NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F055108

Metagenome Family F055108

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055108
Family Type Metagenome
Number of Sequences 139
Average Sequence Length 44 residues
Representative Sequence MAKQLNPGDLFPDYTVSTTDGRTLNIPADLNGEYAVIIFYRGIW
Number of Associated Samples 128
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 75.00 %
% of genes near scaffold ends (potentially truncated) 26.62 %
% of genes from short scaffolds (< 2000 bps) 71.94 %
Associated GOLD sequencing projects 123
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.122 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(10.791 % of family members)
Environment Ontology (ENVO) Unclassified
(32.374 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(21.583 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 11.11%    Coil/Unstructured: 88.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF04909Amidohydro_2 38.13
PF00578AhpC-TSA 20.86
PF01212Beta_elim_lyase 13.67
PF03070TENA_THI-4 2.16
PF04519Bactofilin 2.16
PF13382Adenine_deam_C 1.44
PF00696AA_kinase 0.72
PF00005ABC_tran 0.72
PF01547SBP_bac_1 0.72
PF00890FAD_binding_2 0.72
PF06808DctM 0.72
PF00893Multi_Drug_Res 0.72
PF14518Haem_oxygenas_2 0.72
PF01979Amidohydro_1 0.72
PF00570HRDC 0.72
PF09084NMT1 0.72
PF13531SBP_bac_11 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG1167DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domainTranscription [K] 27.34
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 13.67
COG4992Acetylornithine/succinyldiaminopimelate/putrescine aminotransferaseAmino acid transport and metabolism [E] 13.67
COG3033TryptophanaseAmino acid transport and metabolism [E] 13.67
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 13.67
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 13.67
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 13.67
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 13.67
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 13.67
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 13.67
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 13.67
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 13.67
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 13.67
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 13.67
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 13.67
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 13.67
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 13.67
COG1664Cytoskeletal protein CcmA, bactofilin familyCytoskeleton [Z] 2.16
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.72
COG2076Multidrug transporter EmrE and related cation transportersDefense mechanisms [V] 0.72
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.72

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.12 %
UnclassifiedrootN/A2.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918013|NODE_3448_length_2240_cov_12.970535All Organisms → cellular organisms → Bacteria2272Open in IMG/M
2140918013|NODE_7579_length_2083_cov_7.912626All Organisms → cellular organisms → Bacteria2115Open in IMG/M
2228664022|INPgaii200_c1059471All Organisms → cellular organisms → Bacteria2076Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_13256422All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104370160All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300000787|JGI11643J11755_11481412All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300000956|JGI10216J12902_101593037All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300000956|JGI10216J12902_111485280All Organisms → cellular organisms → Bacteria2192Open in IMG/M
3300003319|soilL2_10167547All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300003987|Ga0055471_10068929All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300003993|Ga0055468_10000683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes3703Open in IMG/M
3300003993|Ga0055468_10062061All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300004057|Ga0055496_10159677All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300004070|Ga0055488_10065470All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300004114|Ga0062593_101993116All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300004282|Ga0066599_101132579All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300004463|Ga0063356_100331594All Organisms → cellular organisms → Bacteria1909Open in IMG/M
3300004463|Ga0063356_100484816All Organisms → cellular organisms → Bacteria1628Open in IMG/M
3300004480|Ga0062592_100024523All Organisms → cellular organisms → Bacteria2840Open in IMG/M
3300004778|Ga0062383_10702182All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300004779|Ga0062380_10094947All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300005289|Ga0065704_10527888All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300005294|Ga0065705_10246725All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300005467|Ga0070706_100560437All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300005518|Ga0070699_101004978All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300005526|Ga0073909_10504492All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300005554|Ga0066661_10551580All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300005557|Ga0066704_10561872All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300005713|Ga0066905_101712939All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300005836|Ga0074470_10303029All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria5694Open in IMG/M
3300005895|Ga0075277_1011882All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300005937|Ga0081455_10051475All Organisms → cellular organisms → Bacteria3532Open in IMG/M
3300006173|Ga0070716_101475381All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300006846|Ga0075430_101813777All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300006847|Ga0075431_102027961All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300006852|Ga0075433_11439741All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300006865|Ga0073934_10099877All Organisms → cellular organisms → Bacteria2214Open in IMG/M
3300007004|Ga0079218_10092420All Organisms → cellular organisms → Bacteria2050Open in IMG/M
3300009012|Ga0066710_102202495All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300009012|Ga0066710_103065246All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium648Open in IMG/M
3300009053|Ga0105095_10432523All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium727Open in IMG/M
3300009078|Ga0105106_10608883All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium783Open in IMG/M
3300009087|Ga0105107_11247312All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium519Open in IMG/M
3300009167|Ga0113563_10524914All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300009506|Ga0118657_10149970All Organisms → cellular organisms → Bacteria3328Open in IMG/M
3300009609|Ga0105347_1009500All Organisms → cellular organisms → Bacteria3365Open in IMG/M
3300009836|Ga0105068_1008946All Organisms → cellular organisms → Bacteria1605Open in IMG/M
3300010046|Ga0126384_11106971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi726Open in IMG/M
3300010304|Ga0134088_10079483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1530Open in IMG/M
3300010391|Ga0136847_10878946All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1027Open in IMG/M
3300010413|Ga0136851_11311991All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300011413|Ga0137333_1046228All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300011443|Ga0137457_1298470All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300012041|Ga0137430_1046840All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1167Open in IMG/M
3300012174|Ga0137338_1008496All Organisms → cellular organisms → Bacteria1867Open in IMG/M
3300012204|Ga0137374_10014587All Organisms → cellular organisms → Bacteria9091Open in IMG/M
3300012207|Ga0137381_10708833All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium875Open in IMG/M
3300012226|Ga0137447_1053674All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium734Open in IMG/M
3300012285|Ga0137370_10063884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2003Open in IMG/M
3300012349|Ga0137387_10616430All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300012355|Ga0137369_11154850All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300012582|Ga0137358_10248127All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300012685|Ga0137397_10894732All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria658Open in IMG/M
3300012891|Ga0157305_10225822All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300012929|Ga0137404_10282440All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1435Open in IMG/M
3300012930|Ga0137407_10137290All Organisms → cellular organisms → Bacteria2145Open in IMG/M
3300012931|Ga0153915_10789401All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1100Open in IMG/M
3300014272|Ga0075327_1232360All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium597Open in IMG/M
3300014296|Ga0075344_1126160All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300014300|Ga0075321_1150226All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300014307|Ga0075304_1022162All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1302Open in IMG/M
3300014877|Ga0180074_1015531All Organisms → cellular organisms → Bacteria1439Open in IMG/M
3300014877|Ga0180074_1125997All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300014882|Ga0180069_1050744All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium933Open in IMG/M
3300014883|Ga0180086_1181286All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium547Open in IMG/M
3300015245|Ga0137409_11014555All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium667Open in IMG/M
3300017930|Ga0187825_10003639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5033Open in IMG/M
3300017944|Ga0187786_10169761All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300017997|Ga0184610_1228676All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium620Open in IMG/M
3300018052|Ga0184638_1254458All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300018056|Ga0184623_10178694All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium979Open in IMG/M
3300018059|Ga0184615_10073582All Organisms → cellular organisms → Bacteria1911Open in IMG/M
3300018068|Ga0184636_1184854All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium737Open in IMG/M
3300018075|Ga0184632_10001006All Organisms → cellular organisms → Bacteria11387Open in IMG/M
3300018083|Ga0184628_10001342All Organisms → cellular organisms → Bacteria → Proteobacteria12165Open in IMG/M
3300018422|Ga0190265_10498288All Organisms → cellular organisms → Bacteria1330Open in IMG/M
3300018422|Ga0190265_10698706All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1136Open in IMG/M
3300018422|Ga0190265_13782104All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300018466|Ga0190268_11622162All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium571Open in IMG/M
3300018481|Ga0190271_10193218All Organisms → cellular organisms → Bacteria2018Open in IMG/M
3300019487|Ga0187893_10001191All Organisms → cellular organisms → Bacteria64426Open in IMG/M
3300020003|Ga0193739_1084387All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300020060|Ga0193717_1019544All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2923Open in IMG/M
3300020186|Ga0163153_10032224All Organisms → cellular organisms → Bacteria → Proteobacteria3915Open in IMG/M
3300020193|Ga0194131_10000364All Organisms → cellular organisms → Bacteria75497Open in IMG/M
3300020197|Ga0194128_10066309All Organisms → cellular organisms → Bacteria2465Open in IMG/M
3300020200|Ga0194121_10650021All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300022209|Ga0224497_10051009All Organisms → cellular organisms → Bacteria1788Open in IMG/M
3300025155|Ga0209320_10002917All Organisms → cellular organisms → Bacteria8615Open in IMG/M
3300025324|Ga0209640_10457273All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1046Open in IMG/M
3300025925|Ga0207650_11584345All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300025988|Ga0208141_1004454All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1103Open in IMG/M
3300026320|Ga0209131_1068756All Organisms → cellular organisms → Bacteria → Proteobacteria1941Open in IMG/M
3300026535|Ga0256867_10001916All Organisms → cellular organisms → Bacteria8878Open in IMG/M
3300027056|Ga0209879_1031783All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300027665|Ga0209983_1022286All Organisms → cellular organisms → Bacteria1327Open in IMG/M
3300027722|Ga0209819_10220737All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium659Open in IMG/M
3300027778|Ga0209464_10076521All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300027815|Ga0209726_10049000All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2966Open in IMG/M
3300027831|Ga0209797_10096394All Organisms → cellular organisms → Bacteria1292Open in IMG/M
3300027917|Ga0209536_100017741All Organisms → cellular organisms → Bacteria10060Open in IMG/M
3300030006|Ga0299907_10020461All Organisms → cellular organisms → Bacteria4970Open in IMG/M
3300030006|Ga0299907_10078948All Organisms → cellular organisms → Bacteria2673Open in IMG/M
3300030006|Ga0299907_11057692All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium592Open in IMG/M
3300030619|Ga0268386_10133593All Organisms → cellular organisms → Bacteria1900Open in IMG/M
3300030620|Ga0302046_10176585All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1754Open in IMG/M
3300031228|Ga0299914_10651000All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300031538|Ga0310888_10819514All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium577Open in IMG/M
3300031562|Ga0310886_11070576All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium519Open in IMG/M
3300031820|Ga0307473_10008638All Organisms → cellular organisms → Bacteria3554Open in IMG/M
3300031824|Ga0307413_10904062All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300031852|Ga0307410_10763931All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium819Open in IMG/M
3300031858|Ga0310892_11148686All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300031911|Ga0307412_10045680All Organisms → cellular organisms → Bacteria2865Open in IMG/M
3300031965|Ga0326597_10280656All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1905Open in IMG/M
3300032013|Ga0310906_10187214All Organisms → cellular organisms → Bacteria1244Open in IMG/M
3300032075|Ga0310890_10109537Not Available1751Open in IMG/M
3300032075|Ga0310890_10364812All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300032163|Ga0315281_10385834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1512Open in IMG/M
3300032770|Ga0335085_10265418All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2054Open in IMG/M
3300032829|Ga0335070_10160888All Organisms → cellular organisms → Bacteria2272Open in IMG/M
3300033414|Ga0316619_10853841All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300033480|Ga0316620_10027566All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3538Open in IMG/M
3300034115|Ga0364945_0004434All Organisms → cellular organisms → Bacteria3728Open in IMG/M
3300034147|Ga0364925_0036160All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1639Open in IMG/M
3300034176|Ga0364931_0031550All Organisms → cellular organisms → Bacteria1551Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.79%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil7.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.19%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.32%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.60%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.88%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.88%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.16%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.16%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.16%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.16%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.16%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.16%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.44%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.44%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.44%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.72%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.72%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.72%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.72%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.72%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.72%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.72%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.72%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.72%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.72%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.72%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.72%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.72%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.72%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.72%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.72%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.72%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.72%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918013Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)EnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300004057Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2EnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005895Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009836Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010413Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9EnvironmentalOpen in IMG/M
3300011406Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2EnvironmentalOpen in IMG/M
3300011413Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012174Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014296Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300014300Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1EnvironmentalOpen in IMG/M
3300014307Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1EnvironmentalOpen in IMG/M
3300014877Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10DEnvironmentalOpen in IMG/M
3300014882Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018068Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020186Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1EnvironmentalOpen in IMG/M
3300020193Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120mEnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300020200Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50mEnvironmentalOpen in IMG/M
3300022209Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_13EnvironmentalOpen in IMG/M
3300025155Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025988Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027056Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Iowa-Corn-GraphCirc_019090402140918013SoilMAKQLGPGDPFPNYNVPTAHGGRLNIPTGFKGEYAVIIFYRGIW
Iowa-Corn-GraphCirc_024898302140918013SoilMTKQLNPGDPFPTFDVNLTDGRSLKLPIDLKGEYAVIIYYRGIW
INPgaii200_105947122228664022SoilMARQLNPGDLFPDYSVQLTDGRTLNIPRELRGEYAVIIFYRGIW
ICChiseqgaiiFebDRAFT_1325642223300000363SoilMAKQLNPGDPFPVFDVNLTDGRTLKLPTDLKGEYAVIIYYRGIW*
INPhiseqgaiiFebDRAFT_10437016033300000364SoilMAKQLNPGDPFPSFNVQLTDGRTLDISSGLKGEYAVIIYYRGIW*
JGI11643J11755_1148141223300000787SoilMTKQLNPGDPFPTFDVNLTDGRSLKLPIDLKGEYAVIIYYRGIW*
JGI10216J12902_10159303713300000956SoilMAKQLNPGDPFPVFDVNLTDGRRLTLPTDLTGEYAVIIYYRGIW*
JGI10216J12902_11148528023300000956SoilMGKQLNPGDSFPVFNVNLTDGRRLDLPKDLPGDYAVIIYYRGTW*
soilL2_1016754733300003319Sugarcane Root And Bulk SoilMAKQLTPGDPFPRFDIKLTDGRTLNLPSGLTGEYAVIIFYRGIW*
Ga0055471_1006892923300003987Natural And Restored WetlandsMAKQLGPGDPFPNYTVPTVNGATLHIPADLNGEYAVIIFYR
Ga0055468_1000068333300003993Natural And Restored WetlandsMARQLNPGDLFPEYRVEVTDGTTLNVPADLRGEYAVIIFYRGIW*
Ga0055468_1006206123300003993Natural And Restored WetlandsMARQLGPNDPFPTYTVSTADGGRMKIPADLEGEYAVIIFYRGVW*
Ga0055496_1015967713300004057Natural And Restored WetlandsMRMAKQLNPGDPFLSFQVNLTNGGTLNLPTDLKAEYAVIIYYRGIW*
Ga0055488_1006547013300004070Natural And Restored WetlandsMARQLNPGDLFPEYRVEVTDGTILNMPWDLRGEYAVIIFYRGIW*
Ga0062593_10199311613300004114SoilMAKQLGPGDPFPNYTVPTVNGATLHIPVDLNGEYAVIIFYRGI
Ga0066599_10113257913300004282FreshwaterMAKQLNPGDVFPAFKVKLTNGQTLDLPKDLTGDYAVIIYYRGIW*
Ga0063356_10033159433300004463Arabidopsis Thaliana RhizosphereMAAQLGPGAPFPSYAVRTVGGGTLAIPAEIEGEYAVIIFYRGIW*
Ga0063356_10048481623300004463Arabidopsis Thaliana RhizosphereMAKQLGPGDPFPNYNVPTAHGGRLNIPTGFKGEYAVIIFYRGIW*
Ga0062592_10002452313300004480SoilMAKQLGPGDPFPNYNVPTADGGRLNIPTGFKGEYAVIIFYRGIW*
Ga0062383_1070218223300004778Wetland SedimentLNPGDAFPEFKVPTVNGPTLSIPNDLTGEYAVIIYYRGIW*
Ga0062380_1009494733300004779Wetland SedimentMTMAKQLNPGDAFPEFKVPTVGGRTLSIPNDLTGEYAVIIYYRGIW*
Ga0065704_1052788823300005289Switchgrass RhizosphereMTMAKQLNPGDQFPNYIVQLADGGTLSIPHDLRGEYAVIIFYRGIW*
Ga0065705_1024672533300005294Switchgrass RhizosphereMAKQLGPGDPFPSYSVQTAFGGTLNIPTDLKGEYAVIIFYRGIW*
Ga0070706_10056043723300005467Corn, Switchgrass And Miscanthus RhizosphereMARQLNPGDLFPDYSVQLTDGRTLNIPRELRGEYAVIIFYRGIW*
Ga0070699_10100497823300005518Corn, Switchgrass And Miscanthus RhizosphereMAKRLNPGDPFPNYLIQVTDGGTLSIPQDLRGEYAVIIFYRCIW*
Ga0073909_1050449233300005526Surface SoilQFPNYTIGTTTGTTLSIPADLAGEYAVILFYRGIW*
Ga0066661_1055158033300005554SoilMAKQLNPGDLFPSYTVQLIDGRTVNIPQELRGECAVIIFYRGIW*
Ga0066704_1056187213300005557SoilMAKQLKPGDSFPTYTVPITDGGTLNIPADLAGEYAVIIF
Ga0066905_10171293913300005713Tropical Forest SoilNPGDQFPNYIVQLAEGGTLSIPQDLRGEYAVIIFYRGIW*
Ga0074470_1030302973300005836Sediment (Intertidal)MAKQLNPGDLFPNFTVNLTDGRTLNIPTDLKGEYAVIIYYRGIW*
Ga0075277_101188233300005895Rice Paddy SoilMAKQLNPGDAFPTYIVPTTEGRTLNIPADLKGEYAVLIFYRGIW*
Ga0081455_1005147543300005937Tabebuia Heterophylla RhizosphereMTMAKQLNPGDQFPNYIVQLADGGTLSIPQDLRGEYAVIIFYRGIW*
Ga0070716_10147538113300006173Corn, Switchgrass And Miscanthus RhizosphereMAKQLGPGDQFPNYTFGTTLGTTLSIPAALMGEYAVIIFYRGVW*
Ga0075430_10181377723300006846Populus RhizosphereNVNSMAKLGPGDPFPNYNVPTADGGRLNIPTGFKGEYAVIIFYRGIW*
Ga0075431_10202796113300006847Populus RhizosphereMAKQLGPGDLFPNYTAPSADGGTLNIPADFKGAYAVIIFYRGIW*
Ga0075433_1143974113300006852Populus RhizosphereMAKQLGPGDAFPNYTVPTADGRTLNIPADLRGEYAVIILYRGVW*
Ga0073934_1009987713300006865Hot Spring SedimentMSKQLTPGAPFPAYTVPTVDGPTLNIPAGLEGECAVVIFYRGVW*
Ga0079218_1009242053300007004Agricultural SoilMAKQLGPGDPFPNYTVPTAEGGTLRIPADFEGEYAVI
Ga0066710_10220249513300009012Grasslands SoilMAKQLKPGDSFPTYTVPITDGGTLNIPADLAAEYAVIIF
Ga0066710_10306524613300009012Grasslands SoilQLNPAASLPTYTVPIRDGGTLNIPADLAGEYAVIIFFRGVW
Ga0105095_1043252323300009053Freshwater SedimentMAKQLGPGDKFPDYTVPTADGGLLRIPADLTGEYAVIIFYRGIW*
Ga0105106_1060888313300009078Freshwater SedimentMAKQLGPGDKFPDYTVPTTDGGILNIPANLKGEYAVIIFYRGVW*
Ga0105107_1124731223300009087Freshwater SedimentMAKQLNPGDAFPEFKVPTVSGSTLSIPNDLTGDYAVIIYYRGIW*
Ga0113563_1052491423300009167Freshwater WetlandsMAKQLNPGDPFPTFTVNLTDGRTLTLPANLQGEYAVIIYYRGIW*
Ga0118657_1014997033300009506Mangrove SedimentMARQLNVGDTFPQYTVSLTDNRTLNIPADLKGEYSVIIFYRGIW*
Ga0105347_100950053300009609SoilMAKQLNPGDAFPEFKVPTVSGTTLSIPNDLKGDYAVIIYYRGIW*
Ga0105068_100894613300009836Groundwater SandKQLNPGDLFPDYTVQLTDGRTVNIPQELRGEYAVIIFYRGIW*
Ga0126384_1110697123300010046Tropical Forest SoilMAKQLTPGDPFPNYTVPTIDERRLNIPADLKGEYAVIIFYRGIW*
Ga0134088_1007948323300010304Grasslands SoilMAKQLGPGDAFPNYTVPTAEGPTLNIPADLRGEYAVIIFYRGVW*
Ga0136847_1087894613300010391Freshwater SedimentGMTMAKQLNPGDNFPNFVVPTTDGRSLNIPADLTGEYAVIIFYRGIW*
Ga0136851_1131199123300010413Mangrove SedimentMARQLNVGDTFPQYAVRLTGNRTLNIPGDLKGEYAVIIYYRGIW*
Ga0137454_109093923300011406SoilMNLIRKKVAIMAKQLNPGEAFPEFKVPTVSGSTLSIPKDLTGDYAVIIYYRGIW*
Ga0137333_104622823300011413SoilMAKQLNPGDLFPDFRVPISDGRTMNIPADLKGDYAVIIFYLGVW*
Ga0137457_129847023300011443SoilMAKQLNPGDAFPEFKVPTVSGSTLSIPNDLKGDYAVIIYYRGIW*
Ga0137430_104684033300012041SoilMDFQMAKQLNPGDPFPHFTVPLTDGRTLNIPTDLKGEYAVIIYYRGIW*
Ga0137338_100849633300012174SoilMAKQLNPGDLFPNFRVPISNGRTMNIPADLKGDYAVIIFYRGVW*
Ga0137374_1001458793300012204Vadose Zone SoilMAKQLGPGDEFPNYTAPTADRRTLNIPADLKGGYAVIIFYRGVW*
Ga0137381_1070883313300012207Vadose Zone SoilSFPTYTVPITDGGTLNIPADLAGEYAVIIFYRGVW*
Ga0137447_105367413300012226SoilPGDAFPAFKVPTVDGQMLSIPTDLKGEYAVIIYYRGVW*
Ga0137370_1006388423300012285Vadose Zone SoilMAKQLNPGDVFPEYIVPTTDGVTLNIPAGLAGDYAVIIFYRGVW*
Ga0137387_1061643013300012349Vadose Zone SoilMAKQLKPGDSFPTYTVPITDGGTLNIPADLAGEYAVII
Ga0137369_1115485013300012355Vadose Zone SoilMAKQLNPGDLFPDYTVRTSDGRKLNIPADLKGEYAVII
Ga0137358_1024812733300012582Vadose Zone SoilMAKQLGPGDQFPNYTIGTTIGTTLSMPADLAGEYAVIIFYRGIW*
Ga0137397_1089473213300012685Vadose Zone SoilPGDPFPNYLIQVTDGGTLSIPQDLRSEYAVIIFYRGIW*
Ga0157305_1022582223300012891SoilMARQINPGDPFPAFNVSLTDGRRLNLPGDLEGEYAVIIYYRGIW*
Ga0137404_1028244023300012929Vadose Zone SoilMAKQLNPGDLFPVYTVPTTDGRKLDIPADLKGEYAVVIFYRGIW*
Ga0137407_1013729033300012930Vadose Zone SoilMAKRLNPGDPFPNYLIQVTDGGTLSIPQDLRGDAVIIFYRGIW*
Ga0153915_1078940133300012931Freshwater WetlandsMAKQLNPGDAFPTYIVPTTEGRTLNIPADLKGEYAVIIFYRGIW*
Ga0075327_123236023300014272Natural And Restored WetlandsMAKQLGPGDIFPNYTVPTVDGRTLNIPADIKAEYAVIIFYRGLW*
Ga0075344_112616013300014296Natural And Restored WetlandsQLNPGDLFQKYCVAVTDGTTLNIPDDLRGEYAVIIFYRGIW*
Ga0075321_115022613300014300Natural And Restored WetlandsMARQLNPGDAFPTYIVPTTEGRTLNIPADLKGEYA
Ga0075304_102216223300014307Natural And Restored WetlandsMAKQLNPGDAFPEFKVATVSGPVLSIPSDLTGEYAVIIYYRGIW*
Ga0180074_101553123300014877SoilMAKQLGPGDKFPDYSVPTTDGGVLNIPADLTGEYAVIIYYRGIW*
Ga0180074_112599713300014877SoilKQLNPGDAFPEFEVSTVSGSKLSIPKDLNGDYAVIIYYRGIW*
Ga0180069_105074423300014882SoilMAKQLNPGEPFPEFKVPTVSGSTLSIPNDLTGDYAVIIYYRGIW*
Ga0180086_118128623300014883SoilMAKQLGPGDKFPDYTVPTADGGVLNIPADLKGEYAVIIYYRGIW*
Ga0137409_1101455513300015245Vadose Zone SoilMAKQLGPGEQFPNYTIGTTIGTTLSMPADLAGEYAVIIFYRGIW*
Ga0187825_1000363923300017930Freshwater SedimentMAKQLNPGDAFPTYIVPTTEGRTLNIPSDLKGEYAVIIFYRGIW
Ga0187786_1016976113300017944Tropical PeatlandMAKQLNPGDPFPSYNVRITDGRTLSIPQDLTGEYAVIIFYRG
Ga0184610_122867613300017997Groundwater SedimentLNPGDMFPTYTVPTTDGRTLNIPAHLKGEYAVIIFYRGIW
Ga0184638_125445823300018052Groundwater SedimentMAKQLNPGDWFPNFTVPVTDGRTLNIPADLTGEYTVIIFYRGIW
Ga0184623_1017869433300018056Groundwater SedimentIYQSIAMARQLNPGDPFPTFNVNLTDGRTMNLPTDLKGEYAVIIYYRGIW
Ga0184615_1007358233300018059Groundwater SedimentMAKQLNPGDLFPNFRVPISDGRTMNIPADLKGDYAVVIFYRGVW
Ga0184636_118485423300018068Groundwater SedimentMAKQLNPGDLFPNFRVPISDGRTMKIPADLKGDYAVIIFYRGVW
Ga0184640_1011313313300018074Groundwater SedimentLNHYQTWEAREIMAKQLNPGDNFPNFTVPITDGRTLNIPADLNGEYAVIIFYRGIW
Ga0184632_1000100673300018075Groundwater SedimentMAKQLNPGDLFPNFRVPISDGRTMNIPADLKGDYAVIIFYRGVW
Ga0184639_1028485433300018082Groundwater SedimentTKIQTWEAREIMAKQLNPGDNFPNFTVPITDGRTLNIPNDLTGEYAVIIFYRGIC
Ga0184628_1000134293300018083Groundwater SedimentMAKQLNPGDAFPEFKVPTVSGTTLSIPNDLKGDYAVIIYYRGIW
Ga0190265_1049828823300018422SoilMVKQLAPGDPFPNYMVKTAGGSTLDIPADLKGKYAVIIFYRR
Ga0190265_1069870623300018422SoilMAKQLGPGDPFPNYNVPTADGGRLNIPTDLKGEYAVIIFYRGIW
Ga0190265_1378210413300018422SoilMAKQLGPGGPFPNYTVPTASGGTLTIPADLKGEYAVILFY
Ga0190268_1162216223300018466SoilGDVFPAFNVKLTNGRRLDLPKDLTGDYAVIIYYRGIW
Ga0190271_1019321833300018481SoilMAKQLNPGDEFPEFKVPTVSGSTLSIPKDLKGDYAVIIYYRGIW
Ga0187893_10001191593300019487Microbial Mat On RocksMQRRKQLNAGDNFPEYTVQTTDGRTMNIPKDLHGDYAVVIFYRGVW
Ga0193739_108438713300020003SoilMAKQLNPGDLFPDYTVSTTDGRTLNIPADLNGEYAVIIFYRGIW
Ga0193717_101954423300020060SoilMAKQLGPGDKFPNYMVPTTDGGMLNIPADIKAEYAVIIFYRGIW
Ga0163153_1003222453300020186Freshwater Microbial MatMAKQLNPGDAFPEFKVPTVSGSTLSIPNDLTGDYAVIIYYRGIW
Ga0194131_10000364483300020193Freshwater LakeMAKQLLPGDPFPSFKANLTDGRPLNIPGDLKAEYAVIIYYRGIW
Ga0194128_1006630933300020197Freshwater LakeMAKQLTPGDLFPNFTVPVTDGRTLDIPNDLTGEYAVIIFYRGIW
Ga0194121_1065002123300020200Freshwater LakeMAKQLTPGDLFPNFTVPVTDGRTLDIPNDLTGEYAVIIFYR
Ga0224497_1005100923300022209SedimentMAKQLLPGDPFPDYAVQVVDGRRLTIPADLPGEYSVIIFYRGVW
Ga0209320_1000291723300025155SoilMARQLGPNDPFPTYTVSTADGGRMKIPADLEGEYAVIIFYRGVW
Ga0209640_1045727313300025324SoilMAKQLNPGDLFPNFRVPISDGRTMNIPVDLKGDYAVIIFYRGVW
Ga0207650_1158434523300025925Switchgrass RhizosphereMARQINPGDPFPAFNVSLTDGRRLNLPGDLEGEYAVII
Ga0208141_100445433300025988Rice Paddy SoilMAKQLNPGDAFPTYIVPTTEGRTLNIPADLKGEYAVLIFYRGIW
Ga0209131_106875613300026320Grasslands SoilMAKQLNPGDPFPIFTVALADGRSLNIPGDLTADYAVIIYYRGIW
Ga0256867_1000191653300026535SoilMARQLGPGDPFPTYNVPTVSSGRLNIPGELKGEYAVIIFYRGIW
Ga0209879_103178323300027056Groundwater SandMAKQLNPGDLFPDYTVQLTDGRTVNIPQELRGEYAVIIFYRGIW
Ga0209983_102228623300027665Arabidopsis Thaliana RhizosphereMAKQLGPGDPFPNYTVPTVKGGTLNIPTDLNGEYAVIVF
Ga0209819_1022073713300027722Freshwater SedimentKQLNPGDQFPNYIVQLADGGTLCISQDLKGEYAVIIFYRGIW
Ga0209464_1007652133300027778Wetland SedimentMTMAKQLNPGDAFPEFKVPTVGGRTLSIPNDLTGEYAVIIYYRGIW
Ga0209726_1004900023300027815GroundwaterMAKQLNPGDAFPNFTVPTADGRALNIPADLQGDYAVIIYYRGIW
Ga0209797_1009639423300027831Wetland SedimentMAKQLNPGDAFPEFKVPTVGGRTLSIPNDLTGEYAVIIYYRGIW
Ga0209536_100017741113300027917Marine SedimentMARQLNVGDTFPQYTVPLIDDRTLNIPGDLKGEYAVIIFYRGIW
Ga0299907_1002046143300030006SoilMAQQLLPGDIFPDYKVQTADGRTLDIPRDLTGEYAVIIFYRGIW
Ga0299907_1007894833300030006SoilMARQLNPGDVFPNFSVGNIDGRTMNIPADLNGEYAVIIFYRGIW
Ga0299907_1105769223300030006SoilMARQLSPGDPFPTYNVPTVNHGRLNIPADLKGEYAVIIFYRGIW
Ga0268386_1013359323300030619SoilMAKQLNPGDLFPNFSVPVIDGPVMNIRADLