Basic Information | |
---|---|
Family ID | F055202 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 139 |
Average Sequence Length | 38 residues |
Representative Sequence | MTRRQAKQIRQQVKAILIQVSLGLAAGLIIGAVLALNL |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 139 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 87.05 % |
% of genes near scaffold ends (potentially truncated) | 12.23 % |
% of genes from short scaffolds (< 2000 bps) | 79.14 % |
Associated GOLD sequencing projects | 79 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (58.993 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (17.266 % of family members) |
Environment Ontology (ENVO) | Unclassified (72.662 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (74.101 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 139 Family Scaffolds |
---|---|---|
PF08681 | DUF1778 | 3.60 |
PF07275 | ArdA | 2.88 |
PF03237 | Terminase_6N | 2.16 |
PF10991 | DUF2815 | 1.44 |
PF05127 | Helicase_RecD | 1.44 |
PF12684 | DUF3799 | 0.72 |
COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
---|---|---|---|
COG4453 | Uncharacterized conserved protein, DUF1778 family | Function unknown [S] | 3.60 |
COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 2.88 |
COG1444 | tRNA(Met) C34 N-acetyltransferase TmcA | Translation, ribosomal structure and biogenesis [J] | 1.44 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 58.99 % |
All Organisms | root | All Organisms | 41.01 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000101|DelMOSum2010_c10064474 | Not Available | 1735 | Open in IMG/M |
3300000101|DelMOSum2010_c10100078 | All Organisms → Viruses → Predicted Viral | 1207 | Open in IMG/M |
3300000101|DelMOSum2010_c10209594 | Not Available | 646 | Open in IMG/M |
3300000116|DelMOSpr2010_c10037778 | Not Available | 2201 | Open in IMG/M |
3300000116|DelMOSpr2010_c10191848 | Not Available | 661 | Open in IMG/M |
3300000928|OpTDRAFT_10452530 | Not Available | 520 | Open in IMG/M |
3300000949|BBAY94_10043274 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
3300001346|JGI20151J14362_10023670 | All Organisms → cellular organisms → Bacteria | 3162 | Open in IMG/M |
3300001349|JGI20160J14292_10045537 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 2038 | Open in IMG/M |
3300001352|JGI20157J14317_10113383 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 936 | Open in IMG/M |
3300001460|JGI24003J15210_10039270 | Not Available | 1657 | Open in IMG/M |
3300005747|Ga0076924_1046983 | Not Available | 1165 | Open in IMG/M |
3300006026|Ga0075478_10099902 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 927 | Open in IMG/M |
3300006027|Ga0075462_10043439 | Not Available | 1435 | Open in IMG/M |
3300006029|Ga0075466_1049611 | All Organisms → Viruses → Predicted Viral | 1242 | Open in IMG/M |
3300006164|Ga0075441_10104007 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 1088 | Open in IMG/M |
3300006752|Ga0098048_1074768 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
3300006793|Ga0098055_1054723 | All Organisms → Viruses → Predicted Viral | 1602 | Open in IMG/M |
3300006793|Ga0098055_1101741 | Not Available | 1122 | Open in IMG/M |
3300006810|Ga0070754_10068727 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 1817 | Open in IMG/M |
3300006810|Ga0070754_10140127 | Not Available | 1164 | Open in IMG/M |
3300006810|Ga0070754_10238000 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 835 | Open in IMG/M |
3300006874|Ga0075475_10312097 | Not Available | 647 | Open in IMG/M |
3300006916|Ga0070750_10109782 | Not Available | 1273 | Open in IMG/M |
3300006916|Ga0070750_10272982 | Not Available | 729 | Open in IMG/M |
3300006919|Ga0070746_10195060 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 967 | Open in IMG/M |
3300006920|Ga0070748_1035480 | All Organisms → Viruses → Predicted Viral | 2028 | Open in IMG/M |
3300006920|Ga0070748_1106477 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1066 | Open in IMG/M |
3300006924|Ga0098051_1058997 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
3300007344|Ga0070745_1227082 | Not Available | 682 | Open in IMG/M |
3300007540|Ga0099847_1095689 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 907 | Open in IMG/M |
3300007540|Ga0099847_1240334 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 522 | Open in IMG/M |
3300009071|Ga0115566_10032798 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium | 3677 | Open in IMG/M |
3300009074|Ga0115549_1037239 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1800 | Open in IMG/M |
3300009074|Ga0115549_1116461 | Not Available | 885 | Open in IMG/M |
3300009149|Ga0114918_10089952 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 1930 | Open in IMG/M |
3300009149|Ga0114918_10604914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 579 | Open in IMG/M |
3300009172|Ga0114995_10550627 | Not Available | 630 | Open in IMG/M |
3300009428|Ga0114915_1000298 | Not Available | 23038 | Open in IMG/M |
3300009428|Ga0114915_1050365 | Not Available | 1344 | Open in IMG/M |
3300009433|Ga0115545_1010256 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 4126 | Open in IMG/M |
3300009435|Ga0115546_1162791 | Not Available | 782 | Open in IMG/M |
3300009438|Ga0115559_1037123 | Not Available | 2201 | Open in IMG/M |
3300009440|Ga0115561_1342877 | Not Available | 549 | Open in IMG/M |
3300009467|Ga0115565_10168708 | Not Available | 1016 | Open in IMG/M |
3300009495|Ga0115571_1066216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Desulfovibrio → unclassified Desulfovibrio → Desulfovibrio sp. | 1629 | Open in IMG/M |
3300009495|Ga0115571_1384885 | Not Available | 549 | Open in IMG/M |
3300009505|Ga0115564_10203463 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 1030 | Open in IMG/M |
3300009507|Ga0115572_10474204 | Not Available | 695 | Open in IMG/M |
3300010883|Ga0133547_10436211 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 2666 | Open in IMG/M |
3300011118|Ga0114922_11634557 | Not Available | 517 | Open in IMG/M |
3300011258|Ga0151677_1130974 | Not Available | 505 | Open in IMG/M |
3300013010|Ga0129327_10079102 | Not Available | 1620 | Open in IMG/M |
3300013010|Ga0129327_10734688 | Not Available | 555 | Open in IMG/M |
3300017697|Ga0180120_10034429 | Not Available | 2326 | Open in IMG/M |
3300017697|Ga0180120_10038530 | Not Available | 2181 | Open in IMG/M |
3300017697|Ga0180120_10326915 | Not Available | 610 | Open in IMG/M |
3300017719|Ga0181390_1063775 | All Organisms → Viruses → Predicted Viral | 1051 | Open in IMG/M |
3300017752|Ga0181400_1075689 | Not Available | 1010 | Open in IMG/M |
3300017752|Ga0181400_1097951 | Not Available | 863 | Open in IMG/M |
3300017762|Ga0181422_1177626 | Not Available | 648 | Open in IMG/M |
3300017786|Ga0181424_10441352 | Not Available | 526 | Open in IMG/M |
3300019098|Ga0188859_1010740 | Not Available | 536 | Open in IMG/M |
3300020166|Ga0206128_1016193 | Not Available | 4428 | Open in IMG/M |
3300020166|Ga0206128_1045785 | All Organisms → Viruses → Predicted Viral | 2168 | Open in IMG/M |
