| Basic Information | |
|---|---|
| Family ID | F055173 |
| Family Type | Metagenome |
| Number of Sequences | 139 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ADEVVNLIFKAVAEHASGEEAFDDQTVVAIRVKGTPGKRK |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.77 % |
| % of genes near scaffold ends (potentially truncated) | 79.14 % |
| % of genes from short scaffolds (< 2000 bps) | 69.06 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.137 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.669 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.302 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.043 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.59% β-sheet: 0.00% Coil/Unstructured: 79.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF02784 | Orn_Arg_deC_N | 85.61 |
| PF07969 | Amidohydro_3 | 2.16 |
| PF12697 | Abhydrolase_6 | 1.44 |
| PF01728 | FtsJ | 1.44 |
| PF00756 | Esterase | 0.72 |
| PF00188 | CAP | 0.72 |
| PF13561 | adh_short_C2 | 0.72 |
| PF00270 | DEAD | 0.72 |
| PF01513 | NAD_kinase | 0.72 |
| PF03952 | Enolase_N | 0.72 |
| PF06262 | Zincin_1 | 0.72 |
| PF07228 | SpoIIE | 0.72 |
| PF13185 | GAF_2 | 0.72 |
| PF04542 | Sigma70_r2 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 85.61 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 85.61 |
| COG0293 | 23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ | Translation, ribosomal structure and biogenesis [J] | 1.44 |
| COG1189 | Predicted rRNA methylase YqxC, contains S4 and FtsJ domains | Translation, ribosomal structure and biogenesis [J] | 1.44 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.72 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.72 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.72 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.72 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.72 |
| COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.14 % |
| Unclassified | root | N/A | 20.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004080|Ga0062385_11197859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 519 | Open in IMG/M |
| 3300004082|Ga0062384_100221438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1130 | Open in IMG/M |
| 3300004091|Ga0062387_100731150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 729 | Open in IMG/M |
| 3300004114|Ga0062593_100177081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1663 | Open in IMG/M |
| 3300005295|Ga0065707_10124428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2044 | Open in IMG/M |
| 3300005445|Ga0070708_100675367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 973 | Open in IMG/M |
| 3300005447|Ga0066689_10007499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4762 | Open in IMG/M |
| 3300005538|Ga0070731_11166363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 509 | Open in IMG/M |
| 3300005540|Ga0066697_10679640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 565 | Open in IMG/M |
| 3300005561|Ga0066699_10068683 | All Organisms → cellular organisms → Bacteria | 2247 | Open in IMG/M |
| 3300005598|Ga0066706_10494925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 974 | Open in IMG/M |
| 3300005712|Ga0070764_11054331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 514 | Open in IMG/M |
| 3300006028|Ga0070717_10078559 | All Organisms → cellular organisms → Bacteria | 2765 | Open in IMG/M |
