| Basic Information | |
|---|---|
| Family ID | F055109 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 139 |
| Average Sequence Length | 41 residues |
| Representative Sequence | IPFFGGLIDGYSTKVKGLKPSKGTLNLDSFGHGYRTIWFG |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.28 % |
| % of genes from short scaffolds (< 2000 bps) | 94.24 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.173 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.669 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.863 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.007 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.88% β-sheet: 0.00% Coil/Unstructured: 94.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 33.81 |
| PF12911 | OppC_N | 2.16 |
| PF00005 | ABC_tran | 1.44 |
| PF00106 | adh_short | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.17 % |
| Unclassified | root | N/A | 15.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459015|G14TP7Y02GJ250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 568 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101162790 | Not Available | 661 | Open in IMG/M |
| 3300005093|Ga0062594_101540856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
| 3300005093|Ga0062594_103074195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300005180|Ga0066685_10380279 | Not Available | 981 | Open in IMG/M |
| 3300005187|Ga0066675_10655257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
| 3300005332|Ga0066388_102928548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 872 | Open in IMG/M |
| 3300005332|Ga0066388_105712319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
| 3300005332|Ga0066388_107786230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
| 3300005332|Ga0066388_108443813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300005337|Ga0070682_100522451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 924 | Open in IMG/M |
| 3300005338|Ga0068868_101728141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300005435|Ga0070714_101054122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300005435|Ga0070714_102133412 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005436|Ga0070713_101958013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300005439|Ga0070711_100598424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 920 | Open in IMG/M |
| 3300005447|Ga0066689_10558950 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300005466|Ga0070685_10407632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
| 3300005467|Ga0070706_102058172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300005518|Ga0070699_100095929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 2597 | Open in IMG/M |
| 3300005540|Ga0066697_10428411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300005543|Ga0070672_100903453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 780 | Open in IMG/M |
| 3300005554|Ga0066661_10708098 | Not Available | 591 | Open in IMG/M |
| 3300005614|Ga0068856_100497768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1240 | Open in IMG/M |
| 3300005617|Ga0068859_101288052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
| 3300005618|Ga0068864_102005165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 585 | Open in IMG/M |
| 3300005713|Ga0066905_101928634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 547 | Open in IMG/M |
| 3300005719|Ga0068861_101133686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
| 3300005764|Ga0066903_107477080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300005764|Ga0066903_108103029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300005893|Ga0075278_1074287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
| 3300006028|Ga0070717_11293025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
| 3300006046|Ga0066652_101406023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 653 | Open in IMG/M |
| 3300006057|Ga0075026_100149089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1199 | Open in IMG/M |
| 3300006173|Ga0070716_101338577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300006175|Ga0070712_100362188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1189 | Open in IMG/M |
| 3300006237|Ga0097621_102299429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300006800|Ga0066660_10942167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
| 3300006953|Ga0074063_14103064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1793 | Open in IMG/M |
| 3300007076|Ga0075435_100732681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 860 | Open in IMG/M |
| 3300009011|Ga0105251_10597674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300009098|Ga0105245_12807936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 540 | Open in IMG/M |
| 3300010154|Ga0127503_11295789 | Not Available | 938 | Open in IMG/M |
| 3300010301|Ga0134070_10082937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1104 | Open in IMG/M |
| 3300010359|Ga0126376_10878312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 884 | Open in IMG/M |
| 3300010359|Ga0126376_10905844 | Not Available | 872 | Open in IMG/M |
| 3300010361|Ga0126378_12779444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 559 | Open in IMG/M |
| 3300010376|Ga0126381_101309811 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300010376|Ga0126381_104059381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 569 | Open in IMG/M |
| 3300010376|Ga0126381_104073866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 568 | Open in IMG/M |
| 3300010376|Ga0126381_104364839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 547 | Open in IMG/M |
| 3300010376|Ga0126381_104589007 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300010398|Ga0126383_13603762 | Not Available | 506 | Open in IMG/M |
| 3300010880|Ga0126350_11623843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300011269|Ga0137392_10653072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 872 | Open in IMG/M |
| 3300012188|Ga0136618_10401172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 591 | Open in IMG/M |
| 3300012199|Ga0137383_10508812 | Not Available | 882 | Open in IMG/M |
| 3300012201|Ga0137365_11015464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 601 | Open in IMG/M |
| 3300012211|Ga0137377_11463953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 610 | Open in IMG/M |
| 3300012351|Ga0137386_10388213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1005 | Open in IMG/M |
| 3300012359|Ga0137385_10197438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1757 | Open in IMG/M |
| 3300012360|Ga0137375_11240191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 568 | Open in IMG/M |
| 3300012362|Ga0137361_11532410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 588 | Open in IMG/M |
| 3300012363|Ga0137390_11265765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
| 3300012582|Ga0137358_10967188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 553 | Open in IMG/M |
| 3300012955|Ga0164298_10064468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1817 | Open in IMG/M |
| 3300012955|Ga0164298_10237633 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300012971|Ga0126369_10762517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1048 | Open in IMG/M |
| 3300012971|Ga0126369_12991080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 553 | Open in IMG/M |
| 3300012987|Ga0164307_10907161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 710 | Open in IMG/M |
| 3300012988|Ga0164306_11098312 | Not Available | 661 | Open in IMG/M |
| 3300012989|Ga0164305_11754540 | Not Available | 559 | Open in IMG/M |
| 3300013296|Ga0157374_11824185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 634 | Open in IMG/M |
| 3300014157|Ga0134078_10210608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 797 | Open in IMG/M |
| 3300014745|Ga0157377_10427537 | Not Available | 909 | Open in IMG/M |
| 3300017955|Ga0187817_11106404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 508 | Open in IMG/M |
| 3300018081|Ga0184625_10602568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 538 | Open in IMG/M |
| 3300018089|Ga0187774_10376932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 855 | Open in IMG/M |
| 3300018429|Ga0190272_10935465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 818 | Open in IMG/M |
| 3300020006|Ga0193735_1160643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 573 | Open in IMG/M |
| 3300020581|Ga0210399_11460445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300021073|Ga0210378_10062208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1467 | Open in IMG/M |
| 3300021478|Ga0210402_10954595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 784 | Open in IMG/M |
| 3300021560|Ga0126371_12682108 | Not Available | 604 | Open in IMG/M |
| 3300021560|Ga0126371_13675813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300022756|Ga0222622_10542337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 835 | Open in IMG/M |
| 3300025315|Ga0207697_10462618 | Not Available | 562 | Open in IMG/M |
| 3300025473|Ga0208190_1120049 | Not Available | 507 | Open in IMG/M |
| 3300025904|Ga0207647_10773366 | Not Available | 518 | Open in IMG/M |
| 3300025906|Ga0207699_10168598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1463 | Open in IMG/M |
| 3300025915|Ga0207693_10745554 | Not Available | 757 | Open in IMG/M |
| 3300025918|Ga0207662_10723560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
| 3300025921|Ga0207652_10567362 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300025922|Ga0207646_10123885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2323 | Open in IMG/M |
| 3300025927|Ga0207687_10409578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1117 | Open in IMG/M |
| 3300025928|Ga0207700_10054824 | All Organisms → cellular organisms → Bacteria | 2994 | Open in IMG/M |
| 3300025928|Ga0207700_11841169 | Not Available | 531 | Open in IMG/M |
| 3300025945|Ga0207679_11512991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 615 | Open in IMG/M |
| 3300026078|Ga0207702_12438340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 510 | Open in IMG/M |
| 3300026498|Ga0257156_1051224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 849 | Open in IMG/M |
| 3300026540|Ga0209376_1293359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| 3300026547|Ga0209156_10223135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 889 | Open in IMG/M |
| 3300027775|Ga0209177_10018963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1674 | Open in IMG/M |
| 3300027857|Ga0209166_10045568 | All Organisms → cellular organisms → Bacteria | 2587 | Open in IMG/M |
| 3300028563|Ga0265319_1124527 | Not Available | 802 | Open in IMG/M |
| 3300028563|Ga0265319_1180142 | Not Available | 651 | Open in IMG/M |
| 3300028712|Ga0307285_10115365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 718 | Open in IMG/M |
| 3300028800|Ga0265338_10752736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 670 | Open in IMG/M |
| 3300028828|Ga0307312_10826542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 614 | Open in IMG/M |
| 3300028884|Ga0307308_10262931 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300031448|Ga0272438_1248823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 705 | Open in IMG/M |
| 3300031450|Ga0272433_10414738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 588 | Open in IMG/M |
| 3300031640|Ga0318555_10322685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 836 | Open in IMG/M |
| 3300031719|Ga0306917_11009669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 649 | Open in IMG/M |
| 3300031720|Ga0307469_11201212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 717 | Open in IMG/M |
| 3300031723|Ga0318493_10042526 | Not Available | 2118 | Open in IMG/M |
| 3300031726|Ga0302321_102514333 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300031744|Ga0306918_10069579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2410 | Open in IMG/M |
| 3300031748|Ga0318492_10620708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 577 | Open in IMG/M |
| 3300031751|Ga0318494_10314128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 905 | Open in IMG/M |
| 3300031751|Ga0318494_10568097 | Not Available | 662 | Open in IMG/M |
| 3300031763|Ga0318537_10123577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 962 | Open in IMG/M |
| 3300031765|Ga0318554_10457310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 723 | Open in IMG/M |
| 3300031897|Ga0318520_10877813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 564 | Open in IMG/M |
| 3300031941|Ga0310912_11089930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 610 | Open in IMG/M |
| 3300031954|Ga0306926_12215772 | Not Available | 611 | Open in IMG/M |
| 3300032008|Ga0318562_10855388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 520 | Open in IMG/M |
| 3300032041|Ga0318549_10435346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 591 | Open in IMG/M |
| 3300032042|Ga0318545_10101532 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300032063|Ga0318504_10255893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 825 | Open in IMG/M |
| 3300032064|Ga0318510_10137555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 956 | Open in IMG/M |
| 3300032065|Ga0318513_10106961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1313 | Open in IMG/M |
| 3300032090|Ga0318518_10047083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2038 | Open in IMG/M |
| 3300032180|Ga0307471_102625638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 638 | Open in IMG/M |
| 3300033475|Ga0310811_10354345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1643 | Open in IMG/M |
| 3300033502|Ga0326731_1087612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
| 3300033550|Ga0247829_10749012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 813 | Open in IMG/M |
| 3300033758|Ga0314868_016742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 769 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.16% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.16% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.44% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.44% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.44% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.44% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 1.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.44% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.72% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.72% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.72% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.72% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.72% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.72% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.72% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.72% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031448 | Rock endolithic microbial communities from Victoria Land, Antarctica - Knobhead nord | Environmental | Open in IMG/M |
| 3300031450 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sud | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4PV_03438230 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | NDLVDAHSAKVEGFKVSKATLNLDTFGHGYRTIWFT |
| INPhiseqgaiiFebDRAFT_1011627902 | 3300000364 | Soil | PFFGDLIDGYSDQVKGLKPSKGTLNLDSFGHGFRTIWFG* |
| Ga0062594_1015408561 | 3300005093 | Soil | GYIIPFFRDLLDGYAANVKGLSPSKGTQNLDSYGHGFRTIWFD* |
| Ga0062594_1030741952 | 3300005093 | Soil | YIIPFFNDLVDAYSSKVQGFKPSKGTLNLDSFGNGYTTIWFA* |
| Ga0066685_103802792 | 3300005180 | Soil | MFNNLVDAYSTKVAGFNQGSKATLNLDSFGHGYRNIWFA* |
| Ga0066675_106552572 | 3300005187 | Soil | QQTEYNAGGYIVPCFGGLIDGYSAKVKGLKPSKGTLNLDSFGNGYRSIWFA* |
| Ga0066388_1029285482 | 3300005332 | Tropical Forest Soil | IPFFGGLIDGYATKVKGLVPSKGTLNLDSFGHGYRTIWFG* |
| Ga0066388_1057123192 | 3300005332 | Tropical Forest Soil | IPFFGGLIDGYATKVKGLVPSKGTLNLDSFGHGYRTIWFA* |
| Ga0066388_1077862301 | 3300005332 | Tropical Forest Soil | YIIPFFGGLIDAYAANVKGLKPSKGTLNLDSFGHGFRTIWFG* |
| Ga0066388_1084438131 | 3300005332 | Tropical Forest Soil | EYDIGGYIIPYFNALIDGYASNVKGLSPSKGTLNLASFGHGYRTIWFA* |
| Ga0070682_1005224511 | 3300005337 | Corn Rhizosphere | FFNNLVDSYSTKVSGFVPGKSTQNLDSFGHGYRTIWFNA* |
| Ga0068868_1017281412 | 3300005338 | Miscanthus Rhizosphere | EYDIGGYIIPYFNALIDGYGSNVKGLSPSKGTLNLASFGHGFRTIWFA* |
| Ga0070714_1010541222 | 3300005435 | Agricultural Soil | IIPFFNNLVDSYSSKVSGFVPGKSTQNLDSFGHGYRTIWFNA* |
| Ga0070714_1021334122 | 3300005435 | Agricultural Soil | QGGYIIPMFNNLVDAYSTKVGGFNNGSKATLNLDSFGHGYRSIYFTA* |
| Ga0070713_1019580131 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | NVGGYIIPCFGGLIDGYSTKVKGLKPNKGTLNLNYFGYGYRTIWFA* |
| Ga0070711_1005984241 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | YIIPFFNNLVDSYSTKVSGFVPGKSTQNLDSFGHGYRTIWFS* |
| Ga0066689_105589501 | 3300005447 | Soil | QGGYIIPMFNNLVDAYATKVGGFNNGSKATLNLDSFGHGYRSIYFTA* |
| Ga0070685_104076322 | 3300005466 | Switchgrass Rhizosphere | IPFFNNLVDSFNSKVKGFEAGRGTLNLDAFGHGFRTIWFES* |
| Ga0070706_1020581722 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | IPFFGGLIDGYSTRVQGLKPSKGTLNLDSFGHGYRTIWFG* |
| Ga0070699_1000959294 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MFNNLVDAYSTKVGGLNNGSKATLNLDSFGHGYRSIYFTA* |
| Ga0066697_104284111 | 3300005540 | Soil | IAIEHEMQQTEYNAGGYIVPCFGGLIDGYSAKVKGLKPSKGTLNLDSFGNGYRSIWFA* |
| Ga0070672_1009034531 | 3300005543 | Miscanthus Rhizosphere | NQGGYIIPFFNNLIDAYSAKVTGFQPNRGTLNLDSFGRGYTAISFA* |
| Ga0066661_107080982 | 3300005554 | Soil | VDAYSTKVAGFNQGSKATLNLDSFGHGFRNIWFA* |
| Ga0066654_106690731 | 3300005587 | Soil | NLLDAYSSKVVGFQPGKGTLNLDAFGHGFRTISFA* |
| Ga0068856_1004977683 | 3300005614 | Corn Rhizosphere | IPFFNNLVDSYSSKVSGFIPGKSTQNLDSFGHGYRTIWFNA* |
| Ga0068859_1012880522 | 3300005617 | Switchgrass Rhizosphere | YDLGGYIIPFFRDLLDGYAANVKGLSPSKGTQNLDSYGHGFRTIWFD* |
| Ga0068864_1020051652 | 3300005618 | Switchgrass Rhizosphere | PFFNNLIDAYSAKVTGFQPNRGTLNLDSFGRGYTAISFA* |
| Ga0066905_1019286342 | 3300005713 | Tropical Forest Soil | IIPFFNNLIDGYAANVAGLEPSKGTLNLDSFGRGFRTIGFSS* |
| Ga0068861_1011336861 | 3300005719 | Switchgrass Rhizosphere | YIIPFFNNLVDSFNSKVKGFEAGRGTLNLDAFGHGFRTIWFES* |
| Ga0066903_1074770801 | 3300005764 | Tropical Forest Soil | DLIDGYSNRVQGLKPSKGTLNLDSFGHGFRTIWFG* |
| Ga0066903_1081030292 | 3300005764 | Tropical Forest Soil | FGGLIDGYSTKVKGLKPSKGTLNLDSFGHGYRTIWFG* |
| Ga0075278_10742871 | 3300005893 | Rice Paddy Soil | FFNNLVDAHSSKVEGFKVSKATLNLDTFGHGFRTIWFA* |
| Ga0070717_112930251 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GYIIPFFNNLVDGYSSRIKGFQVTKATQNLDSFAHGYRTIWFS* |
| Ga0066652_1014060231 | 3300006046 | Soil | FGGLIDGYSTRVKGLKPSKGTLNLDSFGHGYRTIWFG* |
| Ga0075026_1001490892 | 3300006057 | Watersheds | FQDLVDAYTRRVSGFMAGKGTLNLDSFGHGFRTIWFG* |
| Ga0070716_1013385771 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VDSYSNKVSGFVPGKSTQNLDSFGHGYRTIWFNA* |
| Ga0070712_1003621883 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EYNYGGYIIPFFNDLVDAYSSKVAGFEPSKGTLNLTSFGNGYTTIWFT* |
| Ga0097621_1022994292 | 3300006237 | Miscanthus Rhizosphere | IIPFFNNLVDSYSTKVSGFVPGKSTQNLDSFGHGYRTIWFS* |
| Ga0066660_109421672 | 3300006800 | Soil | DIVHEMQTIEYIYGGYVIPFFNDLVDSYSTKVAGFKPSKATLNLDSFGHGYRTIWFT* |
| Ga0074063_141030641 | 3300006953 | Soil | YFGALIDGHSSKVQGLVPSKGTLNLDGFGHGYRTIWFA* |
| Ga0075435_1007326811 | 3300007076 | Populus Rhizosphere | EYNIGGYIIPFFGDLIDGYSSRVKGLKPSKGTLNLDSFGHGFRSIYFG* |
| Ga0105251_105976741 | 3300009011 | Switchgrass Rhizosphere | IIPFFNDLVDAYSSKVQGFKPSKGTLNLDSFGNGYTTIWFA* |
| Ga0105245_128079361 | 3300009098 | Miscanthus Rhizosphere | LLDGYAANVKGLSPSKGTQNLDSYGHGFRTIWFD* |
| Ga0127503_112957892 | 3300010154 | Soil | DLIDGYAANVKGLKPSKGTLNLDSFGHGFRSIWFG* |
| Ga0134070_100829371 | 3300010301 | Grasslands Soil | IIPCFGGLIDGYSTKVKGLVPSKGTLNLDSFGHGFRTIWFA* |
| Ga0126376_108783121 | 3300010359 | Tropical Forest Soil | LIDGYSAKVKGLKPSKGTLNLDSFGHGFRTIWFG* |
| Ga0126376_109058441 | 3300010359 | Tropical Forest Soil | IPFFGGLIDAYAANVKGLKPSKGTLNLDSFGHGFRTIWFG* |
| Ga0126378_127794442 | 3300010361 | Tropical Forest Soil | FNDLIDGYAANVQGLKPSKGTLNLDSFGHGYRTIWFS* |
| Ga0126381_1013098111 | 3300010376 | Tropical Forest Soil | FNDLIDGYSSKVKGLKPSKGTLNLDSFGHGFRTIWFG* |
| Ga0126381_1040593812 | 3300010376 | Tropical Forest Soil | FGGLIDGYSTKVKGLKPSKGTLNLDSFGHGFRTIWFS* |
| Ga0126381_1040738662 | 3300010376 | Tropical Forest Soil | GGLIDAYAANVKGLKPSKGTLNLDSFGHGFRTIWFG* |
| Ga0126381_1043648392 | 3300010376 | Tropical Forest Soil | GYIIPCFGGLIDGYATKVKGLKPSKGTLNLDSFGHGFRTIWFG* |
| Ga0126381_1045890071 | 3300010376 | Tropical Forest Soil | IIPFFGDLIDGYSDKVKGLRPSKGTLNLDSFGHGFRTIWLG* |
| Ga0126383_136037622 | 3300010398 | Tropical Forest Soil | IPFFNDLVDAYSKKVNGFVASKGTLNLDSFGHGFRTIWFS* |
| Ga0126350_116238431 | 3300010880 | Boreal Forest Soil | LEYDIGGYVIPFFNDLVDGYSSQVKGLLPSKGTLNLDGFGHGYRTIWFG* |
| Ga0137392_106530721 | 3300011269 | Vadose Zone Soil | PFFGGLIDGYSVRVQGLKPSKGTLNLDSFGHGYRTIWFG* |
| Ga0136618_104011722 | 3300012188 | Polar Desert Sand | KLEYEYGGYIIPFFGSLIDGYSPEVQGFSPSRGTLNLASYGHGYRTIWFG* |
| Ga0137383_105088121 | 3300012199 | Vadose Zone Soil | IPFFGGLIDGYSAKVKGFKPSKGTLNLDSFGHGYRTIWFG* |
| Ga0137365_110154642 | 3300012201 | Vadose Zone Soil | FFGGLIDGYSDKVKGFKPSKGTLNLDSFGHGYRTIWFG* |
| Ga0137377_114639531 | 3300012211 | Vadose Zone Soil | IPFFGGLIDAYSTRVKGLKPSKGTLNLDSFGHGYRTIWFG* |
| Ga0137386_103882132 | 3300012351 | Vadose Zone Soil | FGGLIDAYSTRVKGLKPSKGTLNLDSFGHGFRTIWFG* |
| Ga0137385_101974381 | 3300012359 | Vadose Zone Soil | IPCFGGLIDGYTAKVKGLKPSKGTLNLDSFGHGYRTIWFG* |
| Ga0137375_112401911 | 3300012360 | Vadose Zone Soil | YIIPFFGNLIDGYAANVAGLSPSKGTLNLAGFGQGYRTIWFS* |
| Ga0137361_115324102 | 3300012362 | Vadose Zone Soil | IIPFFGGLIDGYSTRVMGLKPSKGTLNLDSFGHGYRTIWFG* |
| Ga0137390_112657652 | 3300012363 | Vadose Zone Soil | GYIIPFFNDLVDGYSRQVKGLQPSKGTLNLDSFGHGYRTIWFG* |
| Ga0137358_109671881 | 3300012582 | Vadose Zone Soil | NVGGYIIPCFGGLIDGYTAKVKGLKPSKGTLNLDSFGHGYRTIWFG* |
| Ga0164298_100644683 | 3300012955 | Soil | YIIPFFNDLVDAYSSKVQGFQPSKGTLNLDSFGNGYTTIWFG* |
| Ga0164298_102376332 | 3300012955 | Soil | FFNNLIDAYSSKVTGFVPSKGTLNLDAFGHGYRTIWFA* |
| Ga0126369_107625172 | 3300012971 | Tropical Forest Soil | IPFFGGLIDGYAANVKGLKPSKGTLNLDSFGHGFRTIWFS* |
| Ga0126369_129910801 | 3300012971 | Tropical Forest Soil | PFFGGLIDGYAANVKGLKPSKGTLNLDSFGHGFRSIWFG* |
| Ga0164307_109071611 | 3300012987 | Soil | IIPFFNDLVDAYSSKVQGFQPSKGTLNLDSFGNGYTTIWFG* |
| Ga0164306_110983122 | 3300012988 | Soil | GGLIDGYSTKVKGLKPSKGTLNLDSFGHGYRTIWFG* |
| Ga0164305_117545401 | 3300012989 | Soil | PFFNNLVDSYSTKVTGFKVGKAPQNLDSFGHGYRTIWFT* |
| Ga0157374_118241851 | 3300013296 | Miscanthus Rhizosphere | IIPFFGNLIDGYSSKVQGLAPSKGTLNLDSFGHGFRTIWFA* |
| Ga0134078_102106081 | 3300014157 | Grasslands Soil | EYNAGGYIVPCFGGLIDGYSAKVKGLKPSKGTLNLDSFGNGYRSIWFA* |
| Ga0157377_104275371 | 3300014745 | Miscanthus Rhizosphere | LVDSFNSKVKGFEAGRGTLNLDAFGHGFRTIWFES* |
| Ga0187817_111064042 | 3300017955 | Freshwater Sediment | MLEYDIGGYIIPFFNDLIDGYADSFKGLRPSKGTLNLDSFGHGYRTIWFG |
| Ga0184625_106025682 | 3300018081 | Groundwater Sediment | FFGNLLDGYAANVAGFVPSKGTLNLDSFGHGFRTIWFT |
| Ga0187774_103769322 | 3300018089 | Tropical Peatland | YIIPYFNDLIDGYAANVKGLKPSKGTLNLDSFGHGYRTIWFS |
| Ga0190272_109354652 | 3300018429 | Soil | SRIEIQHEMQQLEYDLGGYIIPYFGSLIDGYSAKLAGLSPSKGTLNLAGFGHGFRTIWFA |
| Ga0193735_11606432 | 3300020006 | Soil | PFFNDLVDAYSTKVSGFAVSKGTLNLDSFGHGFRTIWFS |
| Ga0210399_114604452 | 3300020581 | Soil | PFFGDLIDGYAANLKGLKPSKGTLNLDSFGHGFRTIWFS |
| Ga0210378_100622081 | 3300021073 | Groundwater Sediment | NLLDGYASNVAGLVPSKGTLNLDTFGHGYRTIWFS |
| Ga0210402_109545951 | 3300021478 | Soil | YDQGGYIIPFFQDLVDAYSKRVSGFIAGKETLSLDSFGHGFRTIWFG |
| Ga0126371_126821082 | 3300021560 | Tropical Forest Soil | FNDLIDGYSDKVKGLRPSKGTLNLDYFGHGFSSIWFG |
| Ga0126371_136758132 | 3300021560 | Tropical Forest Soil | GLIDGYAANVKGLKPSKGTLNLDSFGHGFRTIWFS |
| Ga0222622_105423371 | 3300022756 | Groundwater Sediment | DIGGYIIPFFNNLIDGYGANVAGFSPSKGTLNLASFGHGYRTIWFSS |
| Ga0207697_104626181 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | FFNDLVDAYSSKVQGFKPSKGTLHLDSFGNGYTTIWFG |
| Ga0208190_11200492 | 3300025473 | Peatland | DLMDAYSSRVAGLNPNKGTLPLDYFGHGFRNIWFT |
| Ga0207647_107733662 | 3300025904 | Corn Rhizosphere | NDLVDAYSTKVQGFEPSKGTLNLTYFGNGYTTIWFA |
| Ga0207699_101685983 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | FGGLIDGYAAKVKGLKPSKGTLNLDSFGHGYRTIWFG |
| Ga0207693_107455542 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | FFNNLVDAYSSKVSGFVQNTRSTQNLNSFGNGFRTIWFT |
| Ga0207662_107235601 | 3300025918 | Switchgrass Rhizosphere | FKNLVDAHSAKVQGFKVSKATLNLDTFGHGYRTIWFT |
| Ga0207652_105673622 | 3300025921 | Corn Rhizosphere | GYVIPFFNNLVDSYSSKVSGFVPGKSTQNLDSFGHGYRTIWFS |
| Ga0207646_101238851 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IPFFGGLIDGYSTKVKGLKPSKGTLNLDSFGHGYRTIWFG |
| Ga0207687_104095781 | 3300025927 | Miscanthus Rhizosphere | IEYNIGGYIIPFFGDLIDGYSSRVKGLKPSKGTLNLDSFGHGFRSIYFG |
| Ga0207700_100548241 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | CFGGLIDGYTAKVKGLKPSKGTLNLDSFGHGYRTIWFG |
| Ga0207700_118411692 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | YIIPFFNDLVDGFSTKVSGFQPSKGTLNLDSFGHGYRTIWFG |
| Ga0207679_115129912 | 3300025945 | Corn Rhizosphere | FNNLIDGYGANVSGFTPSKGTLNLASFGHGFRTIWFND |
| Ga0207702_124383401 | 3300026078 | Corn Rhizosphere | NLIDAYSSKVTGFVPSKGTLNLDAFGHGYRTIWFA |
| Ga0257156_10512241 | 3300026498 | Soil | AEYNAGGYIIPCFGGLIDGYSTKVKGLKPSKGTLNLDSFGHGHRTIWFG |
| Ga0209376_12933591 | 3300026540 | Soil | MFNNLVDAYSTKVAGFNQGSKATLNLDSFGHGYRNIWFA |
| Ga0209156_102231351 | 3300026547 | Soil | QQTEYNAGGYIVPCFGGLIDGYSAKVKGLKPSKGTLNLDSFGNGYRSIWFA |
| Ga0209177_100189633 | 3300027775 | Agricultural Soil | FNDLVDSYSTKVAGFKPSKATLNLDSFGHGFRTIWFT |
| Ga0209166_100455684 | 3300027857 | Surface Soil | NDLIDGYSNSVKGLRPSKGTLNLDSFGHGYRTMWFG |
| Ga0265319_11245271 | 3300028563 | Rhizosphere | FFNNLLDAYSAKVAGFQPSKGTLNLDAFGHGYRTIWFA |
| Ga0265319_11801421 | 3300028563 | Rhizosphere | YIIPFFNNLLDAYSAKVAGFQPSKGTLNLDAFGHGYRTIWFA |
| Ga0307285_101153652 | 3300028712 | Soil | EYDIGGYIIPFFNNLIDGYGANVAGFSPSKGTLNLASFGHGYRTIWFSS |
| Ga0265338_107527361 | 3300028800 | Rhizosphere | PFFNNLLDAYSAKVAGFQPSKGTLNLDAFGHGYRTIWFA |
| Ga0307312_108265421 | 3300028828 | Soil | GLIDGYTAKVKGLKPSKGTLNLDSFGHGYRTIWFG |
| Ga0307308_102629311 | 3300028884 | Soil | YIIPFFNNLLDAYSAKVTGFVPSKGTLNLDAFGHGYRTIWFA |
| Ga0272438_12488231 | 3300031448 | Rock | GGYVIPFYGDLVDAASSKIKGLVPSKGTLNLDGYGRGYRTIWFG |
| Ga0272433_104147382 | 3300031450 | Rock | FGSLVDGYAANVAGLSPSKGTLNLASYGHGYRTIWFS |
| Ga0318555_103226852 | 3300031640 | Soil | MQQAEYNVGGYIIPCFGGLIDGYAANVKGLKPSKGTLNLDSFGHGYRTIWFS |
| Ga0306917_110096691 | 3300031719 | Soil | GYIIPCFGGLIDGYSTKVKGLKPSKGTLNLDSFGHGYRTIWFG |
| Ga0307469_112012122 | 3300031720 | Hardwood Forest Soil | IIPFFNDLVDAYSSKVAGFEPSKGTLNLTSFGNGYTTIWFT |
| Ga0318493_100425261 | 3300031723 | Soil | GGLIDGYSTKVKGLKPSKGTLNLDSFGHGYRTIWFG |
| Ga0302321_1025143331 | 3300031726 | Fen | TGGYIIPFNNNLIDAYSSKVTGFQKNRGTLNLDSFGRNYADVSFA |
| Ga0306918_100695794 | 3300031744 | Soil | GLIDGYSTKVKGLKPSKGTLNLDSFGHGYRTIWFG |
| Ga0318492_106207082 | 3300031748 | Soil | GYIIPCFGGLIDGYAAKVKGLKPSKGTLNLDSFGHGYRTIWFG |
| Ga0318494_103141282 | 3300031751 | Soil | FGGLIDGYSAKVKGLVPSKGTLNLDSFGHGFRTIWFG |
| Ga0318494_105680971 | 3300031751 | Soil | FGGLIDAYAANVKGLKPSKGTLNLDSFGHGYRTIWFG |
| Ga0318537_101235771 | 3300031763 | Soil | IIPCFGGLIDGYSTKVKGLKPSKGTLNLDSFGHGYRTIWFA |
| Ga0318554_104573101 | 3300031765 | Soil | IIPFFGGLIDGYSAKVKGLVPSKGTLNLDSFGHGFRTIWFG |
| Ga0318520_108778132 | 3300031897 | Soil | IPCFGGLIDGYSTKVKGLKPSKGTLNLDSFGHGFRTIWFG |
| Ga0310912_110899301 | 3300031941 | Soil | AEYNVGGYIIPCFGGLIDGYAANVKGLKPSKGTLNLDSFGHGFRTIWFS |
| Ga0306926_122157721 | 3300031954 | Soil | GLIDGYAANVKGLKPSKGTLNLDSFGHGYRTIWFG |
| Ga0318562_108553882 | 3300032008 | Soil | GGLIDGYAANVKGLKPSKGTLNLDSFGHGFRTIWFS |
| Ga0318549_104353462 | 3300032041 | Soil | IPFFGGLIDAYAANVKGLKPSKGTLNLDSFGHGYRTIWFG |
| Ga0318545_101015321 | 3300032042 | Soil | PFFGGLIDGYAANVKGLKPSKGTLNLDSFGHGFRTIWFG |
| Ga0318504_102558931 | 3300032063 | Soil | IPFFGGLIDGYSAKVKGLKPSKGTLNLDSFGHGFRTIWFG |
| Ga0318510_101375551 | 3300032064 | Soil | NVGGYIIPCFGGLIDGYAANVKGLKPSKGTLNLDSFGHGFRTIWFS |
| Ga0318513_101069611 | 3300032065 | Soil | FFGGLLDGYAASVKGLKPSKGTLNLDSFGHGFRTIWFG |
| Ga0318518_100470831 | 3300032090 | Soil | EYNVGGYIIPCFGGLIDGYAAKVKGLKPSKGTLNLDSFGHGYRTIWFG |
| Ga0307471_1026256381 | 3300032180 | Hardwood Forest Soil | IIPFFNDLVDAYSSKVSGFKASKGTLNLDSFGHGFRTIWFG |
| Ga0310811_103543453 | 3300033475 | Soil | PFFGGLIDGYAAKVKGLKPSKGTLNLDSFGHGYRTIWFG |
| Ga0326731_10876122 | 3300033502 | Peat Soil | NLVDAHSAKVEGFKVSKATLNLDTFGHGYRTIWFA |
| Ga0247829_107490121 | 3300033550 | Soil | DLGGYIIPFFRDLLDGYAANVKGLSPSKGTQNLDSYGHGFRTIWFD |
| Ga0314868_016742_3_113 | 3300033758 | Peatland | GNLLDGYGANVNGLLPSKGTLNLDTFGHGYRNIWFS |
| ⦗Top⦘ |