3300021378|Ga0213861_10438197 | Not Available | 633 | Open in IMG/M |
3300021957|Ga0222717_10006889 | All Organisms → cellular organisms → Bacteria | 8106 | Open in IMG/M |
3300021957|Ga0222717_10383908 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 781 | Open in IMG/M |
3300021958|Ga0222718_10123652 | Not Available | 1493 | Open in IMG/M |
3300021959|Ga0222716_10133759 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1636 | Open in IMG/M |
3300021960|Ga0222715_10398983 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 753 | Open in IMG/M |
3300021964|Ga0222719_10295932 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
3300021964|Ga0222719_10678267 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 586 | Open in IMG/M |
3300022053|Ga0212030_1018665 | Not Available | 923 | Open in IMG/M |
3300022065|Ga0212024_1020977 | Not Available | 1066 | Open in IMG/M |
3300022169|Ga0196903_1004493 | Not Available | 1836 | Open in IMG/M |
3300022187|Ga0196899_1032843 | Not Available | 1808 | Open in IMG/M |
3300022187|Ga0196899_1096619 | Not Available | 881 | Open in IMG/M |
3300022187|Ga0196899_1106851 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 822 | Open in IMG/M |
(restricted) 3300024059|Ga0255040_10000071 | Not Available | 20517 | Open in IMG/M |
(restricted) 3300024059|Ga0255040_10018984 | Not Available | 2359 | Open in IMG/M |
(restricted) 3300024059|Ga0255040_10436525 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 557 | Open in IMG/M |
3300024231|Ga0233399_1145640 | Not Available | 508 | Open in IMG/M |
3300024294|Ga0228664_1118631 | Not Available | 551 | Open in IMG/M |
3300024359|Ga0228628_1097943 | Not Available | 558 | Open in IMG/M |
(restricted) 3300024519|Ga0255046_10621208 | Not Available | 521 | Open in IMG/M |
3300025084|Ga0208298_1101531 | Not Available | 521 | Open in IMG/M |
3300025108|Ga0208793_1028924 | Not Available | 1863 | Open in IMG/M |
3300025108|Ga0208793_1073386 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
3300025120|Ga0209535_1037735 | All Organisms → Viruses → Predicted Viral | 2197 | Open in IMG/M |
3300025276|Ga0208814_1008957 | Not Available | 3673 | Open in IMG/M |
3300025483|Ga0209557_1011866 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium | 3213 | Open in IMG/M |
3300025508|Ga0208148_1001343 | Not Available | 9122 | Open in IMG/M |
3300025543|Ga0208303_1060072 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 895 | Open in IMG/M |
3300025577|Ga0209304_1041075 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1275 | Open in IMG/M |
3300025608|Ga0209654_1017940 | Not Available | 2718 | Open in IMG/M |
3300025617|Ga0209138_1103721 | Not Available | 826 | Open in IMG/M |
3300025620|Ga0209405_1173108 | Not Available | 535 | Open in IMG/M |
3300025626|Ga0209716_1003196 | All Organisms → cellular organisms → Bacteria | 10244 | Open in IMG/M |
3300025626|Ga0209716_1005185 | Not Available | 7182 | Open in IMG/M |
3300025626|Ga0209716_1135013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Desulfovibrio → unclassified Desulfovibrio → Desulfovibrio sp. | 656 | Open in IMG/M |
3300025641|Ga0209833_1036215 | Not Available | 1791 | Open in IMG/M |
3300025668|Ga0209251_1075300 | Not Available | 1038 | Open in IMG/M |
3300025767|Ga0209137_1092797 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
3300025767|Ga0209137_1159041 | Not Available | 810 | Open in IMG/M |
3300025803|Ga0208425_1022298 | Not Available | 1677 | Open in IMG/M |
3300025849|Ga0209603_1225558 | Not Available | 698 | Open in IMG/M |
3300025880|Ga0209534_10068241 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2161 | Open in IMG/M |
3300027752|Ga0209192_10026787 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
3300027820|Ga0209578_10311404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 730 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10091940 | Not Available | 1325 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10163617 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10172135 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 989 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10225429 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 793 | Open in IMG/M |
3300028008|Ga0228674_1042581 | Not Available | 1759 | Open in IMG/M |
3300028008|Ga0228674_1090667 | Not Available | 1079 | Open in IMG/M |
3300031519|Ga0307488_10128742 | Not Available | 1802 | Open in IMG/M |
3300031519|Ga0307488_10341006 | Not Available | 948 | Open in IMG/M |
3300031539|Ga0307380_10307051 | Not Available | 1469 | Open in IMG/M |
3300031539|Ga0307380_10433428 | All Organisms → Viruses → Predicted Viral | 1175 | Open in IMG/M |
3300031565|Ga0307379_10376213 | Not Available | 1370 | Open in IMG/M |
3300031565|Ga0307379_10799387 | Not Available | 831 | Open in IMG/M |
3300031565|Ga0307379_11074080 | Not Available | 679 | Open in IMG/M |
3300031565|Ga0307379_11137562 | Not Available | 653 | Open in IMG/M |
3300031566|Ga0307378_10426214 | Not Available | 1211 | Open in IMG/M |
3300031566|Ga0307378_10820841 | Not Available | 781 | Open in IMG/M |
3300031566|Ga0307378_11200934 | Not Available | 600 | Open in IMG/M |
3300031578|Ga0307376_10038947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 3533 | Open in IMG/M |
3300031578|Ga0307376_10189291 | All Organisms → Viruses → Predicted Viral | 1408 | Open in IMG/M |
3300031622|Ga0302126_10025764 | Not Available | 2637 | Open in IMG/M |
3300031638|Ga0302125_10031761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1850 | Open in IMG/M |
3300031638|Ga0302125_10126492 | Not Available | 824 | Open in IMG/M |
3300031658|Ga0307984_1004973 | Not Available | 5137 | Open in IMG/M |
3300032088|Ga0315321_10198229 | Not Available | 1320 | Open in IMG/M |
3300032277|Ga0316202_10020059 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium | 3283 | Open in IMG/M |
3300032277|Ga0316202_10057801 | Not Available | 1812 | Open in IMG/M |
3300032277|Ga0316202_10080076 | All Organisms → Viruses → Predicted Viral | 1514 | Open in IMG/M |
3300032277|Ga0316202_10115374 | All Organisms → Viruses → Predicted Viral | 1244 | Open in IMG/M |
3300032277|Ga0316202_10211543 | Not Available | 900 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 17.27% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 13.67% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 10.79% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 7.91% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.47% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.04% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.32% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 4.32% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 