NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F055162

Metagenome / Metatranscriptome Family F055162

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055162
Family Type Metagenome / Metatranscriptome
Number of Sequences 139
Average Sequence Length 38 residues
Representative Sequence LRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFA
Number of Associated Samples 125
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.60 %
% of genes near scaffold ends (potentially truncated) 88.49 %
% of genes from short scaffolds (< 2000 bps) 89.21 %
Associated GOLD sequencing projects 123
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.964 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(9.352 % of family members)
Environment Ontology (ENVO) Unclassified
(23.741 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.396 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.46%    β-sheet: 0.00%    Coil/Unstructured: 61.54%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF12728HTH_17 16.55
PF00589Phage_integrase 12.95
PF08843AbiEii 2.16
PF00069Pkinase 2.16
PF00691OmpA 1.44
PF02371Transposase_20 0.72
PF05065Phage_capsid 0.72
PF06537DHOR 0.72
PF05227CHASE3 0.72
PF00722Glyco_hydro_16 0.72
PF13517FG-GAP_3 0.72
PF13671AAA_33 0.72
PF08448PAS_4 0.72
PF10011DUF2254 0.72
PF07676PD40 0.72
PF12740Chlorophyllase2 0.72
PF05101VirB3 0.72
PF01548DEDD_Tnp_IS110 0.72
PF03544TonB_C 0.72
PF13620CarboxypepD_reg 0.72
PF00027cNMP_binding 0.72
PF13545HTH_Crp_2 0.72
PF04542Sigma70_r2 0.72
PF13602ADH_zinc_N_2 0.72
PF05721PhyH 0.72
PF02055Glyco_hydro_30 0.72
PF07228SpoIIE 0.72
PF03703bPH_2 0.72
PF01168Ala_racemase_N 0.72
PF00196GerE 0.72
PF00860Xan_ur_permease 0.72
PF13191AAA_16 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 8.63
COG2253Predicted nucleotidyltransferase component of viral defense systemDefense mechanisms [V] 2.16
COG3547TransposaseMobilome: prophages, transposons [X] 1.44
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.72
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.72
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.72
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.72
COG2273Beta-glucanase, GH16 familyCarbohydrate transport and metabolism [G] 0.72
COG3402Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.72
COG3428Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domainFunction unknown [S] 0.72
COG3488Uncharacterized conserved protein with two CxxC motifs, DUF1111 familyGeneral function prediction only [R] 0.72
COG3702Type IV secretory pathway, VirB3 componentIntracellular trafficking, secretion, and vesicular transport [U] 0.72
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 0.72
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.72
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.72
COG5520O-Glycosyl hydrolaseCell wall/membrane/envelope biogenesis [M] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.96 %
UnclassifiedrootN/A5.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_105205638All Organisms → cellular organisms → Bacteria → Acidobacteria1432Open in IMG/M
3300001087|JGI12677J13195_1011936All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae603Open in IMG/M
3300002245|JGIcombinedJ26739_101652996All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300003505|JGIcombinedJ51221_10030650All Organisms → cellular organisms → Bacteria1958Open in IMG/M
3300004092|Ga0062389_103394672All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300004463|Ga0063356_104263115All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium TAA 166615Open in IMG/M
3300004633|Ga0066395_10311924All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300004643|Ga0062591_101309327All Organisms → cellular organisms → Bacteria → Acidobacteria713Open in IMG/M
