| Basic Information | |
|---|---|
| Family ID | F055134 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 139 |
| Average Sequence Length | 42 residues |
| Representative Sequence | QHPIEIVGAQLRGMMSWLPKDGKKPAEAPKDGTKQVVNA |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.28 % |
| % of genes from short scaffolds (< 2000 bps) | 89.93 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.281 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.583 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.741 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.360 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.40% β-sheet: 0.00% Coil/Unstructured: 80.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF02776 | TPP_enzyme_N | 97.12 |
| PF03544 | TonB_C | 0.72 |
| PF00920 | ILVD_EDD | 0.72 |
| PF02775 | TPP_enzyme_C | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 1.44 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.28 % |
| Unclassified | root | N/A | 0.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_104281659 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300001356|JGI12269J14319_10233019 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300001593|JGI12635J15846_10350308 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300001593|JGI12635J15846_10652859 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300002912|JGI25386J43895_10066143 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300004081|Ga0063454_100994626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 674 | Open in IMG/M |
| 3300004082|Ga0062384_100757046 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300004137|Ga0058883_1324569 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300004152|Ga0062386_101696676 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005435|Ga0070714_102455010 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005534|Ga0070735_10303160 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300005591|Ga0070761_10030554 | All Organisms → cellular organisms → Bacteria | 3008 | Open in IMG/M |
| 3300005610|Ga0070763_10275949 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300006028|Ga0070717_12113437 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300006173|Ga0070716_100498562 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300009521|Ga0116222_1226933 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300009521|Ga0116222_1500515 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300010048|Ga0126373_10179489 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
| 3300010341|Ga0074045_10657626 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300010379|Ga0136449_101261162 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300010398|Ga0126383_12002128 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300010858|Ga0126345_1270319 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300011120|Ga0150983_14619477 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300012096|Ga0137389_11405501 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300012350|Ga0137372_10603459 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300012363|Ga0137390_11765191 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012685|Ga0137397_10416027 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300014169|Ga0181531_10104048 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300014501|Ga0182024_10607758 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300014657|Ga0181522_10505294 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300014969|Ga0157376_12836996 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300015195|Ga0167658_1067041 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300015371|Ga0132258_11665012 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300016387|Ga0182040_10091829 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
