDGPWGFYSVDETAARDNASSPEETQDGDVAYARFRPSRETRCPGGLLPGD*
Ga0066692_1093263823300005555SoilQFQKDGPWGFYCADETAARYNASSPEDTQDGSVAYARFAPAKATRYREGLLPDW*
Ga0066699_1059731423300005561SoilSRQFQKDGPWGFYCADETAARYNASSPEDTQDGSVAYARFAPARETRYRPGLLPQ*
Ga0066708_1041382023300005576SoilQKDGPWGFYCADETAARYNASSPEDTQDGSVAYARFAPARETRYRPGLLPQ*
Ga0066706_1049399823300005598SoilSRQFQKDGPWGSYCGDETASRYNASSPEETQDGSVAYARFAPSKESRYPDGLLPGD*
Ga0068862_10193256523300005844Switchgrass RhizosphereGDGPCVLLCASSRQFQKDGPWGFYCVDEVAARHNASSPEETQDTEVTDARFPPTREIAYPGGLLPGD*
Ga0066656_1072814213300006034SoilQFQKDGPWGFYCADETAARYDASSPEDTQDGSVAYARFAPARATRYPDGLLPG*
Ga0070715_1077801423300006163Corn, Switchgrass And Miscanthus RhizosphereASSRQFQERGPWGFYSVDETAARYNASSPEETQDGGVAYARFPPEQETRYPGGLLPGD*
Ga0070716_10033480913300006173Corn, Switchgrass And Miscanthus RhizosphereGAGDGPCVLLCASSRQFQKDGPWGFYCADETAGRYNASSPEDTQDGDLAYARFAPSQETRYRPGLLPE*
Ga0070712_10118614323300006175Corn, Switchgrass And Miscanthus RhizosphereVQEARQFREAGPWGYYCADETAARYNAGCPEDTQDGELAYAQFPPSEPARYREGLLPGG*
Ga0074055_1130245113300006573SoilLCASSRQFQKDGPWGYYCADETAARYNAAPAEDTQDADIAGAQFPPSRETTYPGGLLPGDE*
Ga0074056_1129108613300006574SoilKHAFVGAGEKPCVLLGAGSRRFQKDGPWGFYCADETAARYNAGSPEDTQDGELADARFAPQRPTRHPGGLLPD*
Ga0066653_1049317923300006791SoilLAASSRQFQKDGPWGFYCVDEAARRYNASSPEETQDTEVAYARFPPPRQVRYRDGLLPG*
Ga0075433_1002277613300006852Populus RhizosphereCASSRQFQKDGPWGYYCVDETAAKHNASSPEETQDFGVAYGRFAPAEETRYPGGLLPGD*
Ga0075424_10167128323300006904Populus RhizosphereCASSRQFQKDGPWGYYCVDETAAKYNASSPEETQDFGVAYGRFAPAEETRYPGGLLPGD*
Ga0066710_10075843923300009012Grasslands SoilVLLCASSRQFQKDGSWGFYCVDETAVRYNASSPEETQDGSVAYARFPPSEERPYPGGLLPGD
Ga0099829_1039647823300009038Vadose Zone SoilSSRQFQKDGPWGYYCADEIARRYNASAPEDTQDTAVAYGRFPPSHPTRYRAGLLPD*
Ga0099828_1129915823300009089Vadose Zone SoilVGAGDAPCVLLCASSRQFQKDGPWGFYCADETAARYNASSPEDTQDGSVAYARFAPSRPTRYREGLLPDW*
Ga0099828_1178410523300009089Vadose Zone SoilVLLCASSRQFQKDGPWGFYCADETAARYNASSPEDTQDGSVAYARFAPAKATRYRDGLLPGW*
Ga0105245_1296361913300009098Miscanthus RhizosphereFVGVGAEPCVLVCASSRQFQKDGPWGSYCYDETAESYNAASPVDTQDGEIAYARFPESREVLYPGGLLPE*
Ga0066709_10017020453300009137Grasslands SoilVLLCASSRQFQKDGSWGFYCVDETAVRYNASSPEETQDGSVAYARFPPSEERPYPGGLLPGD*
Ga0066709_10067145413300009137Grasslands SoilGASGRFTTDGPWGCYCGRETARRYNASSPEETQDTEVAYARFPPPRQVRYRDGLLPG*
Ga0111538_1299418623300009156Populus RhizosphereSRQFQKDGPWGWYCADEAATRYNASSPEDTQDGSVAYERFAPTRAVPYREGLLPD*
Ga0111538_1327875823300009156Populus RhizosphereQFQKDGPWGYYCVDETAGKYNASSPEETQDFGVAYGRFAPAEETRYPGGLLPGD*
Ga0126307_1155377213300009789Serpentine SoilDGPWGFYCADETAARYNASSPEDTQDDALAYARFPPLEPARYREGLLPNA*
Ga0126313_1086881013300009840Serpentine SoilVLLCASSRQFQKDGPWGFYCADETAAKYNASSPEDTQDGNVADARFAPSRATRYPGDLLP
Ga0126313_1115697923300009840Serpentine SoilASSRQFQKDGPWGFYCADETAAKYNASSPEDTQDGNVADARFAPSRATRYPGDLLPR*
Ga0126309_1103059123300010039Serpentine SoilGHAFVGTGDEPLVLLCASSRQYQKDGPWGYYLADETAARHNASAPEDTQDNDVADAQFPPVRETRYPDGLLPG*
Ga0126312_1007651113300010041Serpentine SoilVILAASLRQFQKDGPWGFYCADETAGRHNASSPEDTQDREVAYARFAPSEPARYRDGLLQD*
Ga0126382_1170188023300010047Tropical Forest SoilCVLLCASSRQFQKDGPWGFYCVDETAAKYNASSPEETQDADVADAGFAPSRGTRYPGGLLPD*
Ga0151490_146718823300011107SoilVGAGEGPCVLLCASSRQFQKDGPWGFYCADETAARYNAGSPEDTQDGELADARFAPQRPTRHPGGLLPD*
Ga0120156_103683923300011996PermafrostLPGAGDGSCVLLCASSRQFHKNGPWGFYCADETAALYNAASPEDTQDGGIAYARFPPSRETRYPDALLPG*
Ga0120159_121514313300012014PermafrostCVLLCASSRQFQKDGPWGFYCADETAALYNAASPEDTQDGGIAYARFPPSRETRYPDGLLPG*
Ga0136631_1037858323300012043Polar Desert SandFQKDGPWGFYSVDETAARYNASSPEETQDGSVAYARFPPEQETRYPGGLLPGG*
Ga0137388_1005903433300012189Vadose Zone SoilVLLCASSRQFQKDGPWGFYCADETAARYNASSPEDTQDASVAYARFAPAKATRYRDGLLPGW*
Ga0137364_1043418633300012198Vadose Zone SoilCVILAASSRQFQKDGPWGFYCADETAGRYNASSPEDTQDGDVAYAGVPDLEPTRYRDGLLPG*
Ga0137380_1043248613300012206Vadose Zone SoilGPWGFYCADETARRYNASSPEDTQDGEVAYGRFPPSQPTRYRGGLLPG*
Ga0137381_1128718413300012207Vadose Zone SoilQKDGPWGFYCVDETARRYNASSPEDTQDSEVAYGRFPPSQPTRYRNGVLPD*
Ga0137379_1174167323300012209Vadose Zone SoilVLLCASSRQFQKDGPWGFYIADETAARYNAGSPEDTQDGELAYERFEPARPTRY
Ga0137378_1018981123300012210Vadose Zone SoilCVIPAASSRQFQKDGPWGYYCVDETASRYNAASPEETQDGTIAYARFPPEQETRYPGGLLPGG*
Ga0137384_1098072413300012357Vadose Zone SoilASSRQFQKDGPWGFYCADESAGRYNASSPEDTQDGDVADAGFPPSHPTRYRDGLLPS*
Ga0137384_1104253413300012357Vadose Zone SoilKDGPWGFYCADETAARYNAASPEDTQDGRVAYARFAPSRPTRYRNGLLPD*
Ga0137390_1112240523300012363Vadose Zone SoilGAGDEPCVLLAASSRQFQKDGPWGFYCADDVAAKYNASPPEDTQDTALAYARFEPSQPGPYRDGLLPG*
Ga0157304_110546823300012882SoilFQKDGPWGYSCADETAAKYNASSPEDTQDNAVADARFPPQRKTRYREGLLPES*
Ga0157305_1020490213300012891SoilSRQFQKDGPWGYNCADETAARHNASSPEDTQDSEVADARFPPQRETRYPSGLLPD*
Ga0157296_1043639623300012905SoilPCPPETRQAFVGAGEGPGVLLCESSRQFQKDGPWGYYCADETAARHNAASPEETQDNEIAYARFAPAEFARYRAGLLPDG*
Ga0164303_1089004123300012957SoilSRQFQKDGPWGFSCFDETAAKYNAASPEDTQDNEIADARFPPPSEARYREGLLPGG*
Ga0134077_1057575823300012972Grasslands SoilVILAASSRQFQKDGPWGFYCADEVAGRYNASAPEDTQDADVAYARFPPSQPKRYRDGLLPG*
Ga0134087_1008611853300012977Grasslands SoilSSRQFQKDGPWGFYCADETAARYNASSPEDTQEFEPAHARFEPSRKIRYPGGLLPGG*
Ga0164309_1018094423300012984SoilVIMAASSRQFQKDGPWGFYSVDETAARHNASSPEETQDGQIAYARFAPWQESGYRDGWLPDSRS*
Ga0164306_1009769733300012988SoilPGTRHAFAGAGSEPCVILAVSSRQFQKVGPWGFYCVDETAAKYNASSPEETQDGEIAYARFAPPERTRYPGALLPGD*
Ga0120154_114837923300013501PermafrostASSRQFQKDGPWGLYCADETAARYNASSPEDTQDGGIAYARFPPSRETRYPDALLPG*
Ga0120149_115573013300014058PermafrostQFQKDGPWGFYSVDETAARYNASSPEETQDGTVAYARFPPSEETRYPGGLLPGDGQRR*
Ga0157380_1263453323300014326Switchgrass RhizosphereGAGDGPCVILCASSRQFQKDGPWGYYCADDTAAKYGASVPEDTQDDSGHFPQSVPAPYREGLLP*
Ga0173478_1003057923300015201SoilRQFQKHGPWGYNCADETAARHNASSPEDTQDSEVADARFPPQRETRYPSGLLPD*
Ga0132255_10089253733300015374Arabidopsis RhizosphereQFQKDGPWGFYCADDTAARHNASSPEDTQDGALAYARFPPQRAIRYRDGLLPELQSGRRRA*
Ga0184608_1043839623300018028Groundwater SedimentIGAGDGPCVLLCASSRQFQKDGPWGEYCADEAAARYNASSPEDTQDGALADARFPPQRETRYPFGLLPD
Ga0187788_1033848733300018032Tropical PeatlandLCASSRQFQKDGPWGFYIADETAARYNAGSPEDTQDGELADARFEEPRKIRYPGGLLPD
Ga0184638_130396413300018052Groundwater SedimentQFQKDGPWGYYSVDETAARYNASSPEETQDGSIAYARFPPEEEIPYPGGLLPGD
Ga0184618_1003504613300018071Groundwater SedimentLGDAPCVILAASSRQFQKDGPWGFYCADETARRYNASSPEDTQDGEVAYGRFPAAQPMRFREGLLPE
Ga0190265_1010080223300018422SoilMGLRALPARDPRHAFVGADGPCVLLAASSRQFQKDGPWGFYCADEIARRCNSSSPEDTQDSEVAYARFSPSQPMRYRDGLLPD
Ga0190275_1127686513300018432SoilVSSRQFQKDGPWGFYCADEIAARHNASSPEDTQDGELAYARFAPPRPTRYRDGLLPDC
Ga0190268_1000529863300018466SoilRQFQKDGPWGFYCVDETAARHNASSPEETQDGEIANAGLGPSRPTRYPEGLLPG
Ga0066662_1235192713300018468Grasslands SoilAPCVLLCASSRQFQKDGPWGFYCADETAARYNASSPEDTQDGALAYARFSPSQPVRYRDGLLPD
Ga0190270_1271530413300018469SoilRQFQKDGPWGFSCADETAARYNASSPEDTQDNDTADARFPPPRETRYKDGPLPE
Ga0190270_1314210623300018469SoilRSSNGTSCTALRRGHASVGAGDAPCVLLCVSSRQFQKDGPWGFCCADETAARHNASSPEDTQDGEIADTGFGPSRPTRYLDGLLPG
Ga0190274_1018255163300018476SoilAGDGPCVILAASSRQFQKDGPWGFYCADDVAGRHNAASPEDTQDSDVAYARFAPSQPTRYRDGLLPD
Ga0190271_1125168023300018481SoilQFQKDGPWGFYCADETAARYNASSPEDTQDFALAYARFPPLEPARYRDGLLPNS
Ga0190267_1106352913300019767SoilGAGEGPCVLLCASSRQFQKDGPWGYNCADETAARHNASSPEDTQDSEVADARFPPQRETRYPSGLLPN
Ga0206353_1139774713300020082Corn, Switchgrass And Miscanthus RhizosphereQKDGPWGFYCFDETAAKYNAASPEDTQDGSVAYARFPPSSETRYPDGLLPG
Ga0210382_1022054413300021080Groundwater SedimentRQFQKDGPWGFYCADETADRYNASSPEETQDGDVAYAGVPDLEPTRYRDGLLPG
Ga0193699_1004837523300021363SoilVILCASSRQFQEDGPWGFYCADETAARQNAASPEDTQDGGIAYARFPPSRETRYPDGLLP
Ga0247752_101285823300023071SoilLLCASSRQFQKDGPWGYNCADETAARHNASSPEDTQDSEVADARFPPQRETRYPSGLLPD
Ga0247670_101433933300024283SoilPSGTDASSRQFQKDGPWGFYCFDETAAKYNAASPEDTQDGEIAYARFPTPRETRYRDGLLPD
Ga0209640_1021545113300025324SoilVILAASSRQFQKNGPWGFYCADEVARRYNASAPEDTQDGELAYGRFPPSRPTRYRDGSLQ
Ga0207653_1000750413300025885Corn, Switchgrass And Miscanthus RhizosphereASSRQFQKDGPWGYYCVDETAAKYNASSPEETQDFGVAYGRFAPAEETRYPGGLLPGD
Ga0207657_1100897423300025919Corn RhizosphereVLLCTSSRQFQKDGPWGFYCFDETAAKYNAASPEDTQDGSVAYARFPPSSETRYPDGLLP
Ga0207646_1056893233300025922Corn, Switchgrass And Miscanthus RhizosphereRPCVLLCASSRQFQKDGPWGFYCFDETAAKYNAASPEDTQDGSVAYARFPPSSETRYPDGLLPG
Ga0207690_1185734823300025932Corn RhizosphereRHAFVGAGEHGCVLLCASSREFQKDGPWGFYCADETAARYNASSPEDTQDDGVALGRFAPSRATSYREGLLPDTAVSPDTP
Ga0207667_1099889633300025949Corn RhizosphereLCTSSRQFQKDGPWGFYCFDETAAKYNAASPEDTQDGSVAYARFPPSSETRYPDGLLPG
Ga0209805_136652813300026542SoilAGDGPCVILCASSRQFHKDGPWGFYCADETAARYNASSPEDTQDGSVAYARFAPARETRYRPGLLPQ
Ga0209983_112033113300027665Arabidopsis Thaliana RhizosphereRQFQKDGPWGYNCADETAARHNASSPEDTQDSEVADARFPPQRETRYPSGLLPD
Ga0268265_1163796413300028380Switchgrass RhizosphereGPCVLLCTSSRQFQKDGPWGFYCVDGVAARHNASSPEETQDTEVTDARFPPTREIAYPGGLLPGD
Ga0247819_1065229613300028608SoilFQKDGPWGYYCYDETAESFNAASPEDTQDGEIAYGRFPEPREARYPGGLLPE
Ga0307291_114670823300028707SoilGPCVLLCASSRQFQKDGPWGYYCADETAARHNASPPQDTQDNSVAYGRFEPSRPAPYRDGLLPT
Ga0307291_120544013300028707SoilAFVGAGEGPFVLLCASSRQFQKDGPWGYSCADETAARYNASSPEDTQDSEVADARFPPQRETRYLFGLLPN
Ga0307293_1016464113300028711SoilASSRQFQKDGPWGFYCVDEAAARYNASSPEETQDFALAYARFPPAEPTRYRDGLLPNGA
Ga0307318_1020789523300028744SoilDGPWGFYCADETARRYNASSPEDTQDGEVAYGRFPPSEPTGYRDGSLPD
Ga0307323_1006640113300028787SoilQFQKDGPWGVYCADETAARYNASSPEDTQEFEPAHARFEPSRKIRYPGGLLPD
Ga0307323_1012023323300028787SoilVLLCASSRQFQKDGPWGYYCADETAARHNASPPQDTQDNSVAYGRFEPSRPAPYRDGLLP
Ga0307292_1037453613300028811SoilAASSRQFQKDGPWGFYCADETAAKYNASSPEDTQDGEVAYGRFPPSEPARYREGLLPD
Ga0247825_1050804913300028812SoilPCVLLCASSREFQKDGPWGYYCADETAARHNASSPEDTQDGSVAYARFPPSRETRYPDGLLP
Ga0307277_1034052433300028881SoilVILAASSRQFQEHGPRGFYSVDEKAARQNASSPEETQDAGVAYARFAPEQETAYPGALLPGD
Ga0307308_1019031813300028884SoilPCVLLCASSRQFQKDGPWGYYCADETAARYNASSPEDTQDGALADARFPPPRETRYPSGLLPD
Ga0307308_1064925113300028884SoilDGPWGFYCADEVARRYNASAPEDTQDGELADARFAPQQLTRYCEGLLPD
Ga0318555_1041346923300031640SoilQKDGPWGFYCVDEVAARYNASPAEETQDAELAYERFAPSEPSRYRDGLLPG
Ga0318493_1022437933300031723SoilFQKDGPWGFYCVDEVAARYNASPAEETQDAELAYERFAPSEPSRYRDGLLPG
Ga0318554_1045907523300031765SoilLAASSRQFQKDGPWGYYCVDETAARYDASSPEETQDGSVAYANVPPSEPVRYRDGLLPGT
Ga0318546_1034206133300031771SoilYRAASSRQFQKDGPWGFYCVDEAAARYNASSPEETQDGEIAYARFADAELSRYREGLLPD
Ga0307407_1139154813300031903RhizosphereVLLCASSRQFQKDGPWGFYCADETAARYNASSPEDTQDNAHAYARFPPPEFARYRDGLLPNS
Ga0307409_10032274813300031995RhizosphereVGAGDGPCVLLCASSRQFQKDGPWGFYCADETAARYNASSPEETQDGDVAYARFAIPRHTRYPGGLLPS
Ga0308176_1185287613300031996SoilQFQKDGPWGFYSVDETAARHNASSPEETQDDVLAYARFGPARPAPYRDGLLPPTA
Ga0307416_10136221513300032002RhizosphereRQFQKDGPWGLYCADETAARYNASSPEDTQDYALAYARFPPPEPTRYRDGLLPNG
Ga0335082_1127801723300032782SoilGDGPCVILCASSRQFQKDGPWGFYCADETAARYNAGSPEDTQDGELADARFEEPRKIRYPGGLLPD
Ga0335080_1097382213300032828SoilAFVGAGDEPCVILAASSREFQKDGPWGFYCADEVAGRYNASAPEDTQDGELAYGRFRPSQPTRYRDGLLPG
Ga0335077_10033963103300033158SoilAFVGAGAGPCVILCASSRQFQKDGPWGFYCADETAARYNAGSPEDTQDGELADARFEEPRKVRYPGGLLPD
Ga0247829_1089409713300033550SoilPASPQASSREFQKDGPWGSYCVDETAARHNASSPEETQDYALAYARFAPLKPARYREGLLPNG
Ga0364940_0242137_3_2063300034164SedimentGDSPCVLLCASSRQFQKDGPWGFYCADETAARYNAGSPEDTQDGALADARFPPVQASRYRDGWLPGP
Ga0373959_0105246_22_2073300034820Rhizosphere SoilVLLCASSRQFQKDGPWGYNCADETAARHNASSPEDTQDSEVADARFPPPRETRYPSGLLP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.