NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F055144

Metagenome Family F055144

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055144
Family Type Metagenome
Number of Sequences 139
Average Sequence Length 42 residues
Representative Sequence ANGFQAPELFAATALVSAASIAIVLGLDALNDRLSHWRG
Number of Associated Samples 131
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.72 %
% of genes near scaffold ends (potentially truncated) 94.96 %
% of genes from short scaffolds (< 2000 bps) 93.53 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.122 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(16.547 % of family members)
Environment Ontology (ENVO) Unclassified
(28.777 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.007 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.75%    β-sheet: 0.00%    Coil/Unstructured: 49.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF00528BPD_transp_1 9.35
PF13378MR_MLE_C 8.63
PF02746MR_MLE_N 5.76
PF13419HAD_2 5.04
PF04366Ysc84 4.32
PF12911OppC_N 2.16
PF01497Peripla_BP_2 1.44
PF09084NMT1 1.44
PF01063Aminotran_4 0.72
PF13561adh_short_C2 0.72
PF01909NTP_transf_2 0.72
PF12867DinB_2 0.72
PF06537DHOR 0.72
PF04879Molybdop_Fe4S4 0.72
PF13358DDE_3 0.72
PF01844HNH 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 11.51
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 4.32
COG0115Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyaseAmino acid transport and metabolism [E] 1.44
COG0614ABC-type Fe3+-hydroxamate transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.44
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.44
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.44
COG4558ABC-type hemin transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.44
COG4592ABC-type Fe2+-enterobactin transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.44
COG4594ABC-type Fe3+-citrate transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.44
COG4607ABC-type enterochelin transport system, periplasmic componentInorganic ion transport and metabolism [P] 1.44
COG3488Uncharacterized conserved protein with two CxxC motifs, DUF1111 familyGeneral function prediction only [R] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.12 %
UnclassifiedrootN/A2.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_102344335All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria559Open in IMG/M
3300002561|JGI25384J37096_10071335All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1274Open in IMG/M
3300003321|soilH1_10354050All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1128Open in IMG/M
3300003324|soilH2_10283439All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300003999|Ga0055469_10308428All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005167|Ga0066672_10232207All Organisms → cellular organisms → Bacteria1183Open in IMG/M
3300005174|Ga0066680_10413630All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300005177|Ga0066690_10906468All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005181|Ga0066678_10351671All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria972Open in IMG/M
3300005295|Ga0065707_10424367All Organisms → cellular organisms → Bacteria → Proteobacteria827Open in IMG/M
3300005338|Ga0068868_102338510All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria510Open in IMG/M
3300005440|Ga0070705_101470140All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria570Open in IMG/M
3300005444|Ga0070694_100128408All Organisms → cellular organisms → Bacteria → Proteobacteria1828Open in IMG/M
3300005446|Ga0066686_10695521All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300005447|Ga0066689_10787659All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium591Open in IMG/M
3300005451|Ga0066681_10175366All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300005467|Ga0070706_100693584All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300005526|Ga0073909_10265064All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium768Open in IMG/M
3300005540|Ga0066697_10335109All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria883Open in IMG/M
3300005546|Ga0070696_100310866All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1210Open in IMG/M
3300005552|Ga0066701_10763589All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium577Open in IMG/M
3300005555|Ga0066692_10827936All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium568Open in IMG/M
3300005587|Ga0066654_10138779All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1223Open in IMG/M
3300005598|Ga0066706_11435274All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria520Open in IMG/M
3300005713|Ga0066905_100876091All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria784Open in IMG/M
3300005719|Ga0068861_102462475All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria524Open in IMG/M
3300006031|Ga0066651_10394132All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300006031|Ga0066651_10435863All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria696Open in IMG/M
3300006034|Ga0066656_10740669All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria630Open in IMG/M
3300006049|Ga0075417_10076225All Organisms → cellular organisms → Bacteria1491Open in IMG/M
3300006058|Ga0075432_10076103All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1211Open in IMG/M
3300006173|Ga0070716_100147413All Organisms → cellular organisms → Bacteria1509Open in IMG/M
3300006791|Ga0066653_10000673All Organisms → cellular organisms → Bacteria → Proteobacteria9496Open in IMG/M
3300006796|Ga0066665_10892265All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria690Open in IMG/M
3300006846|Ga0075430_100581266All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300006847|Ga0075431_101650613All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales598Open in IMG/M
3300006854|Ga0075425_101006817All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300006876|Ga0079217_10481384All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium765Open in IMG/M
3300006903|Ga0075426_10284447All Organisms → cellular organisms → Bacteria → Proteobacteria1208Open in IMG/M
3300006904|Ga0075424_100786412All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1016Open in IMG/M
3300007004|Ga0079218_11297913All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium766Open in IMG/M
3300009089|Ga0099828_11532293All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300009094|Ga0111539_11136024All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium908Open in IMG/M
3300009137|Ga0066709_101125952All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300009147|Ga0114129_11654364All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium782Open in IMG/M
3300009156|Ga0111538_12651492All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium628Open in IMG/M
3300009162|Ga0075423_10066421All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria3739Open in IMG/M
3300009177|Ga0105248_11696067All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium716Open in IMG/M
3300009553|Ga0105249_10981053All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria913Open in IMG/M
3300009777|Ga0105164_10241839All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300009807|Ga0105061_1087433All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300009817|Ga0105062_1137765All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria504Open in IMG/M
3300009818|Ga0105072_1079055All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria645Open in IMG/M
3300009837|Ga0105058_1071578All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300010047|Ga0126382_10099267All Organisms → cellular organisms → Bacteria → Proteobacteria1876Open in IMG/M
3300010047|Ga0126382_10729446All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria835Open in IMG/M
3300010301|Ga0134070_10367160All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium561Open in IMG/M
3300010304|Ga0134088_10488077All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria606Open in IMG/M
3300010323|Ga0134086_10225900All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria706Open in IMG/M
3300010325|Ga0134064_10369768All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria565Open in IMG/M
3300010336|Ga0134071_10151622All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1127Open in IMG/M
3300010359|Ga0126376_12262796All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria589Open in IMG/M
3300010362|Ga0126377_11952437All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300010391|Ga0136847_13149648All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria904Open in IMG/M
3300010398|Ga0126383_11094173All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300010398|Ga0126383_13152028All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria539Open in IMG/M
3300010868|Ga0124844_1100964All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300011435|Ga0137426_1181928All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300011437|Ga0137429_1159636All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300012189|Ga0137388_10011128All Organisms → cellular organisms → Bacteria6371Open in IMG/M
3300012198|Ga0137364_11016345All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium626Open in IMG/M
3300012205|Ga0137362_11237945All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium631Open in IMG/M
3300012208|Ga0137376_10248187All Organisms → cellular organisms → Bacteria1543Open in IMG/M
3300012285|Ga0137370_10148533Not Available1354Open in IMG/M
3300012349|Ga0137387_10294427All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300012349|Ga0137387_11087132All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium570Open in IMG/M
3300012353|Ga0137367_10550441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria810Open in IMG/M
3300012361|Ga0137360_10250870All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300012363|Ga0137390_11682280All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300012503|Ga0157313_1041397All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria567Open in IMG/M
3300012582|Ga0137358_10415135All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300012922|Ga0137394_10276295Not Available1436Open in IMG/M
3300012925|Ga0137419_10264126All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300012929|Ga0137404_10332363All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1325Open in IMG/M
3300012930|Ga0137407_10231983All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1667Open in IMG/M
3300012944|Ga0137410_10651883All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300012948|Ga0126375_10139601Not Available1510Open in IMG/M
3300012948|Ga0126375_10628830All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300014150|Ga0134081_10132587All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300014154|Ga0134075_10371386All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria629Open in IMG/M
3300014259|Ga0075311_1097041All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium626Open in IMG/M
3300014885|Ga0180063_1281002All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria529Open in IMG/M
3300015264|Ga0137403_11419945All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium543Open in IMG/M
3300015358|Ga0134089_10439868Not Available563Open in IMG/M
3300015359|Ga0134085_10068214All Organisms → cellular organisms → Bacteria1444Open in IMG/M
3300015371|Ga0132258_11124654All Organisms → cellular organisms → Bacteria1985Open in IMG/M
3300015372|Ga0132256_100128114All Organisms → cellular organisms → Bacteria2516Open in IMG/M
3300015373|Ga0132257_102543527All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300015374|Ga0132255_104719516All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria577Open in IMG/M
3300018031|Ga0184634_10016551All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria2729Open in IMG/M
3300018059|Ga0184615_10377508All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium781Open in IMG/M
3300018468|Ga0066662_10747172All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria941Open in IMG/M
3300025149|Ga0209827_10962011All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300025935|Ga0207709_11287866All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria604Open in IMG/M
3300025937|Ga0207669_10181723All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1509Open in IMG/M
3300026296|Ga0209235_1015861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4100Open in IMG/M
3300026298|Ga0209236_1127719All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300026300|Ga0209027_1173138All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300026328|Ga0209802_1302149All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium530Open in IMG/M
3300026333|Ga0209158_1299915All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria553Open in IMG/M
3300026335|Ga0209804_1189092All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300026528|Ga0209378_1080088All Organisms → cellular organisms → Bacteria1479Open in IMG/M
3300026550|Ga0209474_10089570All Organisms → cellular organisms → Bacteria2094Open in IMG/M
3300026551|Ga0209648_10165334All Organisms → cellular organisms → Bacteria1731Open in IMG/M
3300027324|Ga0209845_1012273All Organisms → cellular organisms → Bacteria1437Open in IMG/M
3300027511|Ga0209843_1008857All Organisms → cellular organisms → Bacteria2185Open in IMG/M
3300027646|Ga0209466_1057895All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300027748|Ga0209689_1364915All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium552Open in IMG/M
3300027873|Ga0209814_10550092All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300027882|Ga0209590_10547995All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria746Open in IMG/M
3300031170|Ga0307498_10205625All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria689Open in IMG/M
(restricted) 3300031248|Ga0255312_1068418All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300031548|Ga0307408_100756911All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300031720|Ga0307469_10173421All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1648Open in IMG/M
3300031723|Ga0318493_10386402All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria764Open in IMG/M
3300031724|Ga0318500_10027587All Organisms → cellular organisms → Bacteria → Proteobacteria2245Open in IMG/M
3300031820|Ga0307473_10781773All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium679Open in IMG/M
3300031820|Ga0307473_10868214All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5649Open in IMG/M
3300031911|Ga0307412_11082744All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium712Open in IMG/M
3300031954|Ga0306926_11404886All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria810Open in IMG/M
3300032002|Ga0307416_100583859All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300032002|Ga0307416_102975927All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300032003|Ga0310897_10239160All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium808Open in IMG/M
3300032075|Ga0310890_11004932All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium671Open in IMG/M
3300032180|Ga0307471_101803627All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium763Open in IMG/M
3300032180|Ga0307471_103128703All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → Parahaliea → Parahaliea maris587Open in IMG/M
3300032770|Ga0335085_11035861All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium884Open in IMG/M
3300034817|Ga0373948_0019662All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1279Open in IMG/M
3300034818|Ga0373950_0177598All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria500Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil16.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.47%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.04%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand4.32%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.60%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.88%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.16%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.16%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.16%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.44%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.44%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil1.44%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.72%
WastewaterEnvironmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater0.72%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.72%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.72%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.72%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.72%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.72%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300002561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cmEnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009777Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking waterEnvironmentalOpen in IMG/M
3300009807Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10EnvironmentalOpen in IMG/M
3300009817Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012503Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_RHost-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014259Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1EnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300025149Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027324Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300027511Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10234433533300000559SoilGSFANGFQAPELFAATALVSAVSIAIVLALDGINERLSRWRG*
JGI25384J37096_1007133523300002561Grasslands SoilMGALANGSKAPELFAATGLVSAASIAIVLALDHVSERLSRWRG*
soilH1_1035405013300003321Sugarcane Root And Bulk SoilANGFQAPELFAATALVSAASIAIVLGLDALNDRLSHWRG*
soilH2_1028343913300003324Sugarcane Root And Bulk SoilSLANGFQAPELFAATALVSAASIALVLALDALGERLSRWRESPIAERS*
Ga0055469_1030842813300003999Natural And Restored WetlandsRGMGHVLSSLANGFQAPELFAATALVSVASIAIVLGLDALNERLSHWRR*
Ga0066672_1023220713300005167SoilVRGMGWELSAFANAFQAPELFASTLLVSAVAIAIGLVLDALGERLNRWR*
Ga0066680_1041363013300005174SoilLSSLANGFRAPALFAATALVSAASIVIVLSLDVLNDRLSQWRGEIR*
Ga0066690_1090646813300005177SoilYVLSSLANGFQAPELFAATALVSAASIVIVLSLDVLNDRLAQWRGEVR*
Ga0066678_1035167143300005181SoilLANGFQAPELFAATALVSASSIAIVLALDSLNNRLSRWR*
Ga0065707_1042436733300005295Switchgrass RhizosphereRGMGHILGSYANGFQAPELFAATALVSSASIAIVLGLDHLNDKLSRWRG*
Ga0068868_10233851023300005338Miscanthus RhizosphereMGYVLGSYANGFQAPELFAATALVSAASIAIVLALDHLNDKLSRWRG*
Ga0070705_10147014023300005440Corn, Switchgrass And Miscanthus RhizosphereGHVLGSFANGFQAPELFAATALVSAASIAIVLALDHLNDKLSRWRG*
Ga0070694_10012840843300005444Corn, Switchgrass And Miscanthus RhizosphereVLGSYANGFQAPELFAATALVSAASIAIVLALDHLNDKLSRWRG*
Ga0066686_1069552113300005446SoilRGMGYVMGSLANGFQAPELFAATALVSATSIAIVLGLDHVNDRLSRWRG*
Ga0066689_1078765913300005447SoilGYVMSSLANGFRAPELFAATGLVSAASIAIVLVLDHVNERLSHWRG*
Ga0066681_1017536613300005451SoilYVMGSLANGFQAPELFAATALVSATSIAIVLGLDQLNERLSRWRG*
Ga0070706_10069358413300005467Corn, Switchgrass And Miscanthus RhizosphereVLGSFANGFQAPELFAATALVSAASIAIVLALDHLNDRLSRWRG*
Ga0073909_1026506413300005526Surface SoilMGHVLNSLANGFQAAELFAATALVSAASIAIVLGLDALNERLSHWRS*
Ga0066697_1033510923300005540SoilVMGGLANGFRAPELFAATGLVSVASIAIVLGLDHLNEKLSRWRG*
Ga0070696_10031086613300005546Corn, Switchgrass And Miscanthus RhizosphereLGSLANGFQAPELFAATALVSAASIVIVLGLDALNDRLSHWRG*
Ga0066701_1076358913300005552SoilGMGYVMSSLANGFRAPELFAATGLVSAASIAIVLVLDHVNERLSHWRG*
Ga0066692_1082793633300005555SoilYVMSSLANGFRAPELFAATGLVSAASIAIVLVLDHVNERLSHWRG*
Ga0066654_1013877913300005587SoilGYVMGAFANGFQAPELFAATGLVSAASVAIVLALDHVSERLSHWRG*
Ga0066706_1143527423300005598SoilHVLGSYANGFQAPELFAATALVSAASIAIVLALDHLNDKLSRWRG*
Ga0066905_10087609123300005713Tropical Forest SoilGLANGFRAPELFAATGLVSVASIAIVLGLDHLNEKLSHWRG*
Ga0068861_10246247513300005719Switchgrass RhizosphereGFQAPELFAATALVSAVSIAIVLALDGINERLSRWRG*
Ga0066651_1039413213300006031SoilSFANAFRAPELFAATALVSAASIAIVLALDRLNDRLSHWRI*
Ga0066651_1043586313300006031SoilSLANGFRAPELFAATGLVSAASIAIVLALDHVNERLSHWRG*
Ga0066656_1074066933300006034SoilYVMSSLANGFRAPELFAATGLVSAASIAIVLGLDHVNERLSHWRG*
Ga0075417_1007622533300006049Populus RhizosphereHVLGSFANGFQAPELFAATALVSMASIVIVLSLDALNDRLSHWRGEAR*
Ga0075432_1007610313300006058Populus RhizosphereVLGSLANGFQAPELFAATALVSVSSIAIVLGLDALNERLSIWRG*
Ga0070716_10014741313300006173Corn, Switchgrass And Miscanthus RhizosphereGMGYVLSSLANGFQAPELFSATALVSAASIVIVLSLDSLNDRLSQWREESR*
Ga0066653_1000067383300006791SoilFRAPELFAATGLVSVASIAIVLGLDHLNEKLSRWRG*
Ga0066665_1089226513300006796SoilNGFRAPELFAATGLVSAASIAIVLGLDHVNERLSHWRG*
Ga0075430_10058126623300006846Populus RhizosphereSSLANGFQAAELFAATALVSAASIIIVLSLASVNERLSQWRGESR*
Ga0075431_10165061323300006847Populus RhizosphereRGMGFLLVSLANAFRAPELFAATALVSLLSIAIVLGLERLNRRLGHWR*
Ga0075425_10100681713300006854Populus RhizosphereFQAPELFAATALVSAASIAIVLALDGINERLSRWRG*
Ga0079217_1048138423300006876Agricultural SoilMGSLANGFRAPELFAATALVSAASIAIVLGLDALNERLSRWRG*
Ga0075426_1028444713300006903Populus RhizosphereANAFRAPELFAATGLISVASIAIVLALDALNERLSRWR*
Ga0075424_10078641243300006904Populus RhizosphereLANGFQAPELFAATALVSFASIAIVLALDALNDRLSHWRG*
Ga0079218_1129791313300007004Agricultural SoilMSALANGFQAAELFAVTALVSVASIVIVLSLDALGERLSVWRG*
Ga0099828_1153229323300009089Vadose Zone SoilGFRAPELFAATGLVSAASIAIVLGLDHLNEKLSHWRG*
Ga0111539_1113602413300009094Populus RhizosphereANGFRAAELFAVTGLVSAASIAIVLTLDVLNDRLAHWRG*
Ga0066709_10112595223300009137Grasslands SoilMGALANGFQAPERFAATGLVSAASIAIVLALDHVSERLSRWRG*
Ga0114129_1165436413300009147Populus RhizosphereLANGFQAPELFAATALVSAVSITIVLGLDALNERLSHWRR*
Ga0111538_1265149233300009156Populus RhizosphereGFQAPELFAATALVSAVSITIVLGLDALNERLSHWRR*
Ga0075423_1006642163300009162Populus RhizosphereQAPELFAATALVSVASIAIVLGLDALNERLSHWRH*
Ga0105248_1169606713300009177Switchgrass RhizosphereVLGSLANGFQAPELFAATALVSASSIAIVLGLDALNDRLSHWRG*
Ga0105249_1098105343300009553Switchgrass RhizosphereNSLANGFQAAELFAATALVSAASIAIVLGLDALNERLSHWRS*
Ga0105164_1024183913300009777WastewaterGYTLGALANGFQAPELFAATLLVSAVSITIVLALDALGERLGRWR*
Ga0105061_108743313300009807Groundwater SandMGYVLSSLANGFRAPELFAATALVSAASIVIVLSLDVLNDRLSQWRGELR*
Ga0105062_113776513300009817Groundwater SandQAPELFAATGLVSAASIAIVLTLDHLNDKLSHWRG*
Ga0105072_107905533300009818Groundwater SandSFANGFQAPELFAATALVSAASIAIVLALDHLNDKLSHWRG*
Ga0105058_107157813300009837Groundwater SandRAPELFAATALVSAASIALVLGLDAINEHLSRWR*
Ga0126382_1009926713300010047Tropical Forest SoilGFQAPELFAATALVSVASIAIVLALDHVNDRLSRWRG*
Ga0126382_1072944623300010047Tropical Forest SoilVMGGLANGFRAPELFAATGLVSVASIAIVLGLDHLNEKLSHWRG*
Ga0134070_1036716023300010301Grasslands SoilVMGSLANGFQAPELFAATGLVSAASIAIVLALDHLNDKLSHWRG*
Ga0134088_1048807723300010304Grasslands SoilGSVMGGLANGFRAPELFAATGLVSVASIAIVLGLDHLNEKLSHWRG*
Ga0134086_1022590023300010323Grasslands SoilSLANAFRAPELFAATGLVSVASIAIVLALDHVNERLSHWRG*
Ga0134064_1036976813300010325Grasslands SoilGMGYVMGAFANGFQAPELFAATGLVSAASIAIVLALDHVSERLSHWRG*
Ga0134071_1015162243300010336Grasslands SoilMGALANGFQAPELFAATGLVSAASIAIVLALDHVSERLSRWRG*
Ga0126376_1226279623300010359Tropical Forest SoilGFRAPELFAATGLVSVASIAIVLGLDHLNEKLSHWRG*
Ga0126377_1195243713300010362Tropical Forest SoilLFAATALVSAASIVIVLSLDALNDRLSHWRGESR*
Ga0136847_1314964813300010391Freshwater SedimentRAPELFAATALVSAASIAAVLGLDRLNERLSHWRG*
Ga0126383_1109417333300010398Tropical Forest SoilGSFANGFQAPELFAATALVSAASIAIVLALDSLNERLSGWRG*
Ga0126383_1315202823300010398Tropical Forest SoilYANGFQAPELFAATALVSAASITIVLALDHLNEKLSRWRG*
Ga0124844_110096433300010868Tropical Forest SoilAPELFAATALVSAASIAIVLALDSLNERLSGWRG*
Ga0137426_118192833300011435SoilGMGSVMGALANGFRAPELFAATALVSAASIVSVLGLDALSERLSHWRD*
Ga0137429_115963623300011437SoilLANGFQAPELFAATGLVSAASILLVLALDALNERLARWRG*
Ga0137388_1001112813300012189Vadose Zone SoilMGYVLGSFANGFQAPELFAATALVSAASIAIVLALDHVNDKLSRWRG*
Ga0137364_1101634523300012198Vadose Zone SoilGMGYVMSSFANGFRAPELFAATALVSAASIAIVLVLDHVNERLSHWRG*
Ga0137362_1123794533300012205Vadose Zone SoilANGFRAPELFAATALVSVSSIAIVLGLDALNERLSHWRS*
Ga0137376_1024818733300012208Vadose Zone SoilLANGFQAPELFAATALVSAASIVIVLSLDVLNDRLAQWRGEVR*
Ga0137370_1014853313300012285Vadose Zone SoilPELFAATALVSAASIVIVLSLDSLNDRLSHWRGELR*
Ga0137387_1029442713300012349Vadose Zone SoilLANGFRAPELFAATGLVSAASIAIVLGLDHVNERLSHWRG*
Ga0137387_1108713223300012349Vadose Zone SoilVMGSLANGFQAPELFAATALVSATSIAIVLGLDQLNERLSRWRG*
Ga0137367_1055044113300012353Vadose Zone SoilAFRAPELFAATGLRSIASSAIVLALDAVNERLSRWR*
Ga0137360_1025087013300012361Vadose Zone SoilLFAATALVSAASIVIVLSLDVLNDRLSQWRGEIR*
Ga0137390_1168228013300012363Vadose Zone SoilAGVRGMGWELSAFANAFQAPELFAATLLVSAVAIAIGLVLDGLGERLARWR*
Ga0157313_104139723300012503Arabidopsis RhizosphereFLAPELFAATALVSAASIAIVLALDHLNDKLSRWRG*
Ga0137358_1041513523300012582Vadose Zone SoilLANGFRAPELFAATALVSAASIVIVLSLDVLNDRLAQWRGEVR*
Ga0137394_1027629513300012922Vadose Zone SoilAPELFAATALVSAASIAIVLALDHLNDKLSRWRG*
Ga0137419_1026412633300012925Vadose Zone SoilYVMGSLANGFRAPELFAATALVSATSIAIVLGLDHVNARLSRWRG*
Ga0137404_1033236313300012929Vadose Zone SoilNSFANGFRAPELFAATALVSVSSIAIVLGLDALNERLSHWRS*
Ga0137407_1023198313300012930Vadose Zone SoilGFQAPELFAATALVSVSSIVIVLGLDALNERLSHWRS*
Ga0137410_1065188313300012944Vadose Zone SoilLFAATALVSAASIVIVLSLDVLNDHLSQWRGEPR*
Ga0126375_1013960143300012948Tropical Forest SoilVLGSYANGFQAPELFAATALVSVASIAIVLALDHVNERLSRWRG*
Ga0126375_1062883033300012948Tropical Forest SoilGMGHVLGSYANGFQAPELFAATALVSAASIAIVLALDHVNDRLSRWRG*
Ga0134081_1013258723300014150Grasslands SoilSLANGFRAPELFAATALVSAASIVIVLSLDVLNDRLSQWRGEPR*
Ga0134075_1037138613300014154Grasslands SoilMGGLANGFRAPELFAATGLVSVASIAIVLGLDHLNEKLSHWRG*
Ga0075311_109704113300014259Natural And Restored WetlandsGFQAPELFAATALVSAASIGIVLGLDALNDRLARWRS*
Ga0180063_128100223300014885SoilFRAPELFAATGLVSAASIAIVLALDALNERLSRWR*
Ga0137403_1141994523300015264Vadose Zone SoilGMGYMMGSLANGFQAPELFAATALVSATSIAIVLGLDHVNERLSRWRG*
Ga0134089_1043986813300015358Grasslands SoilMGALANCFQAPELFAATGLVSAASIAIVLALDHVSERLARWRG*
Ga0134085_1006821413300015359Grasslands SoilMGSLANGFQAPELFAATALVSATSIAIVLGLDQLNERLSRWRG*
Ga0132258_1112465413300015371Arabidopsis RhizosphereGFQAPELFAATALVSAASIAIVLALDHLNDKLSRWRG*
Ga0132256_10012811413300015372Arabidopsis RhizosphereNGFQAPELFAATALVSAASIVIVLALDHLNEKLSSWRG*
Ga0132257_10254352713300015373Arabidopsis RhizosphereGFQAPELFAATALVSAASIVIVLSLDSLNDRLSQWREESR*
Ga0132255_10471951633300015374Arabidopsis RhizosphereGMGHVLGSLANGFQAPELFAATALVSAASIAIVLGLDALNDRLSHWRG*
Ga0184634_1001655113300018031Groundwater SedimentSLANGFQAPELFAATALVSISSIVIVLGLDALNERLSHWRS
Ga0184615_1037750813300018059Groundwater SedimentNGFQAPELFAATALVSISSIVIVLGLDALNERLSHWRS
Ga0066662_1074717233300018468Grasslands SoilVSLSRAHCYVMGALANGFQAPELFAATGLVSAASIAIVLALDHVSERLSRWRG
Ga0209827_1096201143300025149Thermal SpringsSGLANAFQAAELFAATALVSALSIGIVVGLEVLNRRLGRWRG
Ga0207709_1128786623300025935Miscanthus RhizosphereMGSLANGFQAPELFAATALVSAASIAIVLALDTLNDRLSHWRG
Ga0207669_1018172313300025937Miscanthus RhizosphereGMGHVLGSLANGFQAPELFAATALVSASSIAIVLGLDALNDRLSHWRG
Ga0209235_101586133300026296Grasslands SoilMAFQAPELFAATGLVSAASIAIVLALDHLNDKLSHWRG
Ga0209236_112771923300026298Grasslands SoilFRAPELFAATGLVSAASIAIVLVLDHVNERLSHWRG
Ga0209027_117313823300026300Grasslands SoilGFRAPELFAATALVSAASIVIVLSLDALNDRLSQWRGDLR
Ga0209802_130214913300026328SoilMGYVMSSLANGFRAPELFAATGLVSAASIAIVLVLDHVNERLSHWRG
Ga0209158_129991523300026333SoilLGSFANGFQAPELFAATALVSAASIAIVLALDHLNDRLSRWRG
Ga0209804_118909213300026335SoilFRAPELFAATALVSAASIVIVLSLDVLNDRLSQWRGEIR
Ga0209378_108008813300026528SoilFQAPELFAATGLVSAASIAIVLALDHLNDKLSHWSG
Ga0209474_1008957043300026550SoilGMGYVLSSLANGFRAPELFAATALVSAASIVIVLSLDVLNDRLSQWRGEIR
Ga0209648_1016533413300026551Grasslands SoilAFANAFQAPELFAATLLVSAVAIAIGLVLDGLGERLARWR
Ga0209845_101227333300027324Groundwater SandGSLANGFQAPELFAATGLVSAASIAIVLALDHLNDKLSHWRG
Ga0209843_100885713300027511Groundwater SandSLANGFQAPELFAATGLVSAASIAIVLALDHLNDKLSHWRG
Ga0209466_105789513300027646Tropical Forest SoilANGFQPPELFAATALVSTASIAIVLALDSLNERLSRWRA
Ga0209689_136491513300027748SoilGYVMSSLANGFRAPELFAATGLVSAASIAIVLVLDHVNERLSHWRG
Ga0209814_1055009223300027873Populus RhizosphereMGHVLGSFANGFQAPELFAATALVSMASIVIVLSLDALNDRLSHWRGEAR
Ga0209590_1054799533300027882Vadose Zone SoilVMGALANGFQAPELFAATGLVSAASIAIVLALDHVSERLSRWRG
Ga0307498_1020562533300031170SoilGFQAPELFAATALVSAASIAIVLALDHLNDKLSRWRG
(restricted) Ga0255312_106841813300031248Sandy SoilMGALMGALANGFRAPELFAATALVSAASIALVLALDALNERLSRWR
Ga0307408_10075691113300031548RhizosphereFQAPELFAATALVSVASIVIVLSLDAVNDRLSHWRGDAR
Ga0307469_1017342113300031720Hardwood Forest SoilFQAPELFAATALVSAASIAIVLALDVLNDRLSHWRGQ
Ga0318493_1038640213300031723SoilGHMLGSYANGFQAPELFAATALVSAASIAIVLVLDHVNDKLSRWRG
Ga0318500_1002758713300031724SoilGHVLGSYANGFQAPELFAATALVSAASIAIVLVLDHVNDKLSRWRG
Ga0307473_1078177313300031820Hardwood Forest SoilGFQAPELFAATALVSAASIAIVLALGALSDRLSHWRG
Ga0307473_1086821433300031820Hardwood Forest SoilGMGAELAARANAFQAPELFAATLLVSTVSIAIVLALDALGDRLSRWR
Ga0307412_1108274423300031911RhizosphereVMGSLANGFQAPELFAATALVSAASIAIVLGLDALNERLSHWR
Ga0306926_1140488613300031954SoilSYANGFQAPELFAATALVSAASITIVLALDHLNEKLSRWRG
Ga0307416_10058385923300032002RhizosphereHVLGSFANGFQAPELFAATALVSTASIVIVLSLDALNDRLSHWRGDAR
Ga0307416_10297592723300032002RhizosphereLANGFQAPELFAATALVSAASIVIVLSLDVLNDRLSHWRGDAR
Ga0310897_1023916043300032003SoilLNSLANGFQAAELFAATALVSAASIAIVLGLDALNERLSHWRS
Ga0310890_1100493233300032075SoilHVLGSLANGFQAPELFAATALVSAASIVIVLGLDALNDRLSHWRG
Ga0307471_10180362713300032180Hardwood Forest SoilFQAPELFAATALVSVSSIAIVLGLDALNERLSIWRG
Ga0307471_10312870313300032180Hardwood Forest SoilGFRAPELFAATGLISVVSIAIVLALDALNERLSRWR
Ga0335085_1103586113300032770SoilANGFQAPELFAATALVSASSIAIVLALDTLNDRLSHWRG
Ga0373948_0019662_1172_12793300034817Rhizosphere SoilQAAELFAATALVSAASIAIVLGLDALNERLSHWRS
Ga0373950_0177598_343_4863300034818Rhizosphere SoilMGYVLSSYANGFQAPELFAATALVSAASIAIVLALDHLNDKLSRWRG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.