3.60% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.60% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.60% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.88% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.88% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.16% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.16% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.44% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.44% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.44% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.72% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.72% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.72% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.72% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.72% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.72% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
3300019098 | Metatranscriptome of marine microbial communities from Baltic Sea - GS684_0p1 | Environmental | Open in IMG/M |
3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
3300024231 | Seawater microbial communities from Monterey Bay, California, United States - 43D | Environmental | Open in IMG/M |
3300024294 | Seawater microbial communities from Monterey Bay, California, United States - 78D | Environmental | Open in IMG/M |
3300024359 | Seawater microbial communities from Monterey Bay, California, United States - 34D | Environmental | Open in IMG/M |
3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
3300025668 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
3300031638 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_surface | Environmental | Open in IMG/M |
3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2010_100644743 | 3300000101 | Marine | MTRRQEKQICQQVKAALIQIVLGFAAGLIIGAVLALNL* |
DelMOSum2010_101000783 | 3300000101 | Marine | MTRRQPKQIRRQVKAILTQVSLGIAAGLIIGAVLALNL* |
DelMOSum2010_102095942 | 3300000101 | Marine | MTRRQAKQVRQQVKAILTQVSLGLAAGLIIGAVLALNL* |
DelMOSpr2010_100377785 | 3300000116 | Marine | MTRHQEKQVYQQVKAILIQVILGLAAGLIIGAVLALNL* |
DelMOSpr2010_101918482 | 3300000116 | Marine | RARRGGGIMTRRQNKAIRQQVKAALIQIGLGFAAGIAIATVLSMNL* |
OpTDRAFT_104525302 | 3300000928 | Freshwater And Marine | MTRRQNKAIRQQAKAALIQIGLGFAAGLTIATVLFMNL* |
BBAY94_100432742 | 3300000949 | Macroalgal Surface | MTRRQRKAIRQQVKAALIQIGLGLAAGLIIAAVLFLNL* |
JGI20151J14362_100236705 | 3300001346 | Pelagic Marine | MTRRQAKQIRQQVKAILIQVSLGLAAGLIIGAVLALNL* |
JGI20160J14292_100455374 | 3300001349 | Pelagic Marine | MTRRQEKQVRQQVKAALIQIGLGFAAGLAIATVLLLNL* |
JGI20157J14317_101133832 | 3300001352 | Pelagic Marine | MTRRQAKQIRQQVRAILTQVGLGLAAGLIIGAVLALNL* |
JGI24003J15210_100392702 | 3300001460 | Marine | MTRRQNKAIRQQVKASLIQIGLGFAAGIAIATVLFMNL* |
Ga0076924_10469832 | 3300005747 | Marine | MTRRQTKQIRQRVKVALIQIVLGFAAGLAIATVLFLNL* |
Ga0075478_100999022 | 3300006026 | Aqueous | MTRRQEKQVHQQVKAILTQVILGLAAGLIIGAVLALNL* |
Ga0075462_100434394 | 3300006027 | Aqueous | MTRRQEKQIRQQVKAALIQIVLGFAAGLIVGAVLALNL* |
Ga0075466_10496112 | 3300006029 | Aqueous | MTRRQAKQVRQQVKAILTQVSLGLAAGLIIGAALALNL* |
Ga0075441_101040073 | 3300006164 | Marine | MTRRQRKAIRQQVRAILLQISLGACAGLAIGAVLFLNL* |
Ga0098048_10747684 | 3300006752 | Marine | MTRRQNKAIRQQVKAALIQIGLGFAAGLIIATVLFLNL* |
Ga0098055_10547234 | 3300006793 | Marine | MTRRQAKQIRQQVKAALIQIGLGFAAGLAIATVLFLNL* |
Ga0098055_11017412 | 3300006793 | Marine | MMTRRQSKAIRQQVKAALIQIVLGFAAGLAIATVLFLNL* |
Ga0070754_100687275 | 3300006810 | Aqueous | MTRRQAKQVRQQVKAVLTQVSLGLAAGLIIGAVLALNL* |
Ga0070754_101401272 | 3300006810 | Aqueous | MTRRQAKQIRQQVKAILTQVSLGLAAGLIIGAVLALNL* |
Ga0070754_102380002 | 3300006810 | Aqueous | MTRRQAKQIRQQVRAILTQVSLGLAAGLIIGAVLALNL* |
Ga0075475_103120973 | 3300006874 | Aqueous | MTRRQTKQIRQQVKAILTQVSLGLAAGLIIGAVLALNL* |
Ga0070750_101097825 | 3300006916 | Aqueous | GGIDSMTRRQAKQVRQQVKAILTQVSLGLAAGLIIGAALALNL* |
Ga0070750_102729823 | 3300006916 | Aqueous | MTRRQAKQVRQQVKAILTQVGLGIAAGLIIGAVLALNL* |
Ga0070746_101950602 | 3300006919 | Aqueous | MTRRQEKQVRQQVKAILIQVILGLAAGLIIGAVLALNL* |
Ga0070748_10354803 | 3300006920 | Aqueous | MTRRQTKQIRQQVKAILTQVSLGIAAGLIIGAVLALNL* |
Ga0070748_11064773 | 3300006920 | Aqueous | MTRRQAKQVRQQVKAILTQVSLGVAAGLIIGAVLALNL* |
Ga0098051_10589973 | 3300006924 | Marine | MTRRQSKAIRQQVKAALIQIVLGFAAGLAIATVLFLNL* |
Ga0070745_12270822 | 3300007344 | Aqueous | MTRRQEKQVRQRVKAILTQVSLGIAAGLIIGAALALNL* |
Ga0099847_10956891 | 3300007540 | Aqueous | MTRRQAKQVRRQVKAILTQVSLGLAAGLIIGAVLALNL* |
Ga0099847_12403341 | 3300007540 | Aqueous | QTKQIRQQVKAILTQVSLGIAAGLIIGAVLALNL* |
Ga0115566_100327984 | 3300009071 | Pelagic Marine | MTRRQEKQIRQQVKVALFQIGLGLAAGLIIGAVLALNL* |
Ga0115549_10372394 | 3300009074 | Pelagic Marine | MTRRQAKQIRQQVKAILTQVSLGIAAGLIIGAVLALNL* |
Ga0115549_11164612 | 3300009074 | Pelagic Marine | MTRRQAKQIRQQVKAILIQIGLGLAAGLIIGAVLALNL* |
Ga0114918_100899525 | 3300009149 | Deep Subsurface | MTRRQSKLIRQQVRAILLQISLGAYAGLAIGAVLFLNL* |
Ga0114918_106049142 | 3300009149 | Deep Subsurface | MTRRQSKLIRQQVRAILLQISLGACAGLAIGAVLFLNL* |
Ga0114995_105506272 | 3300009172 | Marine | MTRRQSKIIRQQVRAILLQISLGACAGLAIGAVLFLNL* |
Ga0114915_10002982 | 3300009428 | Deep Ocean | MTRRQRKAIRQQVRAILLQISLGACAGLAIGAALFLNL* |
Ga0114915_10503652 | 3300009428 | Deep Ocean | MTRRQRKAIRQQVRAALIQITLGACAGLAIGAALFLNL* |
Ga0115545_10102561 | 3300009433 | Pelagic Marine | RSSIMTRRQAKQIRRQVKAILIQVSLGLAAGLIIGAVLALNL* |
Ga0115546_11627911 | 3300009435 | Pelagic Marine | RGYNNGGIDSMTRRQAKQIRQQVKAILIQVSLGLAAGLIIGAVLALNL* |
Ga0115559_10371234 | 3300009438 | Pelagic Marine | MTRRQAKQVHQQVKAILTQVSLGLAAGLIIGAVLALNL* |
Ga0115561_13428773 | 3300009440 | Pelagic Marine | MTRRQAKQIRQQVKAILTQVGLGLAAGLIIGAVLALNL* |
Ga0115565_101687081 | 3300009467 | Pelagic Marine | MTRRQAKQIRQQVKAILIQVGLGIAAGLIIGAVLALNL* |
Ga0115571_10662164 | 3300009495 | Pelagic Marine | MTRRQAKQVRQQVKEILTQVSLGLAAGLIIGAVLALNL* |
Ga0115571_13848852 | 3300009495 | Pelagic Marine | MTRRQEKQVRQQVKAILTQVSLGIAAGLIIGAVLALNL* |
Ga0115564_102034632 | 3300009505 | Pelagic Marine | MTRRQTKQVRQQVKAILTQVSLGIAAGLIIGAVALNL* |
Ga0115572_104742041 | 3300009507 | Pelagic Marine | MTRRQSKQIRQQVKTALIQIGLGFAAGLMIATVLFLNL* |
Ga0133547_104362116 | 3300010883 | Marine | MTLRQSKIIRRQVRAILLQISLGACAGLAIGAVLFLNL* |
Ga0114922_116345572 | 3300011118 | Deep Subsurface | MTRRQSKQIRQQVKAILTQVSLGLAAGLIIGAVLALNL* |
Ga0151677_11309742 | 3300011258 | Marine | MTRRQLKAVRQQVRAALIQISLGACAGLIIGAVLFLNL* |
Ga0129327_100791025 | 3300013010 | Freshwater To Marine Saline Gradient | MTHRQAKQIRQQVKSALIQIVLGFAAGLAIATVLFLNL* |
Ga0129327_107346882 | 3300013010 | Freshwater To Marine Saline Gradient | MTRRQEKQIRQQVKAALIQIGLGFAAGLIIATVLSLNL* |
Ga0180120_100344293 | 3300017697 | Freshwater To Marine Saline Gradient | MTHRQAKQIRQQVKSALIQIVLGFAAGLAIATVLFLNL |
Ga0180120_100385306 | 3300017697 | Freshwater To Marine Saline Gradient | MTRRQEKQIRQQVKAALIQIGLGFAAGLIIATVLSLNL |
Ga0180120_103269152 | 3300017697 | Freshwater To Marine Saline Gradient | MTRRQEKQIRQQVKAALIQIVLGLAAGLIIGAVLALNL |
Ga0181390_10637751 | 3300017719 | Seawater | MTRRQNKAIRQQVKAALIQIGLGFAAGIAIATVLSMNL |
Ga0181400_10756891 | 3300017752 | Seawater | KEVMTRRQNKAIHQQVKAALIQIGLGFAAGIAIATVLSMNL |
Ga0181400_10979512 | 3300017752 | Seawater | MTRRQSKEIRQQVRAALIQISLGACAGLIIGAVLFLNL |
Ga0181422_11776263 | 3300017762 | Seawater | MTRRQNKAIRQQVKAALIQIGLGACAGLIIGAVLFMNL |
Ga0181424_104413522 | 3300017786 | Seawater | MTRRQNKAIHQQVKAALIQIGLGCAAGLAIATVLSLNL |
Ga0188859_10107402 | 3300019098 | Freshwater Lake | MTRRQTKRVRQQVKAELIQVGLGLAAGLIIGAVLALNL |
Ga0206128_10161936 | 3300020166 | Seawater | MTRRQTKQIRQQVKAILTQVSLGIAAGIIIGAVLALNL |
Ga0206128_10457854 | 3300020166 | Seawater | MTRRQAKQVRQQVKAILTQVSLGLAAGLIIGAVLALNL |
Ga0213861_104381972 | 3300021378 | Seawater | MTRRQAKQVRQQVKAILTQVSLGLAAGLIIGAALALNL |
Ga0222717_1000688918 | 3300021957 | Estuarine Water | MTRRQNKAIRQQVKAAMIQIGLGFAAGLTIATVLFMNL |
Ga0222717_103839082 | 3300021957 | Estuarine Water | MTRRQTKQIRQQVKAILTQVSLGIAAGLIIGAVLALNL |
Ga0222718_101236524 | 3300021958 | Estuarine Water | MTRRQAKQVRQQVKAILTQVSLGIAAGLIIGAVLALNL |
Ga0222716_101337594 | 3300021959 | Estuarine Water | MTRRQAKQIRQQVKAILTQVSLGLAAGLIIGAVLALNL |
Ga0222715_103989832 | 3300021960 | Estuarine Water | MTRRQSKAIRQQVRAALIQISLGVCAGLVIGAVLFLNL |
Ga0222719_102959325 | 3300021964 | Estuarine Water | MTRRQAKQIRQQVKAILIQVSLGLAAGLIIGAVLALNL |
Ga0222719_106782673 | 3300021964 | Estuarine Water | MMTRRQAKQIRQQVKAILTQVSLGIAAGLIIGAVLALNL |
Ga0212030_10186652 | 3300022053 | Aqueous | MTRRQPKQIRRQVKAILTQVSLGIAAGLIIGAVLALNL |
Ga0212024_10209773 | 3300022065 | Aqueous | MTRRQEKQIRQQVKAALIQIVLGFAAGLIVGAVLALNL |
Ga0196903_10044932 | 3300022169 | Aqueous | MTRRQEKQVHQQVKAILTQVILGLAAGLIIGAVLALNL |
Ga0196899_10328436 | 3300022187 | Aqueous | MTRRQAKQVRQQVKAVLTQVSLGLAAGLIIGAVLALNL |
Ga0196899_10966194 | 3300022187 | Aqueous | NNGGIDSMTRRQAKQIRQQVKAILTQVSLGLAAGLIIGAVLALNL |
Ga0196899_11068512 | 3300022187 | Aqueous | MTRRQAKQIRQQVRAILTQVSLGLAAGLIIGAVLALNL |
(restricted) Ga0255040_1000007132 | 3300024059 | Seawater | MTRRQSKAIRQQVKAALIQIGLGFAAGLAIAAVLFLNL |
(restricted) Ga0255040_100189844 | 3300024059 | Seawater | MTRRQRKAVRQQVRAALIQIGLGACAGLIIGAVLFLNL |
(restricted) Ga0255040_104365252 | 3300024059 | Seawater | MTRRQNKAIRQQVKTALIQIGLGACAGLIIGAVLFLNL |
Ga0233399_11456402 | 3300024231 | Seawater | MTRRQNKAIRQQVKAALIQIGLGFAAGIAIATVLFLNL |
Ga0228664_11186313 | 3300024294 | Seawater | RQNKAIRQQVKAALIQIALGFAAGLAIATVLFLNL |
Ga0228628_10979432 | 3300024359 | Seawater | MTRRQRKAVRQQVRAALIQISLGACAGLIIGAALFLNL |
(restricted) Ga0255046_106212082 | 3300024519 | Seawater | NNGGIDSMTRRQAKQVRQQVKAILTQVSLGLAAGLIIGAVLALNL |
Ga0208298_11015311 | 3300025084 | Marine | MTRRQSKAIRQQVKAALIQIVLGFAAGLAIATVLFLNL |
Ga0208793_10289243 | 3300025108 | Marine | MMTRRQSKAIRQQVKAALIQIVLGFAAGLAIATVLFLNL |
Ga0208793_10733863 | 3300025108 | Marine | MTRRQAKQIRQQVKAALIQIGLGFAAGLAIATVLFLNL |
Ga0209535_10377353 | 3300025120 | Marine | MTRRQNKAIRQQVKASLIQIGLGFAAGIAIATVLFMNL |
Ga0208814_100895710 | 3300025276 | Deep Ocean | MTRRQRKAIRQQVRAILLQISLGACAGLAIGAVLFLNL |
Ga0209557_10118663 | 3300025483 | Marine | MTRRQNKAIRQQVKASLIQIALGFAAGLAIATVLSMNL |
Ga0208148_100134313 | 3300025508 | Aqueous | MTRRQEKQICQQVKAALIQIVLGFAAGLIIGAVLALNL |
Ga0208303_10600721 | 3300025543 | Aqueous | MTRRQAKQVRRQVKAILTQVSLGLAAGLIIGAVLALNL |
Ga0209304_10410752 | 3300025577 | Pelagic Marine | MTRRQAKQIRQQVKAILTQVSLGIAAGLIIGAVLALNL |
Ga0209654_10179404 | 3300025608 | Marine | MTRRQSKAVRQQVKAALIQIGLGVCAGLTIGAALFLNL |
Ga0209138_11037213 | 3300025617 | Marine | MTRRRSKAVRQQVKAALIQIGLGVCAGLTIGAALFLNL |
Ga0209405_11731083 | 3300025620 | Pelagic Marine | SMTRRQAKQIRQQVKAILTQVSLGIAAGLIIGAVLALNL |
Ga0209716_100319617 | 3300025626 | Pelagic Marine | MTRRQEKQVRQQVKAALIQIGLGFAAGLAIATVLLLNL |
Ga0209716_100518510 | 3300025626 | Pelagic Marine | MTRRQAKQVRQQVKAILTQVSLGVAAGLIIGAVLALNL |
Ga0209716_11350132 | 3300025626 | Pelagic Marine | MTRRQAKQVRQQVKEILTQVSLGLAAGLIIGAVLALNL |
Ga0209833_10362154 | 3300025641 | Pelagic Marine | MTRRQAKQVHQQVKAILTQVSLGLAAGLIIGAVLALNL |
Ga0209251_10753002 | 3300025668 | Marine | MTRRQSKAIRQQVKAALIQIGLGFAAGIAIATVLSMNL |
Ga0209137_10927972 | 3300025767 | Marine | MTRRQRKTVRQQVRAALFQIGLGACAGLIIGAALFLNL |
Ga0209137_11590412 | 3300025767 | Marine | MTRRQRKTVRQQVRAALFQIGLGACAGLIIGAVLFLNL |
Ga0208425_10222986 | 3300025803 | Aqueous | NGGTDSMTRRQAKQVRQQVKAILTQVSLGLAAGLIIGAVLALNL |
Ga0209603_12255581 | 3300025849 | Pelagic Marine | GRCYHRRSIMTRRQAKQVRQQVKEILTQVSLGLAAGLIIGAVLALNL |
Ga0209534_100682413 | 3300025880 | Pelagic Marine | MTRRQAKQIRQQVRAILTQVGLGLAAGLIIGAVLALNL |
Ga0209192_100267875 | 3300027752 | Marine | MTRRQSKLIRQQVRAILLQISLGACAGLAIGAVLFLNL |
Ga0209578_103114042 | 3300027820 | Marine Sediment | MTRRQTKQIRQRVKVALIQIVLGFAAGLAIATVLFLNL |
(restricted) Ga0233415_100919403 | 3300027861 | Seawater | MTRRQSKAIRKQVKAALIQIGLGFAAGLAIAAVLFLNL |
(restricted) Ga0233415_101636172 | 3300027861 | Seawater | MTRRQNKAIRLQVKAALIQIGLGFAAGIAIATVLSMNL |
(restricted) Ga0233415_101721352 | 3300027861 | Seawater | MTRRQNKAIRQQVRAALIQIGLGACAGLIIGAVLFLNL |
(restricted) Ga0233413_102254292 | 3300027996 | Seawater | MTRRQNKAIRQQVKTALIQIGLGACAGLIIGAVLFMNL |
Ga0228674_10425813 | 3300028008 | Seawater | MTRRQSKAIRQQVKAALIQIGLGACAGFIIGAVLFMNL |
Ga0228674_10906672 | 3300028008 | Seawater | MTRRQNKAIRQQVKAALIQIALGFAAGLAIATVLFLNL |
Ga0307488_101287422 | 3300031519 | Sackhole Brine | MTRRQSKLIRQQVTAILLQISLGACAGLAIGAVLFLNL |
Ga0307488_103410064 | 3300031519 | Sackhole Brine | MTRRQNKAIRQQVKASLIQIGLGFAAGIAIATVLSMNL |
Ga0307380_103070515 | 3300031539 | Soil | MTRRQTKQVRQQVKAILTQVSLGIAAGLIIGAVLALNL |
Ga0307380_104334282 | 3300031539 | Soil | MTRRQTKQVRQQVKAILTQVSLGLAAGLIIGAVLALNL |
Ga0307379_103762134 | 3300031565 | Soil | MTRRQTKQIRQQVKAILTQVSLGLAAGLIIGAVLALNL |
Ga0307379_107993873 | 3300031565 | Soil | MTRRQAKQIRQQVRAILTQVSLGIAAGLIIGAVLALNL |
Ga0307379_110740802 | 3300031565 | Soil | MTRRQAKQIRQQVKAILTQVSLGIVAGLIIGAVLALNL |
Ga0307379_111375622 | 3300031565 | Soil | MTRRQSKIIRQQVTAILLQISLGACAGLAIGAVLFLNL |
Ga0307378_104262142 | 3300031566 | Soil | MNRRQSKIIRQQVRTILLQISLGACAGLAIGAVLFLNL |
Ga0307378_108208414 | 3300031566 | Soil | SSMTRRQSKIIRQQVTAILLQISLGACAGLAIGAVLFLNL |
Ga0307378_112009342 | 3300031566 | Soil | MTRRQAKQVRQQVRAILTQVSLGIAAGLIIGAVLALNL |
Ga0307376_100389476 | 3300031578 | Soil | MTRRQTKQIRQQVKAILTQVSLGLVAGLIIGAVLALNL |
Ga0307376_101892914 | 3300031578 | Soil | MTRRQAKQVRQQVKAILTQVGLGLAAGLIIGAVLALNL |
Ga0302126_100257646 | 3300031622 | Marine | MTRRQSKIIRQQVRAILLQISLGACAGLAIGAVLFLNL |
Ga0302125_100317616 | 3300031638 | Marine | TSWKGSNMTRRQSKIIRQQVRAILLQISLGACAGLAIGAVLFLNL |
Ga0302125_101264921 | 3300031638 | Marine | RQSKLIRQQVRAILLQISLGACAGLAIGAVLFLNL |
Ga0307984_10049737 | 3300031658 | Marine | MTRRQNKALRQQVRAILLQISLGTCAGLAIGAALFLNL |
Ga0315321_101982292 | 3300032088 | Seawater | MTRRQNKAIRQQVKAALIQIALGFAAGLAIATVLFMNL |
Ga0316202_100200598 | 3300032277 | Microbial Mat | MTRRQTKQVRQQVKAIFTQVSLGLAAGLIIGAVLALNL |
Ga0316202_100578013 | 3300032277 | Microbial Mat | MTRRQAKQVRQQVRAILIQVSLGLAAGLIIGAVLALNL |
Ga0316202_100800763 | 3300032277 | Microbial Mat | MMTRRQEKQVRQQVKAILIQVILGLAAGLIIGAVLALNL |
Ga0316202_101153742 | 3300032277 | Microbial Mat | MTRRQEKQIRQQVKAALIQIVLGFAAGLIIGAVLALNL |
Ga0316202_102115433 | 3300032277 | Microbial Mat | MTRRQTKQIRQQVKSALIQIVFGFAAGLIIGAVLALNL |
⦗Top⦘ |