3300005459|Ga0068867_100130454All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1953Open in IMG/M
3300005468|Ga0070707_101529057All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300005553|Ga0066695_10573936All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae681Open in IMG/M
3300005559|Ga0066700_10195977All Organisms → cellular organisms → Bacteria1393Open in IMG/M
3300005563|Ga0068855_100499619All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1322Open in IMG/M
3300005591|Ga0070761_10188306All Organisms → cellular organisms → Bacteria → Acidobacteria1219Open in IMG/M
3300005764|Ga0066903_101307961All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1355Open in IMG/M
3300005764|Ga0066903_102061370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1097Open in IMG/M
3300005840|Ga0068870_11346009All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia521Open in IMG/M
3300006052|Ga0075029_100757552All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae658Open in IMG/M
3300006052|Ga0075029_100828159All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89631Open in IMG/M
3300006059|Ga0075017_100142088All Organisms → cellular organisms → Bacteria1704Open in IMG/M
3300006059|Ga0075017_100679900All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola791Open in IMG/M
3300006162|Ga0075030_100830718All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300006162|Ga0075030_101449308All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300006172|Ga0075018_10303092All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300006174|Ga0075014_100320126All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300006176|Ga0070765_100077998All Organisms → cellular organisms → Bacteria2800Open in IMG/M
3300006176|Ga0070765_100635781All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1007Open in IMG/M
3300006893|Ga0073928_10497066All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium875Open in IMG/M
3300006954|Ga0079219_10589394All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300009029|Ga0066793_10526222All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300009137|Ga0066709_103623082All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068560Open in IMG/M
3300009519|Ga0116108_1256768All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300009522|Ga0116218_1327081All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300009524|Ga0116225_1447024All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89574Open in IMG/M
3300009637|Ga0116118_1198471All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300009646|Ga0116132_1250694Not Available538Open in IMG/M
3300009665|Ga0116135_1139523All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium900Open in IMG/M
3300010048|Ga0126373_10367227All Organisms → cellular organisms → Bacteria → Acidobacteria1456Open in IMG/M
3300010048|Ga0126373_11864258All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300010329|Ga0134111_10094044All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1143Open in IMG/M
3300010343|Ga0074044_10821358All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300010360|Ga0126372_11850919All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300010361|Ga0126378_10313061All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1675Open in IMG/M
3300010361|Ga0126378_10620323All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1195Open in IMG/M
3300010362|Ga0126377_12955626All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300010366|Ga0126379_12585926All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300010376|Ga0126381_100045817Not Available5325Open in IMG/M
3300010376|Ga0126381_101270632All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1064Open in IMG/M
3300010376|Ga0126381_104856689All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300010379|Ga0136449_101535123All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1017Open in IMG/M
3300010379|Ga0136449_102260137All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium791Open in IMG/M
3300010398|Ga0126383_13646054All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300010400|Ga0134122_10168096All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1796Open in IMG/M
3300011269|Ga0137392_11167407All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300012200|Ga0137382_10023515All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3578Open in IMG/M
3300012205|Ga0137362_11524524All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300012210|Ga0137378_11402972All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300012357|Ga0137384_10546378All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300012363|Ga0137390_11368173All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300012927|Ga0137416_11756221All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300012964|Ga0153916_12199497All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300012971|Ga0126369_10306735All Organisms → cellular organisms → Bacteria1591Open in IMG/M
3300014054|Ga0120135_1055169All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae621Open in IMG/M
3300014155|Ga0181524_10300987All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae731Open in IMG/M
3300014162|Ga0181538_10596835All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300014164|Ga0181532_10048366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2820Open in IMG/M
3300014164|Ga0181532_10051368All Organisms → cellular organisms → Bacteria → Acidobacteria2722Open in IMG/M
3300015358|Ga0134089_10357521All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300015371|Ga0132258_10900830All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2233Open in IMG/M
3300015371|Ga0132258_12153007All Organisms → cellular organisms → Bacteria1401Open in IMG/M
3300016357|Ga0182032_10711097All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium844Open in IMG/M
3300017823|Ga0187818_10059433All Organisms → cellular organisms → Bacteria → Acidobacteria1644Open in IMG/M
3300017934|Ga0187803_10119762All Organisms → cellular organisms → Bacteria → Acidobacteria1034Open in IMG/M
3300017961|Ga0187778_10141710All Organisms → cellular organisms → Bacteria1513Open in IMG/M
3300017961|Ga0187778_11295509All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300017970|Ga0187783_10661472All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium755Open in IMG/M
3300017972|Ga0187781_10391500Not Available991Open in IMG/M
3300017975|Ga0187782_10590885All Organisms → cellular organisms → Bacteria → Acidobacteria853Open in IMG/M
3300018005|Ga0187878_1279281All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300018006|Ga0187804_10211230All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae831Open in IMG/M
3300018025|Ga0187885_10073973All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1694Open in IMG/M
3300018040|Ga0187862_10409786All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium830Open in IMG/M
3300018090|Ga0187770_11078079All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300018433|Ga0066667_11776060All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300020581|Ga0210399_10676233All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium850Open in IMG/M
3300020583|Ga0210401_11443032All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300021046|Ga0215015_11090867All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1162Open in IMG/M
3300021170|Ga0210400_11156416All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium625Open in IMG/M
3300021171|Ga0210405_10018742All Organisms → cellular organisms → Bacteria → Acidobacteria5649Open in IMG/M
3300021181|Ga0210388_10923989All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium751Open in IMG/M
3300021403|Ga0210397_10459772All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium959Open in IMG/M
3300021406|Ga0210386_11236052All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300021432|Ga0210384_11039832All Organisms → cellular organisms → Bacteria → Acidobacteria721Open in IMG/M
3300021560|Ga0126371_10130675All Organisms → cellular organisms → Bacteria2550Open in IMG/M
3300021858|Ga0213852_1171139All Organisms → cellular organisms → Bacteria → Acidobacteria1163Open in IMG/M
3300022840|Ga0224549_1029603All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae744Open in IMG/M
3300025627|Ga0208220_1081694All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium892Open in IMG/M
3300025878|Ga0209584_10226375Not Available714Open in IMG/M
3300025915|Ga0207693_11043892All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300025917|Ga0207660_11185833All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300025928|Ga0207700_11231683All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium668Open in IMG/M
3300025949|Ga0207667_10598993All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300026023|Ga0207677_12109539All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300026291|Ga0209890_10101135All Organisms → cellular organisms → Bacteria → Acidobacteria1000Open in IMG/M
3300026331|Ga0209267_1228014All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300026508|Ga0257161_1012191All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1571Open in IMG/M
3300027825|Ga0209039_10022759All Organisms → cellular organisms → Bacteria3156Open in IMG/M
3300027853|Ga0209274_10594891All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300027854|Ga0209517_10283254All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300027908|Ga0209006_10438696All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Rhodoferax → Rhodoferax sediminis1095Open in IMG/M
3300028673|Ga0257175_1117467All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300028746|Ga0302233_10427999All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300029817|Ga0247275_1013931All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2781Open in IMG/M
3300029989|Ga0311365_10996508All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300029999|Ga0311339_10035573All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium6994Open in IMG/M
3300030000|Ga0311337_10616850All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium934Open in IMG/M
3300030007|Ga0311338_10965790All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium830Open in IMG/M
3300030114|Ga0311333_10393130Not Available1120Open in IMG/M
3300030520|Ga0311372_10384473All Organisms → cellular organisms → Bacteria2140Open in IMG/M
3300030838|Ga0311335_10570056All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium790Open in IMG/M
3300030940|Ga0265740_1043010All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300030993|Ga0308190_1165014All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300031090|Ga0265760_10228704All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300031708|Ga0310686_116392842All Organisms → cellular organisms → Bacteria → Acidobacteria985Open in IMG/M
3300031715|Ga0307476_10446059All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium957Open in IMG/M
3300031720|Ga0307469_11017743All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300031722|Ga0311351_10514480Not Available909Open in IMG/M
3300031820|Ga0307473_10245178All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300031823|Ga0307478_10542554Not Available971Open in IMG/M
3300032001|Ga0306922_11642773All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae638Open in IMG/M
3300032180|Ga0307471_103480661All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae557Open in IMG/M
3300032261|Ga0306920_102931534All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium646Open in IMG/M
3300032805|Ga0335078_10011473All Organisms → cellular organisms → Bacteria13140Open in IMG/M
3300032805|Ga0335078_12140821All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300032828|Ga0335080_12040259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300032892|Ga0335081_10003641All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae24257Open in IMG/M
3300032897|Ga0335071_10004727All Organisms → cellular organisms → Bacteria14216Open in IMG/M
3300032954|Ga0335083_10537098All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_56_16973Open in IMG/M
3300033402|Ga0326728_10814147All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium677Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.19%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds5.76%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.04%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.32%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.60%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.60%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.60%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.60%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.88%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.88%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.88%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.88%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.16%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.16%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.16%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.16%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.16%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.44%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.44%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.44%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.44%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.72%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.72%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.72%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.72%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.72%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.72%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.72%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.72%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.72%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.72%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001087Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014054Permafrost microbial communities from Nunavut, Canada - A34_5cm_12MEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021858Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022840Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5EnvironmentalOpen in IMG/M
3300025627Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300028746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030940Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10520563813300000955SoilVDLRTVQQGLGRSDMESTMRYLKPSRSEKVREKVNQIFA*
JGI12677J13195_101193623300001087Forest SoilVQQWLGHSDMESTMRYLKPSRSQHVREKVNGIFA*
JGIcombinedJ26739_10165299613300002245Forest SoilLQLWLGHSDTESTMRYLKPARGPLMREKVNEIFA*
JGIcombinedJ51221_1003065033300003505Forest SoilMVTLGWRGLRTVQQWLGHSDMESTMRYLKPSRSQQVKEKVNEIFA*
Ga0062389_10339467223300004092Bog Forest SoilMRDLRTAQQWLGHSDMDSTMRYLKPSRSQLVRDKVNENV*
Ga0063356_10426311513300004463Arabidopsis Thaliana RhizosphereILRRLRTVQQWLGQSDMESTMRSLKPSRTQQAREKVHEVFA*
Ga0066395_1031192413300004633Tropical Forest SoilVDLRTVQQWLGHSDMESTMRYLKPSRSEYTRQKVNEIFR*
Ga0062591_10130932723300004643SoilVELRTVQQWLGHSDMESTMRYLEPSRSKQVREKVNEIFP*
Ga0068867_10013045423300005459Miscanthus RhizosphereVELRTVQQWLGHSDMESTMRYLEPSRSKQVREKVDEIFP*
Ga0070707_10152905713300005468Corn, Switchgrass And Miscanthus RhizosphereVDLRTVQNWLGHSDLESTMRYLKPSRNQAVQDKVNEIFT*
Ga0066695_1057393613300005553SoilDLRTVQLWLGHKDLESTMRYLRPARGRAAREKVNNTFATA*
Ga0066700_1019597713300005559SoilDLRTVQLWLGHKDLESTMRYLKPARGKGIRLKVNATFA*
Ga0068855_10049961913300005563Corn RhizosphereVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFGGVQ*
Ga0070761_1018830633300005591SoilLRTVQSWMGHTDLQSTMRYLKPSRTQATRDKVNEIFAKVCK*
Ga0066903_10130796123300005764Tropical Forest SoilLWAGVDLWTVQQYLGHSDMESTMRYLKPSRSEKERDKVNQIFA*
Ga0066903_10206137023300005764Tropical Forest SoilVDLRTVQLWLGHSDIESTMRYLKPSRSPQVRDKVNEIFA*
Ga0068870_1134600913300005840Miscanthus RhizosphereVQQWLGHSDMESTMRYLKPSRSQKVREKVNEIFA*
Ga0075029_10075755223300006052WatershedsVQLWLGHKDLESTMRYLKPARGKEIRSKVDLTFATGAK*
Ga0075029_10082815913300006052WatershedsVQQWLGHSDMESTMRYLKPSRSQQTRDKVNEIFA*
Ga0075017_10014208813300006059WatershedsVQQWLGHSDMESTMRYLKPSRSQHVRDKVNEIFA*
Ga0075017_10067990023300006059WatershedsTVQQWLGHSDMESTMRYLKPSRSQQTREKVNEIFA*
Ga0075030_10083071813300006162WatershedsVQQWLGHSDMESTMRHLKPSRSQQVRDKVNEIFA*
Ga0075030_10144930813300006162WatershedsVQQWLGHSDMESTMRYLKPSRSQRVRNKVNEIFG*
Ga0075018_1030309213300006172WatershedsVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFA*
Ga0075014_10032012623300006174WatershedsVQLWLGHSDMESTMRYLNPLRSQHVRDKVNEIFA*
Ga0070765_10007799853300006176SoilDLRTVQQWLGHSDMESTMRYLKPSRSQQTREKVNEIFAL*
Ga0070765_10063578113300006176SoilTVQQWLGHSDMESTMRYLKPSRSQHVREKVNEIFA*
Ga0073928_1049706613300006893Iron-Sulfur Acid SpringTVQQWLGHSDMESTLRYLKPSRSQATRDKVNAIFA*
Ga0079219_1058939423300006954Agricultural SoilTVQQWLGHTDMESTMRYLKPARNQVVRDKVNEIFA*
Ga0066793_1052622223300009029Prmafrost SoilLRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFGGVQ*
Ga0066709_10362308213300009137Grasslands SoilVDLRTVQHWMGHKDIESTMRYLKPNRGQEVRAKVNNSFA*
Ga0116108_125676813300009519PeatlandVDLRTVQRWLGHEDMESTMRYFKPSRSKATREKESEIFAD*
Ga0116218_132708113300009522Peatlands SoilVDLRTVQQWLGHSDMESTVRYLKPSRSQQTREKVNEIFA*
Ga0116225_144702413300009524Peatlands SoilDLRTVQQWLGHSDMESTMRYLKPSRSQQTREKVNAIFA*
Ga0116118_119847123300009637PeatlandVDLRTVLQWLGHKDLESTMRYLKPSRSQQTRDKVNEIFA*
Ga0116132_125069413300009646PeatlandVDLRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFAL*
Ga0116135_113952313300009665PeatlandDLRTVQQWLGHSDIESTMRYLKPSRSQATRDKVNEIFAD*
Ga0126373_1036722713300010048Tropical Forest SoilGIDLRTVQAYLGHKDLESTMRYLKPSRTPKAREKINEVFA*
Ga0126373_1186425813300010048Tropical Forest SoilVQHWFGHADLESTMRYLKPSRSQHVRDKMDTIFA*
Ga0134111_1009404413300010329Grasslands SoilRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFA*
Ga0074044_1082135823300010343Bog Forest SoilPHGSACWLGHSDMESTMRYLKPSRSQHVRDKVNEIFA*
Ga0126372_1185091923300010360Tropical Forest SoilVDLRTVQSWMGHTDLASTMRYLKPNHSQEVRVKVNNTFA*
Ga0126378_1031306123300010361Tropical Forest SoilDLRTVQHWLGHTDIESTMRYLKPSRSQQVRDKMDEVFASPDFEIAS*
Ga0126378_1062032313300010361Tropical Forest SoilLRTVQHWMGHKDLESTMRYLKPNRGPAVRDKVNATFAQ*
Ga0126377_1295562613300010362Tropical Forest SoilRTVQQWLGHSDMESTMRYLKPSRSEKVREKVNDIFA*
Ga0126379_1258592613300010366Tropical Forest SoilTVQQWLGHSDMESTMRYLKPSRSETVRDKINSIFA*
Ga0126381_10004581713300010376Tropical Forest SoilVDLRTVQQWLGHSDMESTMRYLKASRSEKVHDKVNPIFV*
Ga0126381_10127063213300010376Tropical Forest SoilDLRTVQLWLGHTEIESTMRYLKPSRSAETHRKVNEIFPSRKRLST*
Ga0126381_10485668913300010376Tropical Forest SoilTVQMWMGHTDIESTMRYLKPSRSQKMQEKVNEIFG*
Ga0136449_10153512313300010379Peatlands SoilRTVQQWLGHSDMESTMRYLKPSRSQHVREKVNEIFA*
Ga0136449_10226013723300010379Peatlands SoilLATVDLRTVQQWLGHSDMESTMRYLKPSRSKQTREKVNEIFAL*
Ga0126383_1364605413300010398Tropical Forest SoilWAGVDLRTGQHWLGHSDMESTIRYLKTSRSEKVRDKVNQIFA*
Ga0134122_1016809653300010400Terrestrial SoilRTVQQWLGHSGMESTMRYLKPSRSKQVREKVNEIFP*
Ga0137392_1116740713300011269Vadose Zone SoilVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFGGDQ*
Ga0137382_1002351513300012200Vadose Zone SoilTVQLWLGHHDLKSTMRYLKPARGKNIRAKVNATFTD*
Ga0137362_1152452423300012205Vadose Zone SoilDLRTVQHWMGHKDIESTMRYLKPNRSQEVKAKVNHTFA*
Ga0137378_1140297213300012210Vadose Zone SoilLRTVQMWLGHSDMESTMRYLKPSRSQAVRDKVDETFA*
Ga0137384_1054637833300012357Vadose Zone SoilDLRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFGGVQ*
Ga0137390_1136817313300012363Vadose Zone SoilVDLRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFA*
Ga0137416_1175622113300012927Vadose Zone SoilVDLRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFGGDQ*
Ga0153916_1219949713300012964Freshwater WetlandsDLRTVQQWMGHTDLESTLRYLKPNRSAAVRDKVNSMFDY*
Ga0126369_1030673543300012971Tropical Forest SoilRTVQQWLGHSDMESTVRYLKPSRSEKRREKVNKIFA*
Ga0120135_105516913300014054PermafrostRTVQQWLGHSDMESTMRYLKPSRSQHVRDKVNEIFA*
Ga0181524_1030098723300014155BogVDLRTVQQWLGHSDMESTMRYLKPSRSQHVRDKVNEIFA*
Ga0181538_1059683513300014162BogHKDIESTMRYLKPARDAQSRAKVNDIFAFASENH*
Ga0181532_1004836653300014164BogAGVDLRSVQEWLGHSDMESTMRYLKPSRSQQTRDKVNEIFA*
Ga0181532_1005136873300014164BogDIRTVQSYLGHSDLESTLRYLKPSRSQATRDKVNEIFGEVLA*
Ga0134089_1035752113300015358Grasslands SoilDLRTVQQWLGHSDMESTMRYLKPSRSQQVRQKVNKIFA*
Ga0132258_1090083013300015371Arabidopsis RhizospherePWAGVDHRTVQQWLGHSDMESTMRYLKPSRSEKVREKVNEIFA*
Ga0132258_1215300733300015371Arabidopsis RhizosphereVDLRTVQQWLGHSDMESTMRYLKPSRNRTVREKVNEIFA*
Ga0182032_1071109723300016357SoilTVQQWLGHSDMESTMRYLKPSRSEKVREKVNQIFG
Ga0187818_1005943323300017823Freshwater SedimentMGLERTVQLWMGHADMESTMRYLTPHRSQAVREKVNTMF
Ga0187803_1011976233300017934Freshwater SedimentMGLERTVQLWMGHADMESTMRYLTPHRSQAVREKVNTML
Ga0187778_1014171013300017961Tropical PeatlandRTVQQWLGHSDMESTMRYLKPSRSEKVREKVNQIFA
Ga0187778_1129550923300017961Tropical PeatlandQLWLGHSDLESTMRYLKPSRSEQVQAKVNDTFSKMGAEA
Ga0187783_1066147223300017970Tropical PeatlandDLRTVQQWLGHSDMESTMRYLKPARDKKVHEKVNETFSKLI
Ga0187781_1039150013300017972Tropical PeatlandVRAVQQWLGHFDVESTMRYLKPARDKKVHEKVNETFSKLEFDWE
Ga0187782_1059088523300017975Tropical PeatlandVDLRTVQERMGRTDIESTMTYLKPNRNKAVRERVNETFAGRA
Ga0187878_127928113300018005PeatlandRTVQQWMGHSDMESTMRYLKPNRSTAVRDKVNTIFGD
Ga0187804_1021123033300018006Freshwater SedimentVQQWLGHSDMESTMRYLKPSRSQKVRDKVNEIFGGVNG
Ga0187885_1007397333300018025PeatlandDLRTVQQWLGHSDMESTMRYLKPSRSQQTREKVNEIFA
Ga0187862_1040978613300018040PeatlandDLRTVQQWLGHSDMESTMRYLKPSRSRIVSEKVNEIFG
Ga0187770_1107807913300018090Tropical PeatlandVQQWLGHSDMESTMRYLKPARNEAVRDKVNEIFGGKNGN
Ga0066667_1177606013300018433Grasslands SoilDEYLRTIKQWLGYTDMESNMRYLKPSRSQQVREKVNEIFA
Ga0210399_1067623313300020581SoilDLRTVQQWLGHSDMESTMRYLKPSRSQHVRDKVNEIFA
Ga0210401_1144303213300020583SoilMSWAEVDLGTVQHWLGHSDMESTMRYLKPSRSEKAGEKVNEIFG
Ga0215015_1109086713300021046SoilRTVQQWLGHSDMESTMRYLKPSRSQRVHAKVNEIFAL
Ga0210400_1115641613300021170SoilDLRTVQQWLGHSDMESTMRYLKPSRSRHVRDKVNEIFA
Ga0210405_1001874243300021171SoilMFYEMVIRQQWLGHSDMESTMRYLKPSRSQQVHEKVNEIFS
Ga0210388_1092398923300021181SoilLWAGVDLRTVQQWLGHSDMESTMCYLKPSRSQQVREKVNEIFG
Ga0210397_1045977243300021403SoilDLRTVQQWMGHTDMESTMRYLKPNRSQAVREKVNQTFAGQ
Ga0210386_1123605213300021406SoilLRTVQQWLGHSDMESTMRYLKPSRSQHVREKVNEIFG
Ga0210384_1103983213300021432SoilWRGLRTVQQWLGHSDMESTMRYLKPSRSQQVKEKVNEIFA
Ga0126371_1013067553300021560Tropical Forest SoilLRTVQQWLGHSDMESTMRYLKPARNEAVREKVNEIFGGKNGK
Ga0213852_117113913300021858WatershedsLRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFA
Ga0224549_102960313300022840SoilFDLRTVQQWLGHSDMESTMRYLQPSRSQHVKDKVNEIFG
Ga0208220_108169433300025627Arctic Peat SoilTVQNWLGHSDIESTMRYLKPSRSQQTRDKVNEIFGGVK
Ga0209584_1022637523300025878Arctic Peat SoilTVQTWLGHSDMESTLRYLKAASARKPIVREKVNAAFASMAR
Ga0207693_1104389213300025915Corn, Switchgrass And Miscanthus RhizosphereDLRTVQQWLGHSDMESTMRYLKPSRSQQVRAKVNEIFGGAQ
Ga0207660_1118583313300025917Corn RhizosphereTVQQWLGHSDMESTMRYLEPSRSKQVREKVNEIFP
Ga0207700_1123168313300025928Corn, Switchgrass And Miscanthus RhizosphereDLRTVQQRLGHSDMESTMRYLKPSRSEKVREKVNEIFA
Ga0207667_1059899313300025949Corn RhizosphereLRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFGGVQ
Ga0207677_1210953913300026023Miscanthus RhizosphereSGVDLRTVHLWLGHKDMESTMRYLKPARGKGVRDEVNATFEG
Ga0209890_1010113513300026291SoilWHLQGGADLRTVQKWLGQTDMESTLRYLRSARGVAVHDKVNATFA
Ga0209267_122801413300026331SoilRTVQHWMGHKDIESTMRYLKPNRSQEVKAKVNHTFA
Ga0257161_101219123300026508SoilVDLRTVQQWLGHSDMESTMRYLKPSRSQHVRDKVNEIFA
Ga0209039_1002275913300027825Bog Forest SoilLRTVQLWMGHSDMESTMRYLKPNRSQAVREKVNAMFG
Ga0209274_1059489113300027853SoilLRTVQSWMGHTDLQSTMRYLKPSRTQATRDKVNEIFAKVCK
Ga0209517_1028325423300027854Peatlands SoilRTVQQWLGHSDMESTMRYLKPSRSQHVRDKVNEIFA
Ga0209006_1043869633300027908Forest SoilTVQQWLGHSDMESTMRYLKPSRSQHVREKVNEIFA
Ga0257175_111746723300028673SoilTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFA
Ga0302233_1042799913300028746PalsaLRTVQQWLGHTDMESTMRYLKPSRSQAVRRKVNKIFA
Ga0247275_101393143300029817SoilMQAEVRFPWANVDLRTVQLWLGHKDLESTMRYLKPSRSRATRDKVNEIFA
Ga0311365_1099650813300029989FenLRTVQLWMGHSDMESTMRYLKPNRSQAVREKVNVMFG
Ga0311339_1003557373300029999PalsaVQNTAFGHSEMESTMRYLKPSRSQHVRLKANEIFA
Ga0311337_1061685023300030000FenTVQLWMGHSDMESTMRYLKPNRSQAVREKVNAMFG
Ga0311338_1096579013300030007PalsaTVQQWLGHSDRESTMRYLKPSRSQQVRDKVNEIFGR
Ga0311333_1039313013300030114FenDLRTVQLWMGHSDMESTMRYLKPNRSQAVREKVNAMFG
Ga0311372_1038447323300030520PalsaAGVDLRTVQQWLGHSDRESTMRYLKPSRSQQVRDKVNEIFGR
Ga0311335_1057005623300030838FenRTVQLWMGHSDMESTMRYLKPNRSQAVREKVNVMFG
Ga0265740_104301013300030940SoilVQQWLGHSDMESTMRYLKPSRSQQVLEKVNEIFGGVQ
Ga0308190_116501413300030993SoilGVDLRTVQQWLGHSDMESTMRYLKPSHSQQVRKKVNEIFA
Ga0265760_1022870423300031090SoilRTVQQWLGHSDMESTMRYLKPSRSQATKDKVNATFAAGGAQ
Ga0310686_11639284213300031708SoilTVQSWLGHSDMESTMRYLKPSRSQATRDKVNTAFAASAQG
Ga0307476_1044605923300031715Hardwood Forest SoilRTVQQWLGHSDMESTMRYLKPSRSQKTHEKVNEIFA
Ga0307469_1101774313300031720Hardwood Forest SoilVGSVDARTVQQWLDHSDMESTMRYLKPSRSQQVRDKVDEI
Ga0311351_1051448023300031722FenRTVQLWMGHSDMESTMRYLKPNRSQAVREKVNAMFG
Ga0307473_1024517823300031820Hardwood Forest SoilTVQSWLGHKDLESTMRYLKPSRSQAVKDKVDATFA
Ga0307478_1054255413300031823Hardwood Forest SoilVDLRTVQQWLGHSDMESTMRYLKPSRSQHVLDKVNEIFA
Ga0306922_1164277323300032001SoilVDLRTVQDWMGHTDIESTMRYLKPNRNKAVRQKVNETFRR
Ga0307471_10348066123300032180Hardwood Forest SoilLRTVQQWLGQSDMESTMRSLKPSRTQQAREKVHEVFA
Ga0306920_10293153423300032261SoilVDLRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFQ
Ga0335078_1001147313300032805SoilRTVQQWLGHSDMESTMRYLKPSRSEKVREKVNEIFAL
Ga0335078_1214082113300032805SoilDLRTVQQWLGHSDMESTMRYLKPSRSQAVAAKVNETFA
Ga0335080_1204025913300032828SoilLRTVQQWLGHSDIESTMRYLKPARDKQTRAKVNEIFA
Ga0335081_1000364113300032892SoilTVQQWLGHSDMESTMRYLKPSRSEKVREKVNEIFA
Ga0335071_1000472713300032897SoilTVQQWLGHSDMESTMRYLKPSRSEKVREKVNEIFAL
Ga0335083_1053709813300032954SoilQQWLGHSDMESTMRYLKPSRSPQVREKMNEISASLDAG
Ga0326728_1081414723300033402Peat SoilQQWLGHSDMESTMRYLKPARNEAVREKVNEIFGGKNGS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.