| Basic Information | |
|---|---|
| Family ID | F055162 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 139 |
| Average Sequence Length | 38 residues |
| Representative Sequence | LRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFA |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.60 % |
| % of genes near scaffold ends (potentially truncated) | 88.49 % |
| % of genes from short scaffolds (< 2000 bps) | 89.21 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.964 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (9.352 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.741 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.396 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.46% β-sheet: 0.00% Coil/Unstructured: 61.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF12728 | HTH_17 | 16.55 |
| PF00589 | Phage_integrase | 12.95 |
| PF08843 | AbiEii | 2.16 |
| PF00069 | Pkinase | 2.16 |
| PF00691 | OmpA | 1.44 |
| PF02371 | Transposase_20 | 0.72 |
| PF05065 | Phage_capsid | 0.72 |
| PF06537 | DHOR | 0.72 |
| PF05227 | CHASE3 | 0.72 |
| PF00722 | Glyco_hydro_16 | 0.72 |
| PF13517 | FG-GAP_3 | 0.72 |
| PF13671 | AAA_33 | 0.72 |
| PF08448 | PAS_4 | 0.72 |
| PF10011 | DUF2254 | 0.72 |
| PF07676 | PD40 | 0.72 |
| PF12740 | Chlorophyllase2 | 0.72 |
| PF05101 | VirB3 | 0.72 |
| PF01548 | DEDD_Tnp_IS110 | 0.72 |
| PF03544 | TonB_C | 0.72 |
| PF13620 | CarboxypepD_reg | 0.72 |
| PF00027 | cNMP_binding | 0.72 |
| PF13545 | HTH_Crp_2 | 0.72 |
| PF04542 | Sigma70_r2 | 0.72 |
| PF13602 | ADH_zinc_N_2 | 0.72 |
| PF05721 | PhyH | 0.72 |
| PF02055 | Glyco_hydro_30 | 0.72 |
| PF07228 | SpoIIE | 0.72 |
| PF03703 | bPH_2 | 0.72 |
| PF01168 | Ala_racemase_N | 0.72 |
| PF00196 | GerE | 0.72 |
| PF00860 | Xan_ur_permease | 0.72 |
| PF13191 | AAA_16 | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 8.63 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 2.16 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.44 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.72 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.72 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.72 |
| COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 0.72 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.72 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.72 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.72 |
| COG3702 | Type IV secretory pathway, VirB3 component | Intracellular trafficking, secretion, and vesicular transport [U] | 0.72 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.72 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.72 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.72 |
| COG5520 | O-Glycosyl hydrolase | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.96 % |
| Unclassified | root | N/A | 5.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_105205638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1432 | Open in IMG/M |
| 3300001087|JGI12677J13195_1011936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 603 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101652996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10030650 | All Organisms → cellular organisms → Bacteria | 1958 | Open in IMG/M |
| 3300004092|Ga0062389_103394672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300004463|Ga0063356_104263115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium TAA 166 | 615 | Open in IMG/M |
| 3300004633|Ga0066395_10311924 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300004643|Ga0062591_101309327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300005459|Ga0068867_100130454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1953 | Open in IMG/M |
| 3300005468|Ga0070707_101529057 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005553|Ga0066695_10573936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 681 | Open in IMG/M |
| 3300005559|Ga0066700_10195977 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300005563|Ga0068855_100499619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1322 | Open in IMG/M |
| 3300005591|Ga0070761_10188306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
| 3300005764|Ga0066903_101307961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1355 | Open in IMG/M |
| 3300005764|Ga0066903_102061370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1097 | Open in IMG/M |
| 3300005840|Ga0068870_11346009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 521 | Open in IMG/M |
| 3300006052|Ga0075029_100757552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 658 | Open in IMG/M |
| 3300006052|Ga0075029_100828159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 631 | Open in IMG/M |
| 3300006059|Ga0075017_100142088 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300006059|Ga0075017_100679900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 791 | Open in IMG/M |
| 3300006162|Ga0075030_100830718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300006162|Ga0075030_101449308 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300006172|Ga0075018_10303092 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300006174|Ga0075014_100320126 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300006176|Ga0070765_100077998 | All Organisms → cellular organisms → Bacteria | 2800 | Open in IMG/M |
| 3300006176|Ga0070765_100635781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
| 3300006893|Ga0073928_10497066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300006954|Ga0079219_10589394 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300009029|Ga0066793_10526222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300009137|Ga0066709_103623082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 560 | Open in IMG/M |
| 3300009519|Ga0116108_1256768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300009522|Ga0116218_1327081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300009524|Ga0116225_1447024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 574 | Open in IMG/M |
| 3300009637|Ga0116118_1198471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300009646|Ga0116132_1250694 | Not Available | 538 | Open in IMG/M |
| 3300009665|Ga0116135_1139523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 3300010048|Ga0126373_10367227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1456 | Open in IMG/M |
| 3300010048|Ga0126373_11864258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300010329|Ga0134111_10094044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1143 | Open in IMG/M |
| 3300010343|Ga0074044_10821358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300010360|Ga0126372_11850919 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300010361|Ga0126378_10313061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1675 | Open in IMG/M |
| 3300010361|Ga0126378_10620323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1195 | Open in IMG/M |
| 3300010362|Ga0126377_12955626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300010366|Ga0126379_12585926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300010376|Ga0126381_100045817 | Not Available | 5325 | Open in IMG/M |
| 3300010376|Ga0126381_101270632 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1064 | Open in IMG/M |
| 3300010376|Ga0126381_104856689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300010379|Ga0136449_101535123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1017 | Open in IMG/M |
| 3300010379|Ga0136449_102260137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
| 3300010398|Ga0126383_13646054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300010400|Ga0134122_10168096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1796 | Open in IMG/M |
| 3300011269|Ga0137392_11167407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300012200|Ga0137382_10023515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3578 | Open in IMG/M |
| 3300012205|Ga0137362_11524524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300012210|Ga0137378_11402972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300012357|Ga0137384_10546378 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300012363|Ga0137390_11368173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300012927|Ga0137416_11756221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300012964|Ga0153916_12199497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300012971|Ga0126369_10306735 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300014054|Ga0120135_1055169 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 621 | Open in IMG/M |
| 3300014155|Ga0181524_10300987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 731 | Open in IMG/M |
| 3300014162|Ga0181538_10596835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300014164|Ga0181532_10048366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2820 | Open in IMG/M |
| 3300014164|Ga0181532_10051368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2722 | Open in IMG/M |
| 3300015358|Ga0134089_10357521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300015371|Ga0132258_10900830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2233 | Open in IMG/M |
| 3300015371|Ga0132258_12153007 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300016357|Ga0182032_10711097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
| 3300017823|Ga0187818_10059433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1644 | Open in IMG/M |
| 3300017934|Ga0187803_10119762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
| 3300017961|Ga0187778_10141710 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300017961|Ga0187778_11295509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300017970|Ga0187783_10661472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300017972|Ga0187781_10391500 | Not Available | 991 | Open in IMG/M |
| 3300017975|Ga0187782_10590885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300018005|Ga0187878_1279281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300018006|Ga0187804_10211230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 831 | Open in IMG/M |
| 3300018025|Ga0187885_10073973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1694 | Open in IMG/M |
| 3300018040|Ga0187862_10409786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
| 3300018090|Ga0187770_11078079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300018433|Ga0066667_11776060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300020581|Ga0210399_10676233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
| 3300020583|Ga0210401_11443032 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300021046|Ga0215015_11090867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1162 | Open in IMG/M |
| 3300021170|Ga0210400_11156416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300021171|Ga0210405_10018742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5649 | Open in IMG/M |
| 3300021181|Ga0210388_10923989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300021403|Ga0210397_10459772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 959 | Open in IMG/M |
| 3300021406|Ga0210386_11236052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300021432|Ga0210384_11039832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300021560|Ga0126371_10130675 | All Organisms → cellular organisms → Bacteria | 2550 | Open in IMG/M |
| 3300021858|Ga0213852_1171139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1163 | Open in IMG/M |
| 3300022840|Ga0224549_1029603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 744 | Open in IMG/M |
| 3300025627|Ga0208220_1081694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 892 | Open in IMG/M |
| 3300025878|Ga0209584_10226375 | Not Available | 714 | Open in IMG/M |
| 3300025915|Ga0207693_11043892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300025917|Ga0207660_11185833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300025928|Ga0207700_11231683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300025949|Ga0207667_10598993 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300026023|Ga0207677_12109539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300026291|Ga0209890_10101135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| 3300026331|Ga0209267_1228014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300026508|Ga0257161_1012191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1571 | Open in IMG/M |
| 3300027825|Ga0209039_10022759 | All Organisms → cellular organisms → Bacteria | 3156 | Open in IMG/M |
| 3300027853|Ga0209274_10594891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300027854|Ga0209517_10283254 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300027908|Ga0209006_10438696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Rhodoferax → Rhodoferax sediminis | 1095 | Open in IMG/M |
| 3300028673|Ga0257175_1117467 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300028746|Ga0302233_10427999 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300029817|Ga0247275_1013931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2781 | Open in IMG/M |
| 3300029989|Ga0311365_10996508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300029999|Ga0311339_10035573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6994 | Open in IMG/M |
| 3300030000|Ga0311337_10616850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
| 3300030007|Ga0311338_10965790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
| 3300030114|Ga0311333_10393130 | Not Available | 1120 | Open in IMG/M |
| 3300030520|Ga0311372_10384473 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
| 3300030838|Ga0311335_10570056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300030940|Ga0265740_1043010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300030993|Ga0308190_1165014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300031090|Ga0265760_10228704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300031708|Ga0310686_116392842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| 3300031715|Ga0307476_10446059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300031720|Ga0307469_11017743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300031722|Ga0311351_10514480 | Not Available | 909 | Open in IMG/M |
| 3300031820|Ga0307473_10245178 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300031823|Ga0307478_10542554 | Not Available | 971 | Open in IMG/M |
| 3300032001|Ga0306922_11642773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 638 | Open in IMG/M |
| 3300032180|Ga0307471_103480661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 557 | Open in IMG/M |
| 3300032261|Ga0306920_102931534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300032805|Ga0335078_10011473 | All Organisms → cellular organisms → Bacteria | 13140 | Open in IMG/M |
| 3300032805|Ga0335078_12140821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300032828|Ga0335080_12040259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300032892|Ga0335081_10003641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 24257 | Open in IMG/M |
| 3300032897|Ga0335071_10004727 | All Organisms → cellular organisms → Bacteria | 14216 | Open in IMG/M |
| 3300032954|Ga0335083_10537098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_56_16 | 973 | Open in IMG/M |
| 3300033402|Ga0326728_10814147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.19% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.32% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.60% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.60% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.60% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.16% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.16% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.16% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.16% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.44% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.44% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.44% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.72% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.72% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.72% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.72% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.72% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.72% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001087 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1052056381 | 3300000955 | Soil | VDLRTVQQGLGRSDMESTMRYLKPSRSEKVREKVNQIFA* |
| JGI12677J13195_10119362 | 3300001087 | Forest Soil | VQQWLGHSDMESTMRYLKPSRSQHVREKVNGIFA* |
| JGIcombinedJ26739_1016529961 | 3300002245 | Forest Soil | LQLWLGHSDTESTMRYLKPARGPLMREKVNEIFA* |
| JGIcombinedJ51221_100306503 | 3300003505 | Forest Soil | MVTLGWRGLRTVQQWLGHSDMESTMRYLKPSRSQQVKEKVNEIFA* |
| Ga0062389_1033946722 | 3300004092 | Bog Forest Soil | MRDLRTAQQWLGHSDMDSTMRYLKPSRSQLVRDKVNENV* |
| Ga0063356_1042631151 | 3300004463 | Arabidopsis Thaliana Rhizosphere | ILRRLRTVQQWLGQSDMESTMRSLKPSRTQQAREKVHEVFA* |
| Ga0066395_103119241 | 3300004633 | Tropical Forest Soil | VDLRTVQQWLGHSDMESTMRYLKPSRSEYTRQKVNEIFR* |
| Ga0062591_1013093272 | 3300004643 | Soil | VELRTVQQWLGHSDMESTMRYLEPSRSKQVREKVNEIFP* |
| Ga0068867_1001304542 | 3300005459 | Miscanthus Rhizosphere | VELRTVQQWLGHSDMESTMRYLEPSRSKQVREKVDEIFP* |
| Ga0070707_1015290571 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VDLRTVQNWLGHSDLESTMRYLKPSRNQAVQDKVNEIFT* |
| Ga0066695_105739361 | 3300005553 | Soil | DLRTVQLWLGHKDLESTMRYLRPARGRAAREKVNNTFATA* |
| Ga0066700_101959771 | 3300005559 | Soil | DLRTVQLWLGHKDLESTMRYLKPARGKGIRLKVNATFA* |
| Ga0068855_1004996191 | 3300005563 | Corn Rhizosphere | VQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFGGVQ* |
| Ga0070761_101883063 | 3300005591 | Soil | LRTVQSWMGHTDLQSTMRYLKPSRTQATRDKVNEIFAKVCK* |
| Ga0066903_1013079612 | 3300005764 | Tropical Forest Soil | LWAGVDLWTVQQYLGHSDMESTMRYLKPSRSEKERDKVNQIFA* |
| Ga0066903_1020613702 | 3300005764 | Tropical Forest Soil | VDLRTVQLWLGHSDIESTMRYLKPSRSPQVRDKVNEIFA* |
| Ga0068870_113460091 | 3300005840 | Miscanthus Rhizosphere | VQQWLGHSDMESTMRYLKPSRSQKVREKVNEIFA* |
| Ga0075029_1007575522 | 3300006052 | Watersheds | VQLWLGHKDLESTMRYLKPARGKEIRSKVDLTFATGAK* |
| Ga0075029_1008281591 | 3300006052 | Watersheds | VQQWLGHSDMESTMRYLKPSRSQQTRDKVNEIFA* |
| Ga0075017_1001420881 | 3300006059 | Watersheds | VQQWLGHSDMESTMRYLKPSRSQHVRDKVNEIFA* |
| Ga0075017_1006799002 | 3300006059 | Watersheds | TVQQWLGHSDMESTMRYLKPSRSQQTREKVNEIFA* |
| Ga0075030_1008307181 | 3300006162 | Watersheds | VQQWLGHSDMESTMRHLKPSRSQQVRDKVNEIFA* |
| Ga0075030_1014493081 | 3300006162 | Watersheds | VQQWLGHSDMESTMRYLKPSRSQRVRNKVNEIFG* |
| Ga0075018_103030921 | 3300006172 | Watersheds | VQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFA* |
| Ga0075014_1003201262 | 3300006174 | Watersheds | VQLWLGHSDMESTMRYLNPLRSQHVRDKVNEIFA* |
| Ga0070765_1000779985 | 3300006176 | Soil | DLRTVQQWLGHSDMESTMRYLKPSRSQQTREKVNEIFAL* |
| Ga0070765_1006357811 | 3300006176 | Soil | TVQQWLGHSDMESTMRYLKPSRSQHVREKVNEIFA* |
| Ga0073928_104970661 | 3300006893 | Iron-Sulfur Acid Spring | TVQQWLGHSDMESTLRYLKPSRSQATRDKVNAIFA* |
| Ga0079219_105893942 | 3300006954 | Agricultural Soil | TVQQWLGHTDMESTMRYLKPARNQVVRDKVNEIFA* |
| Ga0066793_105262222 | 3300009029 | Prmafrost Soil | LRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFGGVQ* |
| Ga0066709_1036230821 | 3300009137 | Grasslands Soil | VDLRTVQHWMGHKDIESTMRYLKPNRGQEVRAKVNNSFA* |
| Ga0116108_12567681 | 3300009519 | Peatland | VDLRTVQRWLGHEDMESTMRYFKPSRSKATREKESEIFAD* |
| Ga0116218_13270811 | 3300009522 | Peatlands Soil | VDLRTVQQWLGHSDMESTVRYLKPSRSQQTREKVNEIFA* |
| Ga0116225_14470241 | 3300009524 | Peatlands Soil | DLRTVQQWLGHSDMESTMRYLKPSRSQQTREKVNAIFA* |
| Ga0116118_11984712 | 3300009637 | Peatland | VDLRTVLQWLGHKDLESTMRYLKPSRSQQTRDKVNEIFA* |
| Ga0116132_12506941 | 3300009646 | Peatland | VDLRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFAL* |
| Ga0116135_11395231 | 3300009665 | Peatland | DLRTVQQWLGHSDIESTMRYLKPSRSQATRDKVNEIFAD* |
| Ga0126373_103672271 | 3300010048 | Tropical Forest Soil | GIDLRTVQAYLGHKDLESTMRYLKPSRTPKAREKINEVFA* |
| Ga0126373_118642581 | 3300010048 | Tropical Forest Soil | VQHWFGHADLESTMRYLKPSRSQHVRDKMDTIFA* |
| Ga0134111_100940441 | 3300010329 | Grasslands Soil | RTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFA* |
| Ga0074044_108213582 | 3300010343 | Bog Forest Soil | PHGSACWLGHSDMESTMRYLKPSRSQHVRDKVNEIFA* |
| Ga0126372_118509192 | 3300010360 | Tropical Forest Soil | VDLRTVQSWMGHTDLASTMRYLKPNHSQEVRVKVNNTFA* |
| Ga0126378_103130612 | 3300010361 | Tropical Forest Soil | DLRTVQHWLGHTDIESTMRYLKPSRSQQVRDKMDEVFASPDFEIAS* |
| Ga0126378_106203231 | 3300010361 | Tropical Forest Soil | LRTVQHWMGHKDLESTMRYLKPNRGPAVRDKVNATFAQ* |
| Ga0126377_129556261 | 3300010362 | Tropical Forest Soil | RTVQQWLGHSDMESTMRYLKPSRSEKVREKVNDIFA* |
| Ga0126379_125859261 | 3300010366 | Tropical Forest Soil | TVQQWLGHSDMESTMRYLKPSRSETVRDKINSIFA* |
| Ga0126381_1000458171 | 3300010376 | Tropical Forest Soil | VDLRTVQQWLGHSDMESTMRYLKASRSEKVHDKVNPIFV* |
| Ga0126381_1012706321 | 3300010376 | Tropical Forest Soil | DLRTVQLWLGHTEIESTMRYLKPSRSAETHRKVNEIFPSRKRLST* |
| Ga0126381_1048566891 | 3300010376 | Tropical Forest Soil | TVQMWMGHTDIESTMRYLKPSRSQKMQEKVNEIFG* |
| Ga0136449_1015351231 | 3300010379 | Peatlands Soil | RTVQQWLGHSDMESTMRYLKPSRSQHVREKVNEIFA* |
| Ga0136449_1022601372 | 3300010379 | Peatlands Soil | LATVDLRTVQQWLGHSDMESTMRYLKPSRSKQTREKVNEIFAL* |
| Ga0126383_136460541 | 3300010398 | Tropical Forest Soil | WAGVDLRTGQHWLGHSDMESTIRYLKTSRSEKVRDKVNQIFA* |
| Ga0134122_101680965 | 3300010400 | Terrestrial Soil | RTVQQWLGHSGMESTMRYLKPSRSKQVREKVNEIFP* |
| Ga0137392_111674071 | 3300011269 | Vadose Zone Soil | VQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFGGDQ* |
| Ga0137382_100235151 | 3300012200 | Vadose Zone Soil | TVQLWLGHHDLKSTMRYLKPARGKNIRAKVNATFTD* |
| Ga0137362_115245242 | 3300012205 | Vadose Zone Soil | DLRTVQHWMGHKDIESTMRYLKPNRSQEVKAKVNHTFA* |
| Ga0137378_114029721 | 3300012210 | Vadose Zone Soil | LRTVQMWLGHSDMESTMRYLKPSRSQAVRDKVDETFA* |
| Ga0137384_105463783 | 3300012357 | Vadose Zone Soil | DLRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFGGVQ* |
| Ga0137390_113681731 | 3300012363 | Vadose Zone Soil | VDLRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFA* |
| Ga0137416_117562211 | 3300012927 | Vadose Zone Soil | VDLRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFGGDQ* |
| Ga0153916_121994971 | 3300012964 | Freshwater Wetlands | DLRTVQQWMGHTDLESTLRYLKPNRSAAVRDKVNSMFDY* |
| Ga0126369_103067354 | 3300012971 | Tropical Forest Soil | RTVQQWLGHSDMESTVRYLKPSRSEKRREKVNKIFA* |
| Ga0120135_10551691 | 3300014054 | Permafrost | RTVQQWLGHSDMESTMRYLKPSRSQHVRDKVNEIFA* |
| Ga0181524_103009872 | 3300014155 | Bog | VDLRTVQQWLGHSDMESTMRYLKPSRSQHVRDKVNEIFA* |
| Ga0181538_105968351 | 3300014162 | Bog | HKDIESTMRYLKPARDAQSRAKVNDIFAFASENH* |
| Ga0181532_100483665 | 3300014164 | Bog | AGVDLRSVQEWLGHSDMESTMRYLKPSRSQQTRDKVNEIFA* |
| Ga0181532_100513687 | 3300014164 | Bog | DIRTVQSYLGHSDLESTLRYLKPSRSQATRDKVNEIFGEVLA* |
| Ga0134089_103575211 | 3300015358 | Grasslands Soil | DLRTVQQWLGHSDMESTMRYLKPSRSQQVRQKVNKIFA* |
| Ga0132258_109008301 | 3300015371 | Arabidopsis Rhizosphere | PWAGVDHRTVQQWLGHSDMESTMRYLKPSRSEKVREKVNEIFA* |
| Ga0132258_121530073 | 3300015371 | Arabidopsis Rhizosphere | VDLRTVQQWLGHSDMESTMRYLKPSRNRTVREKVNEIFA* |
| Ga0182032_107110972 | 3300016357 | Soil | TVQQWLGHSDMESTMRYLKPSRSEKVREKVNQIFG |
| Ga0187818_100594332 | 3300017823 | Freshwater Sediment | MGLERTVQLWMGHADMESTMRYLTPHRSQAVREKVNTMF |
| Ga0187803_101197623 | 3300017934 | Freshwater Sediment | MGLERTVQLWMGHADMESTMRYLTPHRSQAVREKVNTML |
| Ga0187778_101417101 | 3300017961 | Tropical Peatland | RTVQQWLGHSDMESTMRYLKPSRSEKVREKVNQIFA |
| Ga0187778_112955092 | 3300017961 | Tropical Peatland | QLWLGHSDLESTMRYLKPSRSEQVQAKVNDTFSKMGAEA |
| Ga0187783_106614722 | 3300017970 | Tropical Peatland | DLRTVQQWLGHSDMESTMRYLKPARDKKVHEKVNETFSKLI |
| Ga0187781_103915001 | 3300017972 | Tropical Peatland | VRAVQQWLGHFDVESTMRYLKPARDKKVHEKVNETFSKLEFDWE |
| Ga0187782_105908852 | 3300017975 | Tropical Peatland | VDLRTVQERMGRTDIESTMTYLKPNRNKAVRERVNETFAGRA |
| Ga0187878_12792811 | 3300018005 | Peatland | RTVQQWMGHSDMESTMRYLKPNRSTAVRDKVNTIFGD |
| Ga0187804_102112303 | 3300018006 | Freshwater Sediment | VQQWLGHSDMESTMRYLKPSRSQKVRDKVNEIFGGVNG |
| Ga0187885_100739733 | 3300018025 | Peatland | DLRTVQQWLGHSDMESTMRYLKPSRSQQTREKVNEIFA |
| Ga0187862_104097861 | 3300018040 | Peatland | DLRTVQQWLGHSDMESTMRYLKPSRSRIVSEKVNEIFG |
| Ga0187770_110780791 | 3300018090 | Tropical Peatland | VQQWLGHSDMESTMRYLKPARNEAVRDKVNEIFGGKNGN |
| Ga0066667_117760601 | 3300018433 | Grasslands Soil | DEYLRTIKQWLGYTDMESNMRYLKPSRSQQVREKVNEIFA |
| Ga0210399_106762331 | 3300020581 | Soil | DLRTVQQWLGHSDMESTMRYLKPSRSQHVRDKVNEIFA |
| Ga0210401_114430321 | 3300020583 | Soil | MSWAEVDLGTVQHWLGHSDMESTMRYLKPSRSEKAGEKVNEIFG |
| Ga0215015_110908671 | 3300021046 | Soil | RTVQQWLGHSDMESTMRYLKPSRSQRVHAKVNEIFAL |
| Ga0210400_111564161 | 3300021170 | Soil | DLRTVQQWLGHSDMESTMRYLKPSRSRHVRDKVNEIFA |
| Ga0210405_100187424 | 3300021171 | Soil | MFYEMVIRQQWLGHSDMESTMRYLKPSRSQQVHEKVNEIFS |
| Ga0210388_109239892 | 3300021181 | Soil | LWAGVDLRTVQQWLGHSDMESTMCYLKPSRSQQVREKVNEIFG |
| Ga0210397_104597724 | 3300021403 | Soil | DLRTVQQWMGHTDMESTMRYLKPNRSQAVREKVNQTFAGQ |
| Ga0210386_112360521 | 3300021406 | Soil | LRTVQQWLGHSDMESTMRYLKPSRSQHVREKVNEIFG |
| Ga0210384_110398321 | 3300021432 | Soil | WRGLRTVQQWLGHSDMESTMRYLKPSRSQQVKEKVNEIFA |
| Ga0126371_101306755 | 3300021560 | Tropical Forest Soil | LRTVQQWLGHSDMESTMRYLKPARNEAVREKVNEIFGGKNGK |
| Ga0213852_11711391 | 3300021858 | Watersheds | LRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFA |
| Ga0224549_10296031 | 3300022840 | Soil | FDLRTVQQWLGHSDMESTMRYLQPSRSQHVKDKVNEIFG |
| Ga0208220_10816943 | 3300025627 | Arctic Peat Soil | TVQNWLGHSDIESTMRYLKPSRSQQTRDKVNEIFGGVK |
| Ga0209584_102263752 | 3300025878 | Arctic Peat Soil | TVQTWLGHSDMESTLRYLKAASARKPIVREKVNAAFASMAR |
| Ga0207693_110438921 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DLRTVQQWLGHSDMESTMRYLKPSRSQQVRAKVNEIFGGAQ |
| Ga0207660_111858331 | 3300025917 | Corn Rhizosphere | TVQQWLGHSDMESTMRYLEPSRSKQVREKVNEIFP |
| Ga0207700_112316831 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | DLRTVQQRLGHSDMESTMRYLKPSRSEKVREKVNEIFA |
| Ga0207667_105989931 | 3300025949 | Corn Rhizosphere | LRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFGGVQ |
| Ga0207677_121095391 | 3300026023 | Miscanthus Rhizosphere | SGVDLRTVHLWLGHKDMESTMRYLKPARGKGVRDEVNATFEG |
| Ga0209890_101011351 | 3300026291 | Soil | WHLQGGADLRTVQKWLGQTDMESTLRYLRSARGVAVHDKVNATFA |
| Ga0209267_12280141 | 3300026331 | Soil | RTVQHWMGHKDIESTMRYLKPNRSQEVKAKVNHTFA |
| Ga0257161_10121912 | 3300026508 | Soil | VDLRTVQQWLGHSDMESTMRYLKPSRSQHVRDKVNEIFA |
| Ga0209039_100227591 | 3300027825 | Bog Forest Soil | LRTVQLWMGHSDMESTMRYLKPNRSQAVREKVNAMFG |
| Ga0209274_105948911 | 3300027853 | Soil | LRTVQSWMGHTDLQSTMRYLKPSRTQATRDKVNEIFAKVCK |
| Ga0209517_102832542 | 3300027854 | Peatlands Soil | RTVQQWLGHSDMESTMRYLKPSRSQHVRDKVNEIFA |
| Ga0209006_104386963 | 3300027908 | Forest Soil | TVQQWLGHSDMESTMRYLKPSRSQHVREKVNEIFA |
| Ga0257175_11174672 | 3300028673 | Soil | TVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFA |
| Ga0302233_104279991 | 3300028746 | Palsa | LRTVQQWLGHTDMESTMRYLKPSRSQAVRRKVNKIFA |
| Ga0247275_10139314 | 3300029817 | Soil | MQAEVRFPWANVDLRTVQLWLGHKDLESTMRYLKPSRSRATRDKVNEIFA |
| Ga0311365_109965081 | 3300029989 | Fen | LRTVQLWMGHSDMESTMRYLKPNRSQAVREKVNVMFG |
| Ga0311339_100355737 | 3300029999 | Palsa | VQNTAFGHSEMESTMRYLKPSRSQHVRLKANEIFA |
| Ga0311337_106168502 | 3300030000 | Fen | TVQLWMGHSDMESTMRYLKPNRSQAVREKVNAMFG |
| Ga0311338_109657901 | 3300030007 | Palsa | TVQQWLGHSDRESTMRYLKPSRSQQVRDKVNEIFGR |
| Ga0311333_103931301 | 3300030114 | Fen | DLRTVQLWMGHSDMESTMRYLKPNRSQAVREKVNAMFG |
| Ga0311372_103844732 | 3300030520 | Palsa | AGVDLRTVQQWLGHSDRESTMRYLKPSRSQQVRDKVNEIFGR |
| Ga0311335_105700562 | 3300030838 | Fen | RTVQLWMGHSDMESTMRYLKPNRSQAVREKVNVMFG |
| Ga0265740_10430101 | 3300030940 | Soil | VQQWLGHSDMESTMRYLKPSRSQQVLEKVNEIFGGVQ |
| Ga0308190_11650141 | 3300030993 | Soil | GVDLRTVQQWLGHSDMESTMRYLKPSHSQQVRKKVNEIFA |
| Ga0265760_102287042 | 3300031090 | Soil | RTVQQWLGHSDMESTMRYLKPSRSQATKDKVNATFAAGGAQ |
| Ga0310686_1163928421 | 3300031708 | Soil | TVQSWLGHSDMESTMRYLKPSRSQATRDKVNTAFAASAQG |
| Ga0307476_104460592 | 3300031715 | Hardwood Forest Soil | RTVQQWLGHSDMESTMRYLKPSRSQKTHEKVNEIFA |
| Ga0307469_110177431 | 3300031720 | Hardwood Forest Soil | VGSVDARTVQQWLDHSDMESTMRYLKPSRSQQVRDKVDEI |
| Ga0311351_105144802 | 3300031722 | Fen | RTVQLWMGHSDMESTMRYLKPNRSQAVREKVNAMFG |
| Ga0307473_102451782 | 3300031820 | Hardwood Forest Soil | TVQSWLGHKDLESTMRYLKPSRSQAVKDKVDATFA |
| Ga0307478_105425541 | 3300031823 | Hardwood Forest Soil | VDLRTVQQWLGHSDMESTMRYLKPSRSQHVLDKVNEIFA |
| Ga0306922_116427732 | 3300032001 | Soil | VDLRTVQDWMGHTDIESTMRYLKPNRNKAVRQKVNETFRR |
| Ga0307471_1034806612 | 3300032180 | Hardwood Forest Soil | LRTVQQWLGQSDMESTMRSLKPSRTQQAREKVHEVFA |
| Ga0306920_1029315342 | 3300032261 | Soil | VDLRTVQQWLGHSDMESTMRYLKPSRSQQVREKVNEIFQ |
| Ga0335078_100114731 | 3300032805 | Soil | RTVQQWLGHSDMESTMRYLKPSRSEKVREKVNEIFAL |
| Ga0335078_121408211 | 3300032805 | Soil | DLRTVQQWLGHSDMESTMRYLKPSRSQAVAAKVNETFA |
| Ga0335080_120402591 | 3300032828 | Soil | LRTVQQWLGHSDIESTMRYLKPARDKQTRAKVNEIFA |
| Ga0335081_100036411 | 3300032892 | Soil | TVQQWLGHSDMESTMRYLKPSRSEKVREKVNEIFA |
| Ga0335071_100047271 | 3300032897 | Soil | TVQQWLGHSDMESTMRYLKPSRSEKVREKVNEIFAL |
| Ga0335083_105370981 | 3300032954 | Soil | QQWLGHSDMESTMRYLKPSRSPQVREKMNEISASLDAG |
| Ga0326728_108141472 | 3300033402 | Peat Soil | QQWLGHSDMESTMRYLKPARNEAVREKVNEIFGGKNGS |
| ⦗Top⦘ |