| 3300006086|Ga0075019_10958351 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300006102|Ga0075015_100892368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300006172|Ga0075018_10000697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 10549 | Open in IMG/M |
| 3300006172|Ga0075018_10009009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3646 | Open in IMG/M |
| 3300006796|Ga0066665_10137913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1838 | Open in IMG/M |
| 3300006893|Ga0073928_10573314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 800 | Open in IMG/M |
| 3300006954|Ga0079219_11244317 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300007788|Ga0099795_10560452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300009525|Ga0116220_10021528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2604 | Open in IMG/M |
| 3300010048|Ga0126373_10823853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
| 3300010329|Ga0134111_10278646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300010398|Ga0126383_11807869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300011270|Ga0137391_10115475 | All Organisms → cellular organisms → Bacteria | 2329 | Open in IMG/M |
| 3300012096|Ga0137389_10429877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1129 | Open in IMG/M |
| 3300012198|Ga0137364_10307559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1178 | Open in IMG/M |
| 3300012201|Ga0137365_11164561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300012208|Ga0137376_11348126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300012923|Ga0137359_11443649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300012927|Ga0137416_10760228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300012929|Ga0137404_10113205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2207 | Open in IMG/M |
| 3300012930|Ga0137407_12050955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300012948|Ga0126375_11517852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300012971|Ga0126369_10007441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8222 | Open in IMG/M |
| 3300012987|Ga0164307_11566508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300014155|Ga0181524_10158131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1162 | Open in IMG/M |
| 3300014156|Ga0181518_10598705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300014158|Ga0181521_10056708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2649 | Open in IMG/M |
| 3300014638|Ga0181536_10476543 | Not Available | 546 | Open in IMG/M |
| 3300014658|Ga0181519_10019514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4821 | Open in IMG/M |
| 3300015054|Ga0137420_1186009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300015089|Ga0167643_1052701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 614 | Open in IMG/M |
| 3300017822|Ga0187802_10225466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 723 | Open in IMG/M |
| 3300017933|Ga0187801_10118045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1017 | Open in IMG/M |
| 3300017933|Ga0187801_10137808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
| 3300017933|Ga0187801_10490715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300017943|Ga0187819_10801687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300017948|Ga0187847_10107211 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300017955|Ga0187817_10987460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300017959|Ga0187779_11310313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300017966|Ga0187776_10378547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 941 | Open in IMG/M |
| 3300017970|Ga0187783_10521839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300017970|Ga0187783_11243596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300017974|Ga0187777_10121785 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
| 3300018002|Ga0187868_1191558 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300018012|Ga0187810_10449420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 546 | Open in IMG/M |
| 3300018014|Ga0187860_1099015 | Not Available | 1329 | Open in IMG/M |
| 3300018034|Ga0187863_10545101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 651 | Open in IMG/M |
| 3300018035|Ga0187875_10407896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300018042|Ga0187871_10065068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2153 | Open in IMG/M |
| 3300018057|Ga0187858_10756924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300018058|Ga0187766_10455673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
| 3300018085|Ga0187772_10236357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1237 | Open in IMG/M |
| 3300018090|Ga0187770_10336600 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300019787|Ga0182031_1391850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1636 | Open in IMG/M |
| 3300020580|Ga0210403_10232959 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300020580|Ga0210403_10874807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300020580|Ga0210403_11458427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300020583|Ga0210401_10963007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas fluorescens group → Pseudomonas fluorescens | 712 | Open in IMG/M |
| 3300020583|Ga0210401_11202945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300021168|Ga0210406_11090871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300021171|Ga0210405_10929843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300021171|Ga0210405_11379635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300021405|Ga0210387_10619472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
| 3300021407|Ga0210383_11773307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300021478|Ga0210402_10696703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 939 | Open in IMG/M |
| 3300021479|Ga0210410_10516380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1066 | Open in IMG/M |
| 3300021479|Ga0210410_10703926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 892 | Open in IMG/M |
| 3300025460|Ga0208562_1110140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300025916|Ga0207663_11301077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300026998|Ga0208369_1022996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300027069|Ga0208859_1036792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300027432|Ga0209421_1133170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 513 | Open in IMG/M |
| 3300027663|Ga0208990_1177930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300027676|Ga0209333_1005072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4622 | Open in IMG/M |
| 3300027676|Ga0209333_1043853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1238 | Open in IMG/M |
| 3300027867|Ga0209167_10172630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1143 | Open in IMG/M |
| 3300027895|Ga0209624_10136342 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300027903|Ga0209488_10963851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300027986|Ga0209168_10202565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 993 | Open in IMG/M |
| 3300027986|Ga0209168_10652238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300028536|Ga0137415_10670853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300028646|Ga0302159_10127577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300029889|Ga0246001_1095953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300031232|Ga0302323_100635664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1160 | Open in IMG/M |
| 3300031235|Ga0265330_10010033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4479 | Open in IMG/M |
| 3300031715|Ga0307476_10196882 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300031715|Ga0307476_10701577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300031753|Ga0307477_10005334 | All Organisms → cellular organisms → Bacteria | 9205 | Open in IMG/M |
| 3300031820|Ga0307473_10725382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300031821|Ga0318567_10671165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300032160|Ga0311301_11138415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1009 | Open in IMG/M |
| 3300032180|Ga0307471_102407198 | Not Available | 665 | Open in IMG/M |
| 3300032180|Ga0307471_103202715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300032783|Ga0335079_11808197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300032805|Ga0335078_10011561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13099 | Open in IMG/M |
| 3300032829|Ga0335070_11354352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300032954|Ga0335083_10569875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 937 | Open in IMG/M |
| 3300032955|Ga0335076_11566224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300033807|Ga0314866_009778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1256 | Open in IMG/M |
| 3300034090|Ga0326723_0387857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.47% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.04% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.32% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.60% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.60% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.60% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.16% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.16% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.44% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.44% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.72% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.72% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.72% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.72% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.72% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062385_111978591 | 3300004080 | Bog Forest Soil | SADQVVKSIFQAVAEHASGEEAFDDQTVVAIRVKGTPGKRK* |
| Ga0062384_1002214382 | 3300004082 | Bog Forest Soil | IVAGCATKSADCVVNEIFKAVTEHAAGVDTFDDQTVVAIKVKSDSSKRK* |
| Ga0062387_1007311502 | 3300004091 | Bog Forest Soil | NSDATASPAMVVKAIFKAVAEHAAGQDAFDDQTVVAIRVKGAPGKRK* |
| Ga0062593_1001770813 | 3300004114 | Soil | GCADISADCVVKSLFKAVTEHAAGEEAFDDETVVAIKVKGDPKRK* |
| Ga0065707_101244283 | 3300005295 | Switchgrass Rhizosphere | KSAECVVTSLFKAVAKYSAGVESFDDQTVVAIKVKETPPKRK* |
| Ga0068869_1000483794 | 3300005334 | Miscanthus Rhizosphere | AECVVTSLFKAVAKYSAGVESFDDQTVVAIKVKETPPKRK* |
| Ga0070667_1014248521 | 3300005367 | Switchgrass Rhizosphere | CAEISADCVVKSLFKAAAEHSGGEEAFDDETVVAIKVKGETKRK* |
| Ga0070708_1006753671 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VNNIFKAVAEHAAGVDPFDDQTVVAIRVKDRSGAPAGSGKRR* |
| Ga0066689_100074991 | 3300005447 | Soil | ECADKSADYVVDSLFEAVEKHAAGVDPFDDQTVVAIKVKGNPAKRK* |
| Ga0070731_111663631 | 3300005538 | Surface Soil | VTGCEDQTADCVVDSIFKAVAKYAKGVEAFDDQTVVAIKVKGGPGKRK* |
| Ga0066697_106796401 | 3300005540 | Soil | IVARCAGRPADYVVDCLFKAVEEHAAGVEAFDDQTVVAIKVKESPTKSK* |
| Ga0066699_100686831 | 3300005561 | Soil | SRAADKSADWIVDTLFKAVLEHAGSEDPFDDQTVVAIKVKGSPAKRK* |
| Ga0066706_104949251 | 3300005598 | Soil | PADYVVDCLFKAVEEHAAGVEAFDDQTVVAIKVKESPTKSK* |
| Ga0070764_110543312 | 3300005712 | Soil | ERVGEIVAANPNASADEVVKLLFKAVAEHASGEEAFYDQTVVAIRVKGTPGKRK* |
| Ga0070717_100785594 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VADCATKSAECVVREIFKAVTAHAAGVDTFDDQTVVAIKVKADSSKRK* |
| Ga0075026_1005343122 | 3300006057 | Watersheds | QSPDCVVNSLFQAVAEHAAGEDTFDDQTVVAIRVKGSASKRK* |
| Ga0075019_109583511 | 3300006086 | Watersheds | SADCVVNEIFKAVTEHAAGVDAFDDQTVVAIKVKSGPSSGKRK* |
| Ga0075015_1008923682 | 3300006102 | Watersheds | SPDCVVNNIFKAVTEHAAGVDAFDDQTVVAIKVKGGAGKRK* |
| Ga0075018_1000069710 | 3300006172 | Watersheds | SGKSASCVVDSIFKAVSEHAAGVEAFDDQTVVAIRVKDDAAPGSSKRK* |
| Ga0075018_100090091 | 3300006172 | Watersheds | VRNCANKSADCAVDTIFKAVAKHAADVEAFDDQTVVALKVKDAAPGKKK* |
| Ga0066665_101379133 | 3300006796 | Soil | VKEGCKLSAQALVDKLFDAVQEHSAGVETFDDQTIVAIRVKGHSGKRK* |
| Ga0066665_116009122 | 3300006796 | Soil | IFEAVAEHAAGAEPFDDQTVVAIRVKDGAAAKRK* |
| Ga0073928_105733141 | 3300006893 | Iron-Sulfur Acid Spring | ALDANCVVDSLFQEVAKYAAGVETFDDQTVVALKVKGSPGKKK* |
| Ga0079219_112443171 | 3300006954 | Agricultural Soil | DKTADCVVSSLFKAVAKFAAKVESFDDQTVVAIKVKESAAKRK* |
| Ga0099795_105604522 | 3300007788 | Vadose Zone Soil | NNIFKAVAEHTAGADPFDDQTVVAIRVKNSSGAATGTSKRK* |
| Ga0099830_108212602 | 3300009088 | Vadose Zone Soil | NEIFKAVTEHAAGVDTFDDQTVVAIKVKAGPGKSK* |
| Ga0116220_100215281 | 3300009525 | Peatlands Soil | ADALVKLIFEAVAEHASGEEAFDDQTVVAIRVKGTHGKRK* |
| Ga0116110_10351021 | 3300009643 | Peatland | NEIFKAVTEYAAGVDAFDDQTVVAIKVKTGPGKRK* |
| Ga0116135_13466521 | 3300009665 | Peatland | NEIFKAVTEHAAGVDTFDDQTVVAIKVKAGQLSGKRK* |
| Ga0126373_108238531 | 3300010048 | Tropical Forest Soil | MFGRSGVERVISSCGEQSPDCVVNSLFQAVEEHAAGEATFDDETVVAIKVKGSPAKRK* |
| Ga0134111_102786462 | 3300010329 | Grasslands Soil | ADYVVDCLFKAVEENAAGVEAFDDQTVVAIKVKESPTKSK* |
| Ga0074045_104261511 | 3300010341 | Bog Forest Soil | NEIFKAVAEFAAGVDAFDDQTVVAIKVKAGPGKRK* |
| Ga0126383_118078692 | 3300010398 | Tropical Forest Soil | SACGEQSPDCIVNSLFQAVEEHAAGEVTFDDQTVVAIKVKGSTPKRK* |
| Ga0137391_101154751 | 3300011270 | Vadose Zone Soil | GCLTQSADCVVNNIFKAVAEHAAGVDPFDDQTVVAIRVKDGSGAPVGSGKRK* |
| Ga0137389_104298771 | 3300012096 | Vadose Zone Soil | VSADCVVESLFKAVAEYAAGVETFDDQTVVAIRVKGGSGKRK* |
| Ga0137364_103075591 | 3300012198 | Vadose Zone Soil | KLSAQALVDKLFDAVQEHSAGVETFDDQTIVAIRVKGHSGKRK* |
| Ga0137365_111645611 | 3300012201 | Vadose Zone Soil | AQSVVDNLFIAVQEHASGVETFDDQTIMAIRVKGPAGKRK* |
| Ga0137376_113481261 | 3300012208 | Vadose Zone Soil | QSADCVVNNIFKAVAEHAAGVDPFDDQTVVAIRVKDRSGAPVGSGKRK* |
| Ga0137358_102043552 | 3300012582 | Vadose Zone Soil | VVKSLFKAVTEHAAGEEAFDDETVVAIRVKGEPKRR* |
| Ga0137359_114436491 | 3300012923 | Vadose Zone Soil | IILGCQTQSADCVVNNIFEAVAEHAAGVDPFDDQTVVAIRVKDRPGSPAGSGKRK* |
| Ga0137416_107602281 | 3300012927 | Vadose Zone Soil | SQSADCVVSNIFKAVAEHAAGADPFDDQTVVAIRVKDGTGGPGKRK* |
| Ga0137404_101132053 | 3300012929 | Vadose Zone Soil | GCVNVSADCVVKSLFKAVTEHAAGEEAFDDETVVAIRVKGEPKRK* |
| Ga0137407_120509552 | 3300012930 | Vadose Zone Soil | EEIVLSCATQSADCVVNNIFKAVAEHAAGADPFDDQTVVAIRVKDGVSESGGSGKRK* |
| Ga0126375_115178521 | 3300012948 | Tropical Forest Soil | SGVERVIAACPDQSPECVVTSLFQAVAEHAAGEEAFDDQTVVAIKIKGSASKRT* |
| Ga0126369_100074411 | 3300012971 | Tropical Forest Soil | ERVIAACPDQSPECVVTSLFQAVAEHAAGEEAFDDQTVVAIKIKGSASKRK* |
| Ga0164307_115665081 | 3300012987 | Soil | GVERVIASCPEQSPECVVASLFQAVEEHSAGETAFDDQTVVAIKVKESPSKVQ* |
| Ga0181524_101581312 | 3300014155 | Bog | ERVGEIVAANSNASADAIVKLIFQAVAEHASGEEAFDDQTVVAIRVKGTPGKRK* |
| Ga0181518_105987052 | 3300014156 | Bog | AIVAGCATKSADCVVNEIFKAVTEYAAGVDAFDDQTVVAIKVKSSPGKRQ* |
| Ga0181521_100567081 | 3300014158 | Bog | GCATKSADCVVNEIFKAVTEHAAGVDAFDDQTVVAIKVKSSAGKRK* |
| Ga0181536_104765432 | 3300014638 | Bog | VEAILASCAAKWVGCGVNEIFEAVTERAAGVDTFVDQTVVAIKVKGGPGKRK* |
| Ga0181519_100195141 | 3300014658 | Bog | CAQQSADCVVREIFKAVTEHAAGVEAFDDQTVVAIKVKGGAGKGK* |
| Ga0137420_11860092 | 3300015054 | Vadose Zone Soil | VNNIFKAVAEHAAGADPFDDQTVVAIRVKDGSGPQVPSGKRK* |
| Ga0167643_10527012 | 3300015089 | Glacier Forefield Soil | RRTEEIISKCANVSADCAVKSLFEAVAEHASGVETFDDQTIVAIRVKDAPGKHK* |
| Ga0187802_102254661 | 3300017822 | Freshwater Sediment | ERVQAIVAGCAAKSADCVVNEIFKAVTEHAAGVDAFDDQTVVAIKVKSDSVKRK |
| Ga0187801_101180452 | 3300017933 | Freshwater Sediment | NPNASADEVVKLIFKAVAEHASGEEAFDDQTVVAIRVKGTPGKRK |
| Ga0187801_101378082 | 3300017933 | Freshwater Sediment | LTAPVDAVVKAIFDAVAKHAAGEEAFDDQTVVVIRVKGTSGKRK |
| Ga0187801_104907151 | 3300017933 | Freshwater Sediment | AATSADCVVKSLFEAVSAHAAGEETFDDQTVVAIRVKGTPGKRK |
| Ga0187819_108016871 | 3300017943 | Freshwater Sediment | KDANASPDAVVKAIFKAVAEHAAGQDAFDDQTVVAIRVKGAPGKRK |
| Ga0187847_101072112 | 3300017948 | Peatland | LVKTIFKAVAEHAAGVEAFDDQTVVVIRVKGTSGKRK |
| Ga0187817_109874601 | 3300017955 | Freshwater Sediment | IVTKDANASPDAVVKAIFKAVAEHAAGQDAFDDQTVVAIRVKGAPGKRK |
| Ga0187779_113103131 | 3300017959 | Tropical Peatland | TSDLNASADVVVKSIFRAVAEHAAGQDAFDDQTVVAIRVKGSSGKRK |
| Ga0187776_103785471 | 3300017966 | Tropical Peatland | RVEEIVLGCAPQSTDCAVNKIFAAVNEHAAGEPAFDDQTVVAIKVKGGAGKRK |
| Ga0187783_105218392 | 3300017970 | Tropical Peatland | ARNAKLPADALVRAIFAAVAEHAAGEDAFDDQTVVVIRVKERSGKHE |
| Ga0187783_112435962 | 3300017970 | Tropical Peatland | VQAIFAAVSEHAAGEEAFDDQTVVVIRVKDRPGKRE |
| Ga0187777_101217851 | 3300017974 | Tropical Peatland | IARKANLPADAVVQAIFAAVADHAAGAEAFDDQTVVVMRVKDGPGKRE |
| Ga0187868_11915581 | 3300018002 | Peatland | AACANKSAGCVVNEIFKAVTEHAAGVDTFDDQTVVAIKVKTSSGKRK |
| Ga0187804_103760722 | 3300018006 | Freshwater Sediment | KAIFRAVAEHASGEEAFDDQTVVAIRVKGTSGKRK |
| Ga0187810_104494201 | 3300018012 | Freshwater Sediment | ERVQAIVAGCAAKSADCVVSEIFKAVTEHAAGVDAFDDQTVVAIKVKSDPGKRK |
| Ga0187860_10990151 | 3300018014 | Peatland | ATKSAECVVNEIFKAVTEHAAGVDAFDDQTVVAIKVKSSPGKRQ |
| Ga0187863_105451012 | 3300018034 | Peatland | CATKSAECVVNEIFRAVAEHAAGVDAFDDQTVVAIKVKAGSGKRK |
| Ga0187875_104078961 | 3300018035 | Peatland | PDCVVSNIFRAVTEHAAGVEAFDDQTVVAIKVKGGPGKRK |
| Ga0187871_100650681 | 3300018042 | Peatland | RVQAIVTGCATKSADCVVNEIFKAVTEHAAGVDPFDDQTVVAIKVKSGPDKRK |
| Ga0187858_107569241 | 3300018057 | Peatland | ANPNASADEMVKLIFQAVSEHASGVEAFDDQTVVAIRVKGTPGKRK |
| Ga0187766_104556732 | 3300018058 | Tropical Peatland | GTCTSVSAACVVDSLFKAVDEFAAGVEAFDDQTVVAIRVKGGPGRLQ |
| Ga0187772_102363571 | 3300018085 | Tropical Peatland | CRESADTVVKTIFSAVAEHAAGEEAFDDQTVVVMRVKGSPGKRK |
| Ga0187769_100059701 | 3300018086 | Tropical Peatland | EKLVKAIFQAVAEHASGVEAFDDQTVVAIRVKNSTGKRP |
| Ga0187770_103366001 | 3300018090 | Tropical Peatland | TPDCVVSNIFAAVTEYAAGVEAFDDQTVVAIKVKGSPGKRK |
| Ga0182031_13918502 | 3300019787 | Bog | VVNEVFKAVTEFAAGVDAFDDQTVVAIKVKSGPGKRK |
| Ga0210403_102329592 | 3300020580 | Soil | PDAVVKAIFKAVAEHAAGEEAFDDETVVVIRVKGPAGKRK |
| Ga0210403_108748071 | 3300020580 | Soil | SCTDQSPDCVVNSLFKAVEEHAAGEVTFDDQTVVAIKVKGSAAKRK |
| Ga0210403_112681441 | 3300020580 | Soil | VKLIFKAVAEHASGEEAFDDQTVVAIRVKGTPGKRK |
| Ga0210403_114584272 | 3300020580 | Soil | NASPDALVKAIFKAVDEHAAGLDAFDDQTVVAIRVKGSPGKRA |
| Ga0210399_103219531 | 3300020581 | Soil | NVSADCVVKSLFKAATEHAAGEEAFDDETVVAIRVKGEPKRK |
| Ga0210401_109630071 | 3300020583 | Soil | ANPNAAADEVVKLIFNAVAEHASGEEAFDDQTVVAIRVKGTPGKRK |
| Ga0210401_112029452 | 3300020583 | Soil | CHNLEATPDALVKAIFKAVADHAAGEEAFDDQTVVVIRVKGPAGRRK |
| Ga0210406_110908711 | 3300021168 | Soil | AENPNASADAIVKLIFQAVAEHASGEEAFDDQTVVAIRVKGAPGKRK |
| Ga0210405_109298431 | 3300021171 | Soil | RVGQIVAANPKASAGEVVKLIFNAVAEHASGEEAFDDQTVVAIRVKGTLGKRK |
| Ga0210405_113796352 | 3300021171 | Soil | EVVKLLFKAVAEHASGEEAFDDQTVVAIRVKGTPGKRK |
| Ga0210396_117066791 | 3300021180 | Soil | DVVKAIFKAVAEYVSGEEAFDDQTVVAIRVKGSRK |
| Ga0210388_115731551 | 3300021181 | Soil | SADCAVKSLFKAVAEHASGVETFDDQTVVAIRVKGTPGKRK |
| Ga0210387_106194722 | 3300021405 | Soil | ANKSADCVVKEIFEAVNQHAAGVDAFDDQTVVAIKVKNSAGKRK |
| Ga0210383_117733071 | 3300021407 | Soil | DAVVKLIFSAVAEHASGVEAFDDQTIVAIRVKGTPGKRK |
| Ga0210390_113086612 | 3300021474 | Soil | QSIFKAVAEHASGEEAFDDQTVVAIRVKGTPGKRK |
| Ga0210402_106967032 | 3300021478 | Soil | RVGEIVAENPEASANEIVKLIFQAVAKHASGEEAFDDQTVVAIRVKGTPGKRK |
| Ga0210410_105163802 | 3300021479 | Soil | ADEVVNLIFKAVAEHASGEEAFDDQTVVAIRVKGTPGKRK |
| Ga0210410_107039262 | 3300021479 | Soil | ADEVVKLIFKAVAEHASGEEAFDDQTVVAIRVKSTPGKRK |
| Ga0224557_10807292 | 3300023101 | Soil | VDNIFRAVTEHAAGVEAFDDQTVVAIKVKGTAPKRKG |
| Ga0208562_11101402 | 3300025460 | Peatland | ACANKSAGCVVNEIFKAVTEHAAGVDTFDDQTVVAIKVKTSSGKRK |
| Ga0208691_11184462 | 3300025612 | Peatland | VNEIFKAVTEHAAGVDTFDDQTVVAIKVKAGQLSGKRK |
| Ga0207663_113010771 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GCVNVSADCVVKSLFKAVTEHAAGEEAFDDETVVAIRVKGEPKGK |
| Ga0208369_10229962 | 3300026998 | Forest Soil | NPNASADEVVKLLFKAVAEHASGEEAFDDQTVVAIRVKGTPGKRK |
| Ga0208859_10367921 | 3300027069 | Forest Soil | SADEVVKLIFEAVAEHASGEEAFDDQTVVAIRVKGTPGKRK |
| Ga0209421_11331701 | 3300027432 | Forest Soil | ERVEAIVAGCVDKSADCVVKEIFQAVSEHAAGVDAFDDQTVVAIKVKSGAGKRK |
| Ga0208990_11779301 | 3300027663 | Forest Soil | ADCVVNNIFKAVAEHAAGADPFDDQTVVAIRVKDGSGTPVGSGKRK |
| Ga0209333_10050721 | 3300027676 | Forest Soil | CVVNEIFKAVSEHAADVDAFDDQTVVAIKVKAGQSSSKRK |
| Ga0209333_10438532 | 3300027676 | Forest Soil | AGCATKSAECVVNEIFKAVTEHAEGVDTFDDQTVVAIKVKDGQSSGKRK |
| Ga0209274_106830012 | 3300027853 | Soil | KLIFQAVAEHASGVEAFDDQTVVAIRVKGTPGKRK |
| Ga0209167_101726301 | 3300027867 | Surface Soil | SADEMVKLIFQAVAEHASGVEAFDDQTVVAIRVKGAPGKRK |
| Ga0209167_107909791 | 3300027867 | Surface Soil | KLIFKAVAEHASGEEAFDDQTVVAIRVKSTPGKRK |
| Ga0209624_101363421 | 3300027895 | Forest Soil | DCVVKEIFQAVSEHAAGVDAFDDQTVVAIKVKNTPGKRK |
| Ga0209488_109638511 | 3300027903 | Vadose Zone Soil | DCVVNNIFKAVAEHAAGADPFDDQTVVAIRVKDGSGTPVGSGKRK |
| Ga0209168_102025651 | 3300027986 | Surface Soil | VGDIVASNRDASADDVVKAIFKAVAEYVSGEEAFDDQTVVAIRVKGTRK |
| Ga0209168_106522381 | 3300027986 | Surface Soil | DIVASNRDASADDVVKAIFKAVAEYVSGEEAFDDQTVVAIRVKGTRK |
| Ga0137415_106708531 | 3300028536 | Vadose Zone Soil | SADCVVSNIFKAVAEHAAGADPFDDQTVVAIRVKDGTGGPGKRK |
| Ga0302159_101275772 | 3300028646 | Fen | IVTKCADESPDCVISSIFKAVAEHVGGEEAFDDQTVVAIRVKGSSGKRK |
| Ga0246001_10959532 | 3300029889 | Peat | VAGCATKSADCVVNEIFKAVTEHAAGVDAFDDQTVVAIKVKSSAGKRK |
| Ga0302323_1006356641 | 3300031232 | Fen | IILGCQSQSADCVVSNIFKAVAEHAAGADPFDDQTVVAIRVKDGASGAGKRK |
| Ga0265330_100100336 | 3300031235 | Rhizosphere | TKSANCVVNEIFKAVSLHAAGVETFDDQTVVAIKVKSSPGKKK |
| Ga0170818_1042883101 | 3300031474 | Forest Soil | RVLKTLFKAVAEHASGVETFDDQTIVAIRVKDTPGKRK |
| Ga0307476_101968822 | 3300031715 | Hardwood Forest Soil | SADTVVNAIFSAVSEHTGAEDAFDDQTVVVIRVKGTAGKRK |
| Ga0307476_107015771 | 3300031715 | Hardwood Forest Soil | AANPNASAGEIVKLIFQAVAKHASGEEAFDDQTVVAIRVKGTPGKRK |
| Ga0307477_1000533410 | 3300031753 | Hardwood Forest Soil | AHCAEVSADCVVQSLFKAVAEHAAGVETFDDQTVVAIKVKGEAGKSK |
| Ga0307473_100181533 | 3300031820 | Hardwood Forest Soil | DWVVDALFKAVAEHAAGVETFDDETVVAIKVKNSSGTPQ |
| Ga0307473_107253822 | 3300031820 | Hardwood Forest Soil | HCAEVSADCVVQSLFKAVAEHAAGVETFDDQTVVAIKVKGESGKSK |
| Ga0318567_106711651 | 3300031821 | Soil | GVEKVIAECPDQSPECVVNSLFAAVEEHAAGEDTFDDQTVLAIRVKGSAAKRK |
| Ga0308176_110101332 | 3300031996 | Soil | QSADCVVKSLFAAVAEHSAGEETFDDQTVVAIKVKGEPGKKK |
| Ga0311301_111384152 | 3300032160 | Peatlands Soil | TKSADCVVNEIFKAVTEHAAGVDAFDDQTVVAIKVKAGPGKRK |
| Ga0307471_1024071982 | 3300032180 | Hardwood Forest Soil | VSADCVVTSLFKAVTEHAAGEEAFDDETVVAIRVKGEPKRAPKTV |
| Ga0307471_1032027151 | 3300032180 | Hardwood Forest Soil | GVERVIAACPDQSPDCVVSSLFQAVAEHAAGEDTFDDQTVVAIKIKGTAKRK |
| Ga0307472_1017778301 | 3300032205 | Hardwood Forest Soil | ADCVVTSLFKAVTEHAAGEEAFDDETVVAIRVKGEPKRAPKTV |
| Ga0335079_118081972 | 3300032783 | Soil | VVDAIFKAVCGHAGSEDAFDDQTVVVIRVKGSPGKRK |
| Ga0335078_1001156114 | 3300032805 | Soil | NVGAPPDAVVKAIFKAVAEHAAGEEAFDDETAVVIRVKGPAGKHK |
| Ga0335078_110201301 | 3300032805 | Soil | KAIFSAVAEHTAGEEAFDDQTVVAIRVKGAPGKRK |
| Ga0335070_113543521 | 3300032829 | Soil | ATQSADCVVKKIFAAVDEHSAGEPAFDDQTVVAIRVKGSPSKRK |
| Ga0335071_106370272 | 3300032897 | Soil | ADAVVNALFKAVANHAAGVETFDDQTVVAIRVKGNPGKRK |
| Ga0335083_105698751 | 3300032954 | Soil | AKCAPVSAECVVKSLFKAVNAHAAGEEAFDDQTVVAFRVKDGPGKRK |
| Ga0335076_115662242 | 3300032955 | Soil | RVEKIIAACSEQSPDCVVANLFSAVTEHAAGVDAFDDQTVVAIKVKGSPGKRK |
| Ga0314866_009778_1121_1255 | 3300033807 | Peatland | LNASADVVVKSIFRAVAEHAAGQDAFDDQTVVAIRVKGSSGKRK |
| Ga0326723_0387857_1_141 | 3300034090 | Peat Soil | AQSADCVVTNIFKAVDEHAAGANPFDDQTVVAIRVKNVSGGPSKRK |
| ⦗Top⦘ |