Basic Information | |
---|---|
Family ID | F055161 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 139 |
Average Sequence Length | 45 residues |
Representative Sequence | MAIAPTLEKYLAAPTTKREADVVALKLFCLFSFILVGLIAAGIL |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 139 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 83.82 % |
% of genes near scaffold ends (potentially truncated) | 17.99 % |
% of genes from short scaffolds (< 2000 bps) | 88.49 % |
Associated GOLD sequencing projects | 102 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (62.590 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds (15.827 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.252 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.568 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 139 Family Scaffolds |
---|---|---|
PF03733 | YccF | 2.16 |
PF03734 | YkuD | 2.16 |
PF07311 | Dodecin | 2.16 |
PF05532 | CsbD | 1.44 |
PF11752 | DUF3309 | 1.44 |
PF09458 | H_lectin | 1.44 |
PF09351 | DUF1993 | 1.44 |
PF04366 | Ysc84 | 1.44 |
PF00893 | Multi_Drug_Res | 0.72 |
PF00036 | EF-hand_1 | 0.72 |
PF00261 | Tropomyosin | 0.72 |
PF01799 | Fer2_2 | 0.72 |
PF10282 | Lactonase | 0.72 |
PF13683 | rve_3 | 0.72 |
PF08241 | Methyltransf_11 | 0.72 |
PF13340 | DUF4096 | 0.72 |
PF13442 | Cytochrome_CBB3 | 0.72 |
PF03625 | DUF302 | 0.72 |
PF09650 | PHA_gran_rgn | 0.72 |
PF13551 | HTH_29 | 0.72 |
PF03884 | YacG | 0.72 |
PF09361 | Phasin_2 | 0.72 |
PF13333 | rve_2 | 0.72 |
PF13360 | PQQ_2 | 0.72 |
PF00117 | GATase | 0.72 |
PF14067 | LssY_C | 0.72 |
PF01402 | RHH_1 | 0.72 |
PF00491 | Arginase | 0.72 |
COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
---|---|---|---|
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 2.16 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 2.16 |
COG3304 | Uncharacterized membrane protein YccF, DUF307 family | Function unknown [S] | 2.16 |
COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 2.16 |
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 1.44 |
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 1.44 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.72 |
COG1196 | Chromosome segregation ATPase Smc | Cell cycle control, cell division, chromosome partitioning [D] | 0.72 |
COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 0.72 |
COG3024 | Endogenous inhibitor of DNA gyrase, YacG/DUF329 family | Replication, recombination and repair [L] | 0.72 |
COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 62.59 % |
All Organisms | root | All Organisms | 37.41 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664022|INPgaii200_c1111793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → unclassified Nitrobacter → Nitrobacter sp. 62-13 | 572 | Open in IMG/M |
3300000567|JGI12270J11330_10039283 | Not Available | 2665 | Open in IMG/M |
3300000567|JGI12270J11330_10040814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2597 | Open in IMG/M |
3300000789|JGI1027J11758_12844312 | Not Available | 713 | Open in IMG/M |
3300000890|JGI11643J12802_11501573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 990 | Open in IMG/M |
3300004006|Ga0055453_10045457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1184 | Open in IMG/M |
3300004070|Ga0055488_10063233 | Not Available | 832 | Open in IMG/M |
3300004803|Ga0058862_10012838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 534 | Open in IMG/M |
3300005164|Ga0066815_10114657 | Not Available | 518 | Open in IMG/M |
3300005332|Ga0066388_100777352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1553 | Open in IMG/M |
3300005345|Ga0070692_10769997 | Not Available | 654 | Open in IMG/M |
3300005434|Ga0070709_10026256 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3450 | Open in IMG/M |
3300005439|Ga0070711_100395902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1120 | Open in IMG/M |
3300005713|Ga0066905_101242748 | Not Available | 668 | Open in IMG/M |
3300005713|Ga0066905_101625938 | Not Available | 592 | Open in IMG/M |
3300006047|Ga0075024_100442603 | Not Available | 670 | Open in IMG/M |
3300006047|Ga0075024_100892443 | Not Available | 505 | Open in IMG/M |
3300006050|Ga0075028_100246912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 979 | Open in IMG/M |
3300006050|Ga0075028_101017188 | Not Available | 516 | Open in IMG/M |
3300006057|Ga0075026_100302479 | Not Available | 873 | Open in IMG/M |
3300006057|Ga0075026_100536390 | Not Available | 679 | Open in IMG/M |
3300006057|Ga0075026_101029765 | Not Available | 514 | Open in IMG/M |
3300006059|Ga0075017_100080809 | Not Available | 2236 | Open in IMG/M |
3300006059|Ga0075017_101268681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
3300006059|Ga0075017_101486697 | Not Available | 533 | Open in IMG/M |
3300006102|Ga0075015_100177673 | Not Available | 1122 | Open in IMG/M |
3300006162|Ga0075030_101427335 | Not Available | 542 | Open in IMG/M |
3300006172|Ga0075018_10462083 | Not Available | 656 | Open in IMG/M |
3300006172|Ga0075018_10477602 | Not Available | 646 | Open in IMG/M |
3300006172|Ga0075018_10769311 | Not Available | 526 | Open in IMG/M |
3300006354|Ga0075021_10536206 | Not Available | 743 | Open in IMG/M |
3300006354|Ga0075021_10745172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
3300006804|Ga0079221_10550998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 763 | Open in IMG/M |
3300006806|Ga0079220_10030938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2370 | Open in IMG/M |
3300006854|Ga0075425_100770135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1104 | Open in IMG/M |
3300006871|Ga0075434_100683955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1044 | Open in IMG/M |
3300006904|Ga0075424_102213340 | Not Available | 578 | Open in IMG/M |
3300009162|Ga0075423_12164539 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300009525|Ga0116220_10142149 | Not Available | 1028 | Open in IMG/M |
3300009810|Ga0105088_1023429 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300009815|Ga0105070_1075472 | Not Available | 645 | Open in IMG/M |
3300009820|Ga0105085_1078403 | Not Available | 625 | Open in IMG/M |
3300009823|Ga0105078_1018599 | Not Available | 792 | Open in IMG/M |
3300009837|Ga0105058_1033946 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
3300010154|Ga0127503_10240322 | Not Available | 695 | Open in IMG/M |
3300010359|Ga0126376_12918422 | Not Available | 528 | Open in IMG/M |
3300010379|Ga0136449_101383902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1088 | Open in IMG/M |
3300010379|Ga0136449_104223110 | Not Available | 532 | Open in IMG/M |
3300010396|Ga0134126_10256553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 2066 | Open in IMG/M |
3300010396|Ga0134126_12723358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 536 | Open in IMG/M |
3300011087|Ga0138570_1022479 | Not Available | 507 | Open in IMG/M |
3300011999|Ga0120148_1079720 | Not Available | 641 | Open in IMG/M |
3300012491|Ga0157329_1028728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
3300012915|Ga0157302_10227595 | Not Available | 685 | Open in IMG/M |
3300012931|Ga0153915_13286708 | Not Available | 525 | Open in IMG/M |
3300012951|Ga0164300_10014868 | All Organisms → cellular organisms → Bacteria | 2561 | Open in IMG/M |
3300012958|Ga0164299_10079185 | Not Available | 1642 | Open in IMG/M |
3300012960|Ga0164301_10075854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1841 | Open in IMG/M |
3300012960|Ga0164301_10919263 | Not Available | 680 | Open in IMG/M |
3300012961|Ga0164302_11550544 | Not Available | 548 | Open in IMG/M |
3300012988|Ga0164306_10742965 | Not Available | 784 | Open in IMG/M |
3300012989|Ga0164305_11576799 | Not Available | 585 | Open in IMG/M |
3300013501|Ga0120154_1061142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 885 | Open in IMG/M |
3300013766|Ga0120181_1002413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7024 | Open in IMG/M |
3300015077|Ga0173483_10430046 | Not Available | 686 | Open in IMG/M |
3300015371|Ga0132258_11089826 | Not Available | 2019 | Open in IMG/M |
3300015371|Ga0132258_11439367 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
3300015371|Ga0132258_12236470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1372 | Open in IMG/M |
3300015372|Ga0132256_100108968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2712 | Open in IMG/M |
3300015372|Ga0132256_103632724 | Not Available | 519 | Open in IMG/M |
3300015373|Ga0132257_100595503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1365 | Open in IMG/M |
3300015374|Ga0132255_105286613 | Not Available | 546 | Open in IMG/M |
3300017822|Ga0187802_10006921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3519 | Open in IMG/M |
3300017822|Ga0187802_10073028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1274 | Open in IMG/M |
3300017822|Ga0187802_10332452 | Not Available | 595 | Open in IMG/M |
3300017822|Ga0187802_10352179 | Not Available | 578 | Open in IMG/M |
3300017823|Ga0187818_10107922 | Not Available | 1205 | Open in IMG/M |
3300017928|Ga0187806_1076644 | Not Available | 1045 | Open in IMG/M |
3300017933|Ga0187801_10180867 | Not Available | 830 | Open in IMG/M |
3300017936|Ga0187821_10246410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 697 | Open in IMG/M |
3300017937|Ga0187809_10330177 | Not Available | 568 | Open in IMG/M |
3300017943|Ga0187819_10091985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1811 | Open in IMG/M |
3300017955|Ga0187817_10530959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 751 | Open in IMG/M |
3300017955|Ga0187817_10753493 | Not Available | 621 | Open in IMG/M |
3300017955|Ga0187817_10788527 | Not Available | 607 | Open in IMG/M |
3300017973|Ga0187780_10233291 | Not Available | 1287 | Open in IMG/M |
3300017973|Ga0187780_10820594 | Not Available | 673 | Open in IMG/M |
3300017973|Ga0187780_11199097 | Not Available | 556 | Open in IMG/M |
3300017974|Ga0187777_10110261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium → Rhizobium sp. 57MFTsu3.2 | 1814 | Open in IMG/M |
3300017994|Ga0187822_10170997 | Not Available | 709 | Open in IMG/M |
3300017994|Ga0187822_10218031 | Not Available | 643 | Open in IMG/M |
3300018006|Ga0187804_10291823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 709 | Open in IMG/M |
3300018007|Ga0187805_10050981 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
3300018007|Ga0187805_10068942 | Not Available | 1590 | Open in IMG/M |
3300018029|Ga0187787_10451602 | Not Available | 518 | Open in IMG/M |
3300019356|Ga0173481_10502857 | Not Available | 618 | Open in IMG/M |
3300020580|Ga0210403_10772092 | Not Available | 766 | Open in IMG/M |
3300021168|Ga0210406_10906899 | Not Available | 663 | Open in IMG/M |
3300022533|Ga0242662_10217486 | Not Available | 608 | Open in IMG/M |
3300025160|Ga0209109_10164927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1108 | Open in IMG/M |
3300025167|Ga0209642_10549947 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300025325|Ga0209341_10737256 | Not Available | 754 | Open in IMG/M |
3300025327|Ga0209751_10410925 | Not Available | 1121 | Open in IMG/M |
3300026118|Ga0207675_102137750 | Not Available | 576 | Open in IMG/M |
3300026535|Ga0256867_10028153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2364 | Open in IMG/M |
3300026997|Ga0207784_1032279 | Not Available | 536 | Open in IMG/M |
3300027049|Ga0207806_1023839 | Not Available | 707 | Open in IMG/M |
3300027568|Ga0208042_1044294 | Not Available | 1141 | Open in IMG/M |
3300027568|Ga0208042_1132608 | Not Available | 626 | Open in IMG/M |
3300027570|Ga0208043_1073750 | Not Available | 955 | Open in IMG/M |
3300027650|Ga0256866_1004613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3402 | Open in IMG/M |
3300027674|Ga0209118_1079541 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300027680|Ga0207826_1046723 | Not Available | 1201 | Open in IMG/M |
3300027703|Ga0207862_1044541 | Not Available | 1337 | Open in IMG/M |
3300027894|Ga0209068_10545467 | Not Available | 672 | Open in IMG/M |
3300027894|Ga0209068_10864809 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300027910|Ga0209583_10236925 | Not Available | 798 | Open in IMG/M |
3300027911|Ga0209698_11261421 | Not Available | 542 | Open in IMG/M |
3300027915|Ga0209069_10926261 | Not Available | 529 | Open in IMG/M |
3300027957|Ga0209857_1010377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1898 | Open in IMG/M |
3300030620|Ga0302046_11577528 | Not Available | 506 | Open in IMG/M |
3300031226|Ga0307497_10198018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 868 | Open in IMG/M |
3300031231|Ga0170824_122357169 | Not Available | 787 | Open in IMG/M |
3300031256|Ga0315556_1096892 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
3300031455|Ga0307505_10342540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 705 | Open in IMG/M |
3300031474|Ga0170818_109890228 | Not Available | 838 | Open in IMG/M |
3300031474|Ga0170818_110537653 | Not Available | 706 | Open in IMG/M |
3300031562|Ga0310886_10058150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1781 | Open in IMG/M |
3300031699|Ga0315535_1107233 | Not Available | 1037 | Open in IMG/M |
3300031708|Ga0310686_116832437 | Not Available | 1497 | Open in IMG/M |
3300031740|Ga0307468_100190170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1375 | Open in IMG/M |
3300031940|Ga0310901_10217101 | Not Available | 770 | Open in IMG/M |
3300032174|Ga0307470_10204081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1266 | Open in IMG/M |
3300032515|Ga0348332_12512160 | Not Available | 622 | Open in IMG/M |
3300033513|Ga0316628_104304857 | Not Available | 506 | Open in IMG/M |
3300034090|Ga0326723_0221149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 841 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 15.83% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 13.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.23% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.47% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.04% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.32% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.60% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.60% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.88% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.16% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.16% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.16% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.16% |
Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 1.44% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.44% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.44% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.44% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.44% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.44% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.72% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.72% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.72% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.72% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300026997 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 66 (SPAdes) | Environmental | Open in IMG/M |
3300027049 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031256 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10 | Environmental | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031699 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPgaii200_11117932 | 2228664022 | Soil | EKYFWLSPVTKRDADVLAVKLFCLFSFVLVGLIVAGVL |
JGI12270J11330_100392831 | 3300000567 | Peatlands Soil | MAIAPTLEKYLAAPTTKREADVVALKLFCLFSFILVGLIAAGIL* |
JGI12270J11330_100408144 | 3300000567 | Peatlands Soil | MAIAPTLEKYLAARPTTKREIDVVAFKLFCLFSIILVGLIMAGIL* |
JGI1027J11758_128443123 | 3300000789 | Soil | MAIAPASEKYFWLSPVTKRXADVLAVKLFCLFSFVLVGLIVAGVL* |
JGI11643J12802_115015733 | 3300000890 | Soil | SQRGSTMAIAPTSGKSFWRRPATKHEADAMGVKLFCLFSFILVWLIVAGVL* |
Ga0055453_100454573 | 3300004006 | Natural And Restored Wetlands | MAIATTPRTHLWLRPATKREADAMAAKLFCLFSFILVALIMAGVL* |
Ga0055488_100632331 | 3300004070 | Natural And Restored Wetlands | MAIATTPRTHLWLRPATKREVDAMAAKLFCLFSFILVALIMAGVL* |
Ga0062595_1001050132 | 3300004479 | Soil | MAIAPTSGKSFWRRPATKHEADAMGVKLFCLFSFILVWLIVAGVL* |
Ga0058862_100128381 | 3300004803 | Host-Associated | MATASTSEKNVWFHPATKREADVLAVKLFCLFAFILVGLITGGVL* |
Ga0066815_101146571 | 3300005164 | Soil | MAIAPTLQRHLTARPRSKREADVVALKLFCLFSFILVGLIM |
Ga0066388_1007773522 | 3300005332 | Tropical Forest Soil | NTARRKGGNNMAIAPTLQRHLTARPRSKREADVVALKLFCLFSFILVGLIMAGVL* |
Ga0070692_107699972 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIAPTLQRHLTARPRSKREADVVALKLFCLFSFILVGLVMAGVL* |
Ga0070709_100262564 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MATARTSQNNVWFHPATKREADVLAVKLFCLFAFILVGLITAGVL* |
Ga0070711_1003959021 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLTPTLEKYLPLSPATKHEADVMALKLFCLLSFILVGLITAGIL* |
Ga0066905_1012427482 | 3300005713 | Tropical Forest Soil | MVGVGWGTARNTSCRRGGNNMAIAPTLQRHLAARPRSKREADVVALKLFCLFSFILVGLIMAGVL* |
Ga0066905_1016259382 | 3300005713 | Tropical Forest Soil | MAIAPTSGKSYWRMPATKREADEMAVKLFCLFSFILIGLIITGVL* |
Ga0075024_1004426032 | 3300006047 | Watersheds | MAIAPTSEKYLLLRPKSKRESDVVAFKLFCLFSFILVGLITAGIL* |
Ga0075024_1008924431 | 3300006047 | Watersheds | MTIALEKYLAARPTTKREADVVAFKLFCLFSFILVGLIA |
Ga0075028_1002469123 | 3300006050 | Watersheds | MAIALEKYLAARPTTKREADVVAFKLFCLFSFILVGLIAAGIL* |
Ga0075028_1010171881 | 3300006050 | Watersheds | MAIAPTSEKYLLLRPKSKRESDVVAFKLFCLFSFILVGLI |
Ga0075026_1003024791 | 3300006057 | Watersheds | MTIATTLEKYLVGRPKTKREEDVIALKLFCLFSFILVGLIMSGIL* |
Ga0075026_1005363902 | 3300006057 | Watersheds | MAIAPTSEKYLLLRPKSKRESDVVAFKLFCLFSFILVGLIMAGIL* |
Ga0075026_1010297651 | 3300006057 | Watersheds | MAITLEKHLAARPTTKREADVLAFKLFCLFSFILVGLIAAGIL* |
Ga0075017_1000808093 | 3300006059 | Watersheds | MAIAPTLEKYFVLRPTTKREADVVAFKLFCLFSFILVGLIAAGIL* |
Ga0075017_1012686811 | 3300006059 | Watersheds | MTVATTLEKFLVGRPTTKREADVMALKLFCLFSFILVGLIMAGIL* |
Ga0075017_1014866973 | 3300006059 | Watersheds | APTLEKYFGLRPTKLEADVVAFKLFCLFSFILVGLITAGIL* |
Ga0075015_1001776732 | 3300006102 | Watersheds | MALAPTLEKYFGLRPTKLEADVVAFKLFCLFSFILVGLITAGIL* |
Ga0075030_1014273352 | 3300006162 | Watersheds | MAIAPTLEKHFVFRPTTKREADVVAVKLFCLFSFILVGLITAGIL* |
Ga0075018_104620831 | 3300006172 | Watersheds | MTVARTSERYFWLRPATKHEADALALKLFCLFSFILVGLITAGVL* |
Ga0075018_104776021 | 3300006172 | Watersheds | MTVATTLERYLVARPTTKREADVMALKLFCLFSFILVGLIMAGIL* |
Ga0075018_107693111 | 3300006172 | Watersheds | MAISPTLEKYLAAPATQRDADAMALKLFCLFSFILVGLIAAGIL* |
Ga0075021_105362062 | 3300006354 | Watersheds | MAIALEKYLAARPTTKREADVVAFKLFCLFSFILIGLIAAGIL* |
Ga0075021_107451721 | 3300006354 | Watersheds | MTVATTLEKYLVGRPTTKREADVMALKLFCLFSFILVGLIMAGIL* |
Ga0079221_105509983 | 3300006804 | Agricultural Soil | MATAPTSENNVWFHPATKREADVLAVKLFCLFAFILVGLITGGVL* |
Ga0079220_100309383 | 3300006806 | Agricultural Soil | MATLTPEKNVWFHPATKREADVLAVKLFCLFAFILVGLITGGVL* |
Ga0075425_1007701351 | 3300006854 | Populus Rhizosphere | MAIAPASEKYFWLSPVTKRDADVLAFKLFCLFSFVLV |
Ga0075434_1006839552 | 3300006871 | Populus Rhizosphere | MAIAPTSGKSFWRRPATKHEADAMGVKLFCLLSFILVWLIVAGVL* |
Ga0075424_1022133402 | 3300006904 | Populus Rhizosphere | MAIAPASEKYFWLSPVTKRDADVLAVKLFCLFSFVLVGLIVAGVL* |
Ga0075423_121645392 | 3300009162 | Populus Rhizosphere | MAIAPASEKDFWLSPVTKRDADVLAVKLFCLFSFVLVGLIVAGVL* |
Ga0116220_101421492 | 3300009525 | Peatlands Soil | MAIAPTLEKYLVARPTTKREIDVVAFKLFCLFSIILVGLIMAGIL* |
Ga0105088_10234291 | 3300009810 | Groundwater Sand | MAIARKLEKYFWFHPATKREADVVALKLFCLFSFILVGLITAGVL* |
Ga0105070_10754721 | 3300009815 | Groundwater Sand | MAIARTLEKYFWFHPATKREADVVALKLFCLFSFILVGMITAGVL* |
Ga0105085_10784031 | 3300009820 | Groundwater Sand | MAIARTLEKYFWFRPATKREADVVALKLFCLFSFILVGLITAGVL* |
Ga0105078_10185991 | 3300009823 | Groundwater Sand | MAIARTLEKYFWFRPATKREADVVALKLFCLFSFILVGMITAGVL* |
Ga0105058_10339461 | 3300009837 | Groundwater Sand | LRGLNKGGGNMAIARKLEEYFWFHPATKREADALALRLFCLFSFILVGLITAGVL* |
Ga0127503_102403221 | 3300010154 | Soil | MAISPTLEKYLAAPITQRDADAMALKLFCLFSFILVGLIAAGIL* |
Ga0126376_129184221 | 3300010359 | Tropical Forest Soil | MAIAPTLQRHLAARPRSNREADVVALKLFCLFSFILVGLIMAGVL* |
Ga0136449_1013839021 | 3300010379 | Peatlands Soil | EKYLAARPTTKREIDVVAFKLFCLFSIILVGLIMAGIL* |
Ga0136449_1042231101 | 3300010379 | Peatlands Soil | MAVAPTLEKYFGLRPTTKREADVVAFKLFCLFSFILVGLIT |
Ga0134126_102565532 | 3300010396 | Terrestrial Soil | MATAPTSENNVWFHPATKREADALAVKLFCLFAFILVGLITAGVL* |
Ga0134126_127233582 | 3300010396 | Terrestrial Soil | MATASTSEKNVWFHPTTKREADVLAVKLFCLFAFILVGLITGGVL* |
Ga0138570_10224792 | 3300011087 | Peatlands Soil | MAVAPTLEKYFLLRPTTKREADVVAFELFCLFSLILVGLITAGIL* |
Ga0120148_10797201 | 3300011999 | Permafrost | MAIAPTLEKNFWFRPATKREADVLALKLFCLFSFILVGLITAGGL* |
Ga0157329_10287282 | 3300012491 | Arabidopsis Rhizosphere | QRHLTARPRSKREADVVALKLFCLFSFILVGLIMAGVL* |
Ga0157302_102275951 | 3300012915 | Soil | MAIPPASEKDFWLSPVTKRDADVLAVKLFCLFSFVLVGLIVAGVL* |
Ga0153915_132867081 | 3300012931 | Freshwater Wetlands | MAIAPTENVWFHPATKREADVLALKLFCLFAFILIGLITAGIL* |
Ga0164300_100148684 | 3300012951 | Soil | MTLTPTLEKYLSLSPATKHEADVMALKLFCLLSFILVGLITAGIL* |
Ga0164298_101652523 | 3300012955 | Soil | YRKGGQSMTLTPTLEKYLPLSPATKHEADVMALKLFCLLSFILVGLITAGIL* |
Ga0164299_100791852 | 3300012958 | Soil | MTLTPTLEKYLPLSPATKHEADVMALKLFCLLSFILVGLITAGIV* |
Ga0164301_100758543 | 3300012960 | Soil | MILTPTLEKYLPLSPATKHEADVMALKLFCLLSFILVGLITAGIL* |
Ga0164301_109192632 | 3300012960 | Soil | MAISPTLEKYLAAPATQRDADAMALKLFCLFSFILVSLIAAGIL* |
Ga0164302_115505441 | 3300012961 | Soil | MAISPTLEKYLAVPTTQRDADAMALRLFCLFSFILVGLITAGIL* |
Ga0164306_107429651 | 3300012988 | Soil | MAMSPTLEKYLPAPTTQRDADAMALKLFCLFSFILVGLITAGIL* |
Ga0164305_115767991 | 3300012989 | Soil | MTHTPTLGKYLPLSPATKHEADVLKLFCLLSFVLVGLITAGIL* |
Ga0120154_10611421 | 3300013501 | Permafrost | MAIAPTLEKNFWFRPATKREADVLALKLFCLFSFILVGLITAGVL* |
Ga0120181_100241315 | 3300013766 | Permafrost | MAIAPTLEKNFWFRPATKREADVVALELFCLFSFILVGLITAGVL* |
Ga0173483_104300461 | 3300015077 | Soil | MAIAPASEKYFWLSPVTKRDADVLAFKLFCLFSFVLVGLIVAGVL* |
Ga0132258_110898261 | 3300015371 | Arabidopsis Rhizosphere | MATARTSQNNVWFHPATKREADVLAVKLFCLFAFILVG |
Ga0132258_114393672 | 3300015371 | Arabidopsis Rhizosphere | MATAPTSENNVWFHPATKREADALAVKLFCLFAFILVGLITAGIL* |
Ga0132258_122364703 | 3300015371 | Arabidopsis Rhizosphere | MAITDYFSLRPETKQEADVMALKLFCLFSFILVGLITVGVL* |
Ga0132256_1001089683 | 3300015372 | Arabidopsis Rhizosphere | MAIAPTLQRHLTARPRSKREADVVALKLFCLFSFILVGLIMAGVL* |
Ga0132256_1036327241 | 3300015372 | Arabidopsis Rhizosphere | MATASTSEKNVWFHPATKREADALAVKLFCLFAFILVGLITAGIL* |
Ga0132257_1005955033 | 3300015373 | Arabidopsis Rhizosphere | MAIAPTLQRHLTARPRCKREADVVALKLFCLFSFILVGLIMAGVL* |
Ga0132255_1052866132 | 3300015374 | Arabidopsis Rhizosphere | MATALTPEKNVWFHPATKREADVLAVKLFCLFAFILVGLITGGVL* |
Ga0187802_100069215 | 3300017822 | Freshwater Sediment | MAIAPTLEKYLAAPTTKREADVVAFKLFCLFSFILVGLIAAGIL |
Ga0187802_100730282 | 3300017822 | Freshwater Sediment | MAIAPTLEKYLAAEKYLAAPTTKREADVVAFKLFCLFSFILVGLITARIL |
Ga0187802_103324521 | 3300017822 | Freshwater Sediment | MAIAPTLEKYLVVPTTKREADLLALKLFCLFSFILVGLIAVGIR |
Ga0187802_103521791 | 3300017822 | Freshwater Sediment | MVIAPTLAKAILFRPTTKREADLVALKLFCLFSFILVGLIAAGIL |
Ga0187818_101079221 | 3300017823 | Freshwater Sediment | MTIAPTLEKYWAVPTTKREADLVALKLFCLFSFILVGLIAAGIL |
Ga0187806_10766442 | 3300017928 | Freshwater Sediment | MAIAPTLEKYLAAPTTKREADVAAFKLFCLFSLILVGLIAAGIL |
Ga0187801_101808672 | 3300017933 | Freshwater Sediment | MTIASTLEKYWAVQTTKREADLVALKLFCLFSFILVGLIAAGIL |
Ga0187821_102464101 | 3300017936 | Freshwater Sediment | MATLTPEKNVWFHPATKREADVLAVKLFCLFAFILVGLITGGVL |
Ga0187809_103301772 | 3300017937 | Freshwater Sediment | MAIAPTLEKYLAAPTTKREADVVAFKLFCLFSFILVGLITAGIL |
Ga0187819_100919854 | 3300017943 | Freshwater Sediment | MAIAPTLEKYLAVPTTKREADLLALKLFCLFSFILVGLIAVGIR |
Ga0187819_104283111 | 3300017943 | Freshwater Sediment | MALSPTWYFAVPTTKREADLLALKLFCLFSFILVGLITAGIL |
Ga0187817_105309591 | 3300017955 | Freshwater Sediment | MAIAPTLEKYLAAPTTKREADVVAFKLFFLFSFVLVGLIAAGIL |
Ga0187817_107534931 | 3300017955 | Freshwater Sediment | MAISPALEKYLAAPTTKREADLLACKLFCLFSFILVGLITAGIL |
Ga0187817_107885271 | 3300017955 | Freshwater Sediment | MALSPTWYFAVPTTKREADLLACKLFFLFSLILVGLITVGIL |
Ga0187780_102332911 | 3300017973 | Tropical Peatland | MAIASTLEKYVWFHPATKREADILALKLFCLFSFILLGLITAGV |
Ga0187780_108205941 | 3300017973 | Tropical Peatland | MAFAPTLARAVLFRPTTKREADLVALKLFGLFLFILVSLIAAGIL |
Ga0187780_111990971 | 3300017973 | Tropical Peatland | MALAPTLEKYLAAPTTKREADVVALKLFCLFSFILIGLITAGIL |
Ga0187777_101102614 | 3300017974 | Tropical Peatland | MAFAPTLARAVLFRPTTKREADLVALKLFGLFLCILVSLIAAGIL |
Ga0187822_101709972 | 3300017994 | Freshwater Sediment | MAIAPTLEKYLAAPTTKRAADVVEFKLFCLFSFILVGLIAAGIL |
Ga0187822_102180311 | 3300017994 | Freshwater Sediment | MATLTPEKNVWFHPATKREADVLAVKLFCLFAFILVGLITAGVL |
Ga0187804_102918232 | 3300018006 | Freshwater Sediment | MAIAPTLEKYLVVPTTKREPDLLALKLFCLFSFILVGLIAVGIL |
Ga0187805_100509811 | 3300018007 | Freshwater Sediment | MAIAPTLEKYLAVPTTKREADLLALKLFCLFSFILVGLIAVGMR |
Ga0187805_100689422 | 3300018007 | Freshwater Sediment | MAIAPTLEKYLAAPTTKREADVAAFKLFCLFSFILVGLIAAGIL |
Ga0187787_104516021 | 3300018029 | Tropical Peatland | MATAPTSERNVWFHPATKREADVLAFKLFCLFAFILVGLITAGVV |
Ga0173481_105028572 | 3300019356 | Soil | MAIAPASEKYFWLSPVTKRDADVLAFKLFCLFSFVLVGLIVAGVL |
Ga0210403_107720922 | 3300020580 | Soil | MTLTPTLENYLPLSPATKHEADVMALKLFCLLSFILVGLITAGIL |
Ga0210406_109068991 | 3300021168 | Soil | MTLTPTLEKYLPLSPATKHEADVMALKLFCLLSFILVGLITAGVL |
Ga0242662_102174862 | 3300022533 | Soil | MAISPTLEKYLAAPTTQRDADAMALKLFCLFSFILVGLITAGIL |
Ga0209109_101649273 | 3300025160 | Soil | MAIARKLEKYFWFHPATKREADVVALKLFCLFSFILVGMITAGVL |
Ga0209642_105499472 | 3300025167 | Soil | GGGNMAIARKLEKYFWFHPATKREADVVALKLFCLFSFILVGMITAGVL |
Ga0209341_107372561 | 3300025325 | Soil | RTLEKYFWFRPATKREADALALRLFCLFSFILVGLITAGVL |
Ga0209751_104109251 | 3300025327 | Soil | MAIARTLEKYFWFRPATKREADALALRLFCLFSFILVGLITAGVL |
Ga0207675_1021377502 | 3300026118 | Switchgrass Rhizosphere | MAIAPTLQRHMAARARTKREADVVALKLFCLFSFILVG |
Ga0256867_100281533 | 3300026535 | Soil | MAIPRTLEKSFWFRPATKREADVLALKLFCLFSFILLGLITSGVL |
Ga0207784_10322791 | 3300026997 | Tropical Forest Soil | MAIAPTLEKYVPTTQREADLLAFKLFCLFSFILVGFIAAGIL |
Ga0207806_10238391 | 3300027049 | Tropical Forest Soil | MAIAPTLEKYVPTTQREADLLAHKLFCLFSFILVGLIAGGIF |
Ga0208042_10442941 | 3300027568 | Peatlands Soil | MAIAPTLEKYLVARPTTKREIDVVAFKLFCLFSIILVGLIMAGIL |
Ga0208042_11326082 | 3300027568 | Peatlands Soil | MAIAPTLEKYLAAPTTKREADVVALKLFCLFSFILVGLIAAGIL |
Ga0208043_10737502 | 3300027570 | Peatlands Soil | MAIAPTLEKYLAARPTTKREIDVVAFKLFCLFSIILVGLIMAGIL |
Ga0256866_10046131 | 3300027650 | Soil | MAIPRTLEKSFWFRPATKREADVLALKLFCLFSLILLGLITSGVL |
Ga0209118_10795411 | 3300027674 | Forest Soil | MAIAPTLEKNFRFRPATKREADVLALKLFCLFSFILVGLITAGVL |
Ga0207826_10467232 | 3300027680 | Tropical Forest Soil | MITATFERYLSLPTTKQEADLMALKLFCLFSLILVALITAGIL |
Ga0207862_10445412 | 3300027703 | Tropical Forest Soil | MITATFERYLSLPTTKHEADLMALKLFCLFSLVLVALITAGIL |
Ga0209068_105454671 | 3300027894 | Watersheds | MAIALEKYLAARPTTKREADVVAFKLFCLFLFILVGLIAAGIL |
Ga0209068_108648092 | 3300027894 | Watersheds | MAVALGKYLAASPTTKREADVVAFKLFCLFSFILVGLIMAGIL |
Ga0209583_102369251 | 3300027910 | Watersheds | MAIAPTSEKYLSLRPKSKREADVVAFKLFCLFSFILVGLIMAGIL |
Ga0209698_112614211 | 3300027911 | Watersheds | MAIAPTLEKHFVFRPTTKREADVVAVKLFCLFSFILVGLITAGIL |
Ga0209069_109262611 | 3300027915 | Watersheds | MNIALEKYLAGRPTTKREADVVAFKLFCLFSFILVGLIAAGIL |
Ga0209857_10103773 | 3300027957 | Groundwater Sand | MAIARKLEEYFWFHPATKREADVVALKLFCLFSFILVGMITAGVL |
Ga0302046_115775281 | 3300030620 | Soil | MAIARTLEKYFWFRPATKREADVVALKLFCLFSFILVG |
Ga0307497_101980182 | 3300031226 | Soil | KGGNNMAIAPALQRHLTARPRSKREADVVALKLFCLFSFILVGLIMAGVL |
Ga0170824_1223571691 | 3300031231 | Forest Soil | MAISPTLEKYLAAPTTRDADAMALRLFCLFSFILVGLITAGIP |
Ga0315556_10968922 | 3300031256 | Salt Marsh Sediment | MAIATTPRTHLWLRPATKREVDAMAAKLFCLFSFILVALIMAGVL |
Ga0307505_103425401 | 3300031455 | Soil | WGTARNTSRRKGGNNMAIAPTLQRHLTARPRSKREADVVALKLFCLFSFILVGLIMAGVL |
Ga0170818_1098902282 | 3300031474 | Forest Soil | MAISPTLEKYLAAPTTRDADAMALRLFCLFSFILVGLITAGIL |
Ga0170818_1105376532 | 3300031474 | Forest Soil | MTLTPTLEKYLPLSPATKHEADVMALKLFCLLSFILVGLITAGIL |
Ga0310886_100581501 | 3300031562 | Soil | APTLQRHLTARPRSKREADVVALKLFCLFSFILVGLIMAGVL |
Ga0315535_11072332 | 3300031699 | Salt Marsh Sediment | MAIATTPRTHLWLRPATKREVDAMAAKLFCLFSFILVALILAGVL |
Ga0310686_1168324375 | 3300031708 | Soil | MAIATALEKHFVLRPTTKREADVVAFKLFCLFSLILVGLITVGIL |
Ga0307468_1001901703 | 3300031740 | Hardwood Forest Soil | MAIAPTLQRHMAARARTKREADVVALKLFCLFSFILVGLIMAGVL |
Ga0310901_102171011 | 3300031940 | Soil | MAIAPTLQRHLTARPRSKREADVVALKLFCLFSFILVGLIMAGVL |
Ga0307470_102040814 | 3300032174 | Hardwood Forest Soil | MAIAPTLQRHLAARPRTKREADVVALKLFCLFSFILI |
Ga0348332_125121602 | 3300032515 | Plant Litter | MAIATTLEKHFVLRPTTKREADVVAFKLFCLFSFILVGLITAGIL |
Ga0316628_1043048571 | 3300033513 | Soil | MAIAPTLQRHLTARPRSKREADVVALKLFCLFSFIL |
Ga0326723_0221149_67_264 | 3300034090 | Peat Soil | MVGVSWWTARNTSRRKGGNNMAIAPTLQRHLTARPRSKREADVVALKLFCLFSFILVGLIMAGVL |
⦗Top⦘ |