| 3300017822|Ga0187802_10259565 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300017937|Ga0187809_10356135 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300018007|Ga0187805_10006794 | All Organisms → cellular organisms → Bacteria | 4674 | Open in IMG/M |
| 3300018007|Ga0187805_10105781 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300018086|Ga0187769_10273136 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300018090|Ga0187770_10901420 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300018433|Ga0066667_12320311 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300019284|Ga0187797_1381741 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300019786|Ga0182025_1218794 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300020580|Ga0210403_10228143 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300020583|Ga0210401_11341292 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300021401|Ga0210393_10233186 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300021401|Ga0210393_10307300 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300021402|Ga0210385_10453753 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300021402|Ga0210385_11043571 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300021406|Ga0210386_10892755 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300021420|Ga0210394_11268715 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300021433|Ga0210391_10697113 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300021478|Ga0210402_10198827 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300021478|Ga0210402_11025520 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300021479|Ga0210410_11524329 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300021560|Ga0126371_10452058 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300021861|Ga0213853_10864259 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300022506|Ga0242648_1062528 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300022511|Ga0242651_1054552 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300022712|Ga0242653_1002625 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
| 3300022712|Ga0242653_1017964 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300022717|Ga0242661_1082743 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300024279|Ga0247692_1071100 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300025412|Ga0208194_1005133 | All Organisms → cellular organisms → Bacteria | 2363 | Open in IMG/M |
| 3300025442|Ga0208034_1044900 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300025905|Ga0207685_10814564 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300025913|Ga0207695_10098488 | All Organisms → cellular organisms → Bacteria | 2923 | Open in IMG/M |
| 3300026308|Ga0209265_1041278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1428 | Open in IMG/M |
| 3300027070|Ga0208365_1026493 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300027076|Ga0208860_1014008 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300027521|Ga0209524_1036450 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300027576|Ga0209003_1115359 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300027745|Ga0209908_10146758 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300027824|Ga0209040_10070111 | All Organisms → cellular organisms → Bacteria | 2053 | Open in IMG/M |
| 3300027825|Ga0209039_10161804 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300027854|Ga0209517_10427580 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300027867|Ga0209167_10047817 | All Organisms → cellular organisms → Bacteria | 2095 | Open in IMG/M |
| 3300027867|Ga0209167_10767223 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300027895|Ga0209624_10381322 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300027903|Ga0209488_10074497 | All Organisms → cellular organisms → Bacteria | 2520 | Open in IMG/M |
| 3300027905|Ga0209415_10119266 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
| 3300028036|Ga0265355_1017038 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300028765|Ga0302198_10403868 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300028765|Ga0302198_10548594 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300028866|Ga0302278_10123100 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300028874|Ga0302155_10145608 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300028874|Ga0302155_10234986 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300028882|Ga0302154_10542770 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300028906|Ga0308309_10805862 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300029908|Ga0311341_10315337 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300029953|Ga0311343_11214569 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300029999|Ga0311339_11327570 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300030013|Ga0302178_10356055 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300030020|Ga0311344_10175407 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
| 3300030043|Ga0302306_10170971 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300030057|Ga0302176_10067513 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300030057|Ga0302176_10154941 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300030519|Ga0302193_10480969 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300030529|Ga0210284_1799703 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300030529|Ga0210284_1850618 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300030580|Ga0311355_11539294 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300030598|Ga0210287_1168708 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300030706|Ga0310039_10210121 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300030740|Ga0265460_11837973 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300030743|Ga0265461_11517418 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300030743|Ga0265461_12692477 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300030836|Ga0265767_101105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1269 | Open in IMG/M |
| 3300030878|Ga0265770_1152478 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300030906|Ga0302314_10707754 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300031018|Ga0265773_1047827 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300031231|Ga0170824_101919706 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300031231|Ga0170824_104328128 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300031231|Ga0170824_109674573 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300031231|Ga0170824_111251511 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
| 3300031231|Ga0170824_126161085 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031233|Ga0302307_10393010 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300031233|Ga0302307_10600710 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031446|Ga0170820_17282890 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300031469|Ga0170819_17070250 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031474|Ga0170818_103935262 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300031474|Ga0170818_109240713 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300031525|Ga0302326_11633737 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300031573|Ga0310915_10053345 | All Organisms → cellular organisms → Bacteria | 2619 | Open in IMG/M |
| 3300031708|Ga0310686_105667390 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300031715|Ga0307476_10222907 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300031753|Ga0307477_10548991 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300031753|Ga0307477_11049024 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031754|Ga0307475_11363951 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031771|Ga0318546_10930202 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300031781|Ga0318547_10758648 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300031820|Ga0307473_11389106 | Not Available | 529 | Open in IMG/M |
| 3300031941|Ga0310912_11481621 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031946|Ga0310910_10032639 | All Organisms → cellular organisms → Bacteria | 3553 | Open in IMG/M |
| 3300032782|Ga0335082_10089337 | All Organisms → cellular organisms → Bacteria | 3078 | Open in IMG/M |
| 3300032783|Ga0335079_11912555 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300032783|Ga0335079_12070362 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300033004|Ga0335084_10347352 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300033134|Ga0335073_10716358 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300033290|Ga0318519_10444733 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.58% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.19% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 7.19% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 6.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.47% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.04% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.60% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.16% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.16% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.16% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.44% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.44% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.44% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.44% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.72% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.72% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.72% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.72% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004137 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028765 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300030529 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030598 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1042816591 | 3300000955 | Soil | EQQHPIEKVGAQLRGMMSWLPKEAKKSQPKQESEAKVVNA* |
| JGI12269J14319_102330191 | 3300001356 | Peatlands Soil | ALREKEKKHPIEIVGAQLRGMMSWLPKEGKKTEAPKEKQVVNA* |
| JGI12635J15846_103503081 | 3300001593 | Forest Soil | HPIEIVGAQLRGMMSWLPKDGKKPAEAPAPKQVVNA* |
| JGI12635J15846_106528592 | 3300001593 | Forest Soil | IIGAQLRGMMSWLPGREAKKPAEAKKREPEQVVNA* |
| JGI25386J43895_100661431 | 3300002912 | Grasslands Soil | KEKQHPIEAVGAQLRGMMSWLQKDVKKPGAAQKPQAQVVNA* |
| Ga0063454_1009946261 | 3300004081 | Soil | REAEKKHPIEIVGAELRGMMSWLPKDGKKQAAPQDSAKQVVNA* |
| Ga0062384_1007570461 | 3300004082 | Bog Forest Soil | EKEKQHPIEIVGAQLRGMMSWLPKDGKKPAEAPAPKQVVNA* |
| Ga0058883_13245691 | 3300004137 | Forest Soil | EQQHPIEIVGAQLRGMMSWLPGRETKKPAEAKKPEPEQVVNA* |
| Ga0062386_1016966761 | 3300004152 | Bog Forest Soil | KDGGYHFTELREKEQKHPIEIVGAQLRGMMSWLPGREAKKPADAPKPEAKQVVNA* |
| Ga0070714_1024550102 | 3300005435 | Agricultural Soil | VLREKEKQHPIEIVGAQLRSMMSWLPKEGKKPAETPKDPSKQVVNA* |
| Ga0070735_103031601 | 3300005534 | Surface Soil | LRENEKRHPIEIVGAELRGMMAWLPGREAKKPVEAKKEDGKLAVNA* |
| Ga0070761_100305541 | 3300005591 | Soil | IVGAQLRSMMSWLPKDGKKPADAPKPPEKQVVNA* |
| Ga0070763_102759492 | 3300005610 | Soil | EKQHPIEIVGAQLRGMMSWLPKEGKKTAPAPSDTKQVVNA* |
| Ga0070717_121134372 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EKQHPIEIVGAQLRSMMSWLPKDGKKTAEASKESTKQVVNA* |
| Ga0070716_1004985621 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QHPIEIVGAQLRGMMSWLPQAGKKKAEAPAESTKQVVNA* |
| Ga0116222_12269332 | 3300009521 | Peatlands Soil | EKEKQHPIEIVGAQLRGMMSWLPRESKKPAPQDPPKVVNA* |
| Ga0116222_15005151 | 3300009521 | Peatlands Soil | KEKQHPIEIVGAQLRGMMSWLPKESKKPAETPKRVVNA* |
| Ga0126373_101794891 | 3300010048 | Tropical Forest Soil | PIEIVGAQLRSMMSWLPKEGKKAASAPQATKQVVNA* |
| Ga0074045_106576261 | 3300010341 | Bog Forest Soil | KHPIEIVGAQLRGMMSWLPGKDGKKPAEAPKPAPKQVVNA* |
| Ga0136449_1012611621 | 3300010379 | Peatlands Soil | EKQHPIEIVGAQLRSMMSWLPKESKKPAEAPKESVKQVVNA* |
| Ga0126383_120021281 | 3300010398 | Tropical Forest Soil | EIVGAELRGMMSWLPKEGKKQPAQQDSTKQVVNA* |
| Ga0126345_12703192 | 3300010858 | Boreal Forest Soil | REKEKQHPIEIVGAQLRGMMSWLPKEGKKKTEAPQDPTKQVVNA* |
| Ga0150983_146194771 | 3300011120 | Forest Soil | KEKQHPIEIVGAELRGMMSWLPKETKKPAETPKAQPKQVVNA* |
| Ga0137389_114055012 | 3300012096 | Vadose Zone Soil | PIEIVGAQLRGMMSWLPGKDAKKPAEAPKPGEAAETKAKQVVNA* |
| Ga0137372_106034592 | 3300012350 | Vadose Zone Soil | LREKEKQHPIEIVGAQLRGMMSWLPKEGKKPTEAPKDPTKQVVNA* |
| Ga0137390_117651912 | 3300012363 | Vadose Zone Soil | QQHPIEIVGAQLRGMMSWLPGREAKKGPDAPKPEPKQVVNA* |
| Ga0137397_104160272 | 3300012685 | Vadose Zone Soil | AKFNALRAKEKQHPIEIVGAQLRGMMSWLPKEGAKKPAAPKDSTKQVVNA* |
| Ga0181531_101040482 | 3300014169 | Bog | REKEKQHPIEIVGAQLRGMMSWLPKDGKKPEAPAPKQVVNA* |
| Ga0182024_106077582 | 3300014501 | Permafrost | GGYHFTELRQKEQQHPIEIIGAQLRGMMSWLPGKEPKKPAEAKKPEPEQVVNA* |
| Ga0181522_105052941 | 3300014657 | Bog | TELREKEQRHPIEIVGAQLRGMMSWLPGREAKKPAQTPKPEPEQVVNA* |
| Ga0157376_128369962 | 3300014969 | Miscanthus Rhizosphere | EIVGAQLRGMMSWLPKEGKKPAEAPDPTKQVVNA* |
| Ga0167658_10670412 | 3300015195 | Glacier Forefield Soil | LRQKEQQHPIEIVGAQLRGMMSWLPGREAKKAPDAPKEEVKQAVNA* |
| Ga0132258_116650121 | 3300015371 | Arabidopsis Rhizosphere | EKEKQHPIEIVGAELRGMMSWLPKEGKKPAEAPDPTKQVVNA* |
| Ga0182040_100918291 | 3300016387 | Soil | GAELRGMMSWLPKEGGKTQPPAQATKPEAEPKVVNA |
| Ga0187802_102595651 | 3300017822 | Freshwater Sediment | IEIVGAQLRAMMSWLPKEGKNKAEAPKPPKQVVNA |
| Ga0187809_103561351 | 3300017937 | Freshwater Sediment | KEKQHPIEIVGAQLRGMMSWLPKEGKKPAEAPKGTTKQVVNV |
| Ga0187805_100067941 | 3300018007 | Freshwater Sediment | KQHPIEIVGAQLRSMMSWLPKEAKKSTEAPKPDTKRVVNA |
| Ga0187805_101057811 | 3300018007 | Freshwater Sediment | EKEKQHPIEIVGAQLRGMMSWLPKDGKKAAEAPAPKQVVNA |
| Ga0187769_102731361 | 3300018086 | Tropical Peatland | KQHPIEIVGAQLRGMMSWLPKEGKKATEAPKDKEKQVVNA |
| Ga0187770_109014201 | 3300018090 | Tropical Peatland | EKKHPIEIVGAQLRGLMSWLPKEGKKTEAPKEKQVVNA |
| Ga0066667_123203112 | 3300018433 | Grasslands Soil | IKIVGAQLRGMMSWLPKEAAKKPADAPKDKPKQVVNA |
| Ga0187797_13817411 | 3300019284 | Peatland | IVGAQLRGMMSWLPGREAKKAAEAPKAEPEQVVNA |
| Ga0182025_12187941 | 3300019786 | Permafrost | QQHPIEIIGAQLRGMMSWLPGKEPKKPAEAKKPEPEQVVNA |
| Ga0210403_102281432 | 3300020580 | Soil | PIEIVGAQLRGMMSWLPGREAKKGPEAPKEGIKQAVNA |
| Ga0210401_113412921 | 3300020583 | Soil | EKQHPIEKVGAELRGMMSWLPKEAKKAQPKSEAEPKVVNA |
| Ga0210393_102331861 | 3300021401 | Soil | IEIVGAQLRGMMSWLPKEGNKSTAAPKDPAKQVVNA |
| Ga0210393_103073001 | 3300021401 | Soil | HPIEIVGAQLRGMMSWLPGGPSKKPLEMPKPEPQRVVNA |
| Ga0210385_104537532 | 3300021402 | Soil | AQLRGMMSWLPGQQPKKPAEAPKASEAAKAPKQVVNA |
| Ga0210385_110435712 | 3300021402 | Soil | EKQHPIEIVGAQLRGMMSWLPKEGNKSTEAPKDPAKQVVNA |
| Ga0210386_108927551 | 3300021406 | Soil | RESEKQHPIEIVGAQLRGMMSWLPKEGKKTAPAPSDTKQVVNA |
| Ga0210394_112687151 | 3300021420 | Soil | YQFAELREKEQQHPIEIVGAQLRGMMSWLPGQQAKKPAEAPKAEAKKVAVNA |
| Ga0210391_106971131 | 3300021433 | Soil | QHPIEIVGAQLRGMMSWLPGQQPKKAPEAKKEEIKQAVNA |
| Ga0210402_101988272 | 3300021478 | Soil | YHFTELRHQEQQHPIEIVGAQLRGMMSWLPGQQAAKKPAEAPKAEAKKVAVNA |
| Ga0210402_110255201 | 3300021478 | Soil | REKEKKHPIEIVGAQLRGMMSWLPKDGKKPADAPKAPEKQVVNA |
| Ga0210410_115243292 | 3300021479 | Soil | PIEIIGAQLRGMMSWLPKEGKKATPQGSTKQVVNA |
| Ga0126371_104520581 | 3300021560 | Tropical Forest Soil | PIEIVGAQLRAMMSWLPKEGKKQPAPESTKQVVNA |
| Ga0213853_108642591 | 3300021861 | Watersheds | KHPIEIVGAELRGMMSWLPKEGKKPADAPKEPKQVVNA |
| Ga0242648_10625282 | 3300022506 | Soil | LRAKEKQHPIEIVGAQLRGMMSWLPKDGKKPAEAPAAAPKQVVNA |
| Ga0242651_10545522 | 3300022511 | Soil | EIVGAQLRGMMSWLPKEGKKSAEAPKDSTKQVVNA |
| Ga0242653_10026252 | 3300022712 | Soil | REKEKQHPIEIIGAQLRGMMSWLPKEGKKATPQGSTKQVVNA |
| Ga0242653_10179641 | 3300022712 | Soil | KRHPIEIVGAQLRSMMSWLPKEGKKPAETPKDGTKQVVNA |
| Ga0242661_10827432 | 3300022717 | Soil | REKEKQHPIEIIGAQLRGMMSWLPRDGKKPAAPQDSTKQVVNA |
| Ga0247692_10711001 | 3300024279 | Soil | REAEKRHPIEIVGAQLRGMMSWLPKEAKKAVPASEETKQVVNA |
| Ga0208194_10051333 | 3300025412 | Peatland | IEIVGAQLRGMMSWLPGREAKKPAEAPKPQPKQVVNA |
| Ga0208034_10449002 | 3300025442 | Peatland | HPIEIVGAQLRGMMSWLPGKEAKKPANAPKPEPEQVVNA |
| Ga0207685_108145642 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | HPIEIVGAQLRSMMSWLPKEGKKTAAAPQETKQVVNA |
| Ga0207695_100984884 | 3300025913 | Corn Rhizosphere | NKLREKEKQHPIEIVGAQLRGMMSWLPQAGKKTAEAPAESTKQVVNA |
| Ga0209265_10412783 | 3300026308 | Soil | REKEKQHPIEIVGAQLRGMMSWLPQAGKKKAEAPAESTKQVVNA |
| Ga0208365_10264931 | 3300027070 | Forest Soil | RDGGHHFAELRKKELQHPIEIVGAQLRGMMSWLPGRETKKPAEAPKGEEKQVVNA |
| Ga0208860_10140081 | 3300027076 | Forest Soil | KDGGYNFADLRHKEQQHPIEIVGAQLRGMMSWLPGREAKKPSEAPKPEPKQVVNA |
| Ga0209524_10364501 | 3300027521 | Forest Soil | FTELREKEQQHPIEIVGAQLRGMMSWLPKEGKKPAEAPKDTNQVVNA |
| Ga0209003_11153592 | 3300027576 | Forest Soil | IEIVGAQLRGMMSWLPKEGKKPAEAPKDPAKQVVNA |
| Ga0209908_101467581 | 3300027745 | Thawing Permafrost | REKEKQHPIEIVGAQLRGMMSWLPKEGKKPAEAPPDPAKRVVNA |
| Ga0209040_100701112 | 3300027824 | Bog Forest Soil | PIEIVGAQLRGMMSWLPGRRSKKPAEAPKAEAKQVVNA |
| Ga0209039_101618042 | 3300027825 | Bog Forest Soil | FAALREKEQKHPIEIVGAQLRGMMSWLPGKDGKKPAEAPKPAPKQVVNA |
| Ga0209517_104275802 | 3300027854 | Peatlands Soil | PIEIVGAELRGMMSWLPKEGKKPAETPRESDKQVVNA |
| Ga0209167_100478173 | 3300027867 | Surface Soil | KQHPIEIVGAQLRGMMSWLPKDGKKSADAPKAPEKQVVNA |
| Ga0209167_107672231 | 3300027867 | Surface Soil | AEKQHPIEIVGAQLRGMMSWLPKEGKKASPAPEEAKQVVNA |
| Ga0209624_103813221 | 3300027895 | Forest Soil | EKEQKHPIEIVGAQLRGMMSWLPGREAKKPAEAPKPAPKQVVNA |
| Ga0209488_100744971 | 3300027903 | Vadose Zone Soil | RQQEKQHPIEIVGAQLRGMMSWLPKEAGKKPAQAPEEPSKQVVNA |
| Ga0209415_101192664 | 3300027905 | Peatlands Soil | ELRHQEQQHPIEIVGAQLRGMMSWLPGKDGKKPAEAPKTAEGTKPEIKQAVNA |
| Ga0265355_10170382 | 3300028036 | Rhizosphere | IEIVGAQLRGMMSWLPKDGKKPADAPKTPEPNKEKQVVNA |
| Ga0302198_104038682 | 3300028765 | Bog | QQHPIEIVGAQLRGMMSWLPGREAKKAPEAKKEEIKQAVNA |
| Ga0302198_105485941 | 3300028765 | Bog | VGAQLRGMMSWLPGRQGSAKKPAEAPKPEPEQVVNA |
| Ga0302278_101231001 | 3300028866 | Bog | NKDGGYHFTELREREQQHPIEIVGAQLRGMMSWLPGREAKKPAEAPKPQQKQVVNA |
| Ga0302155_101456082 | 3300028874 | Bog | REQQHPIEIVGAQLRGMMSWLPGREAKKPAEAPKGEGKTEAKKVAVNA |
| Ga0302155_102349862 | 3300028874 | Bog | KHPIEIVGAQLRGMMSWLPGRQGSAKKPAEAPKPEPEQVVNA |
| Ga0302154_105427702 | 3300028882 | Bog | QEHPIEIVGAQLRGMMSWLPGKETKKAPAAPQTEDKQVVNA |
| Ga0308309_108058621 | 3300028906 | Soil | EKQHPIEIVGAQLRGMMSWLPKDGKKPAEAPAPKQVVNA |
| Ga0311341_103153372 | 3300029908 | Bog | YNFAELREKEQQHPIEIVGAQLRGMMSWLPGREAKKAPEAKKEEIKQAVNA |
| Ga0311343_112145692 | 3300029953 | Bog | TELREREQQHPIEIVGAQLRGMMSWLPGREAKKPAEAPKPQPKQVVNA |
| Ga0311339_113275702 | 3300029999 | Palsa | KEQKHPIEAVGAQLRGMMSWLPGEKKKAEVKTPEKQVVNA |
| Ga0302178_103560551 | 3300030013 | Palsa | KQGGYNFAELREKEQQHPIEIVGAQLRGMMSWLPGIAAKKAAESPKEEIKQAVNA |
| Ga0311344_101754073 | 3300030020 | Bog | EREQQHPIEIVGAQLRGMMSWLPGREAKKPAEAPKPQQKQVVNA |
| Ga0302306_101709711 | 3300030043 | Palsa | AALRAKEKQHPIEIVGAQLRGMMSWLPKDGKKPADAPKTPEPNKEKQVVNA |
| Ga0302176_100675132 | 3300030057 | Palsa | KEKQHPIEIVGAQLRGMMSWLPKDGKKPADAPKTPEPNKEKQVVNA |
| Ga0302176_101549412 | 3300030057 | Palsa | HPIEVVGAELRGMMSWLPGRESKKTAEAPKAETKQAVNA |
| Ga0302193_104809692 | 3300030519 | Bog | NFAELREKEQQHPIEIVGAQLRGMMSWLPGREAKKAPEAKKEEIKQAVNA |
| Ga0210284_17997032 | 3300030529 | Soil | PIEIVGAQLRGMMSWLPKDGKKPADTPKPAEKQVVNA |
| Ga0210284_18506181 | 3300030529 | Soil | QHPIEIVGAQLRGMMSWLPKEGKKAAAPKEEPKQVVNA |
| Ga0311355_115392942 | 3300030580 | Palsa | QFAALREKELQHPIEVVGAQLRGMMSWLPGRESRKTAEAPQAEAKQAVNA |
| Ga0210287_11687081 | 3300030598 | Soil | AKEKQHPIEIVGAQLRAMMSWLPKDGKKPADAPKPPEKQVVNA |
| Ga0310039_102101212 | 3300030706 | Peatlands Soil | HPIEIVGAQLRGMMSWLPKGKKAAEAPAPKQVVNA |
| Ga0265460_118379732 | 3300030740 | Soil | EKQHPIEIVGAQLRGMMSWLPKDGKKPADAPKPPEKEKQVLNA |
| Ga0265461_115174181 | 3300030743 | Soil | IEIVGAQLRGMMSWLPKEGKKPAEAPKDPAKRVVNA |
| Ga0265461_126924771 | 3300030743 | Soil | IEIVGAQLRGMMSWLPKDGKKPADTPKPAEKQVVNA |
| Ga0265767_1011053 | 3300030836 | Soil | AKEKQHPIEIVGAQLRGMMSWLPKDGKKPADAPKPPEKEKQVVNA |
| Ga0265770_11524781 | 3300030878 | Soil | AALREKEQKHPIEIVGAELRGMMSWLPGKEAKKPAEAPKPAPKQVVNA |
| Ga0302314_107077541 | 3300030906 | Palsa | AELREREQQHPIEIVGAQLRGMMSWLPGREGKKPAEAPKGEAGTQAKKVAVNA |
| Ga0265773_10478272 | 3300031018 | Soil | EKEKQHPIEIVGAQLRGMMSWLPKEGKKPAEAPQDPAKQVVNA |
| Ga0170824_1019197063 | 3300031231 | Forest Soil | PIEIVGAELRGMMSWLPKEGKKRSEGPTEVPKQVVNA |
| Ga0170824_1043281281 | 3300031231 | Forest Soil | HPIEIVGAQLRGMMSWLPKEGKKPAEAPKGGTKQVVNA |
| Ga0170824_1096745731 | 3300031231 | Forest Soil | PIEIVGAQLRGMMSWLPKEGKKPAEAPAPKQVVNA |
| Ga0170824_1112515111 | 3300031231 | Forest Soil | FASLRENEQRHPIEIVGAQLRGMMSWLPGKKPVEAKKEEIKQAVNA |
| Ga0170824_1261610852 | 3300031231 | Forest Soil | QHPIEIVGAQLRGMMSWLPKDGKNPAAPKDSAKQVVNA |
| Ga0302307_103930101 | 3300031233 | Palsa | AKEKQHPIEIVGAQLRGMMSWLPKDGKKPADAPKTPEPNKEKQVVNA |
| Ga0302307_106007102 | 3300031233 | Palsa | PIEIVGAQLRGMMSWLPKDGKKPADAPKPAEKQVVNA |
| Ga0170820_172828901 | 3300031446 | Forest Soil | QHPIEIVGAQLRGMMSWLPKDGKKPAEAPKDGTKQVVNA |
| Ga0170819_170702501 | 3300031469 | Forest Soil | PIEIVGAQLRGMMSWLPKDGKNPAAPKDSAKQVVNA |
| Ga0170818_1039352621 | 3300031474 | Forest Soil | IEIVGAQLRGMMSWLPKDGKNPAAPKDSAKQVVNA |
| Ga0170818_1092407131 | 3300031474 | Forest Soil | EKQHPIEIVGAQLRGMMSWLPKEGKKKTEAPKDPTKQVVNA |
| Ga0302326_116337371 | 3300031525 | Palsa | REREQQHPIEIVGAQLRGMMSWLPGREAKKPAEAPKGEGKTEAKKVAVNA |
| Ga0310915_100533451 | 3300031573 | Soil | ERVGAELRGMMSWLPKEGGKTQTPAQATKPEAEPKVVNA |
| Ga0310686_1056673901 | 3300031708 | Soil | KEKQHPIEIVGAQLRGMMSWLPKDGKKPAEAPAPKQVVNA |
| Ga0307476_102229072 | 3300031715 | Hardwood Forest Soil | QHPIEIVGAQLRGMMSWLPKEGKKPAEAPQDPAKQVVNA |
| Ga0307477_105489911 | 3300031753 | Hardwood Forest Soil | AALREKEKQHPIEIVGAQLRGMMSWLPAEGKKPAEAQKKEVKHAVNA |
| Ga0307477_110490241 | 3300031753 | Hardwood Forest Soil | KEQKHPIEIVGAELRGMMSWLPGKEAKKPAEAPKPAPKQVVNA |
| Ga0307475_113639511 | 3300031754 | Hardwood Forest Soil | GYHFTELRHKEQQHPIEIVGAQLRGMMSWLPGREAKKPAEAKKPEPEQVVNA |
| Ga0318546_109302022 | 3300031771 | Soil | AALREAEKQHPIERVGAELRGMMSWLPKEGGKTQTPAQATKPEAEPKVVNA |
| Ga0318547_107586482 | 3300031781 | Soil | AEKQHPIERVGAELRGMMSWLPKEGGKTQTPAQATKPEAEPKVVNA |
| Ga0307473_113891061 | 3300031820 | Hardwood Forest Soil | ALREKEKQHPIEIVGAQLRGMMSWLPAEGKKPAADPKTADQKKGKSKQVVNA |
| Ga0310912_114816212 | 3300031941 | Soil | KRHPIEIVGAQLRSMMSWLPKEGKKQSAPQESPKQVVNA |
| Ga0310910_100326394 | 3300031946 | Soil | ALREAEKQHPIERVGAELRGMMSWLPKEGGKTQTPAQATKPEAEPKVVNA |
| Ga0335082_100893374 | 3300032782 | Soil | KEKQHPIEIIGAQLRGMMSWLPKEGKKQPAPQDPTKQVVNA |
| Ga0335079_119125551 | 3300032783 | Soil | REAEKQHPIEQVGAQLRGMMSWLPKESKKAGAAERPEPRVVNA |
| Ga0335079_120703622 | 3300032783 | Soil | AEKRHPIEIVGAQLRGMMSWLPKDGKKSAPAQQETKQVVNA |
| Ga0335084_103473521 | 3300033004 | Soil | LREKEKQHPIEIVGAQLRGMMSWLPKEGKKQTAPQDSSKQVVNA |
| Ga0335073_107163581 | 3300033134 | Soil | EKEKQHPIEIVGAQLRAMMSWLPKDGKKPAPADSTKQVVNA |
| Ga0318519_104447332 | 3300033290 | Soil | KQHPIERVGAELRGMMSWLPKEGGKTQTPAQATKPEAEPKVVNA |
| ⦗Top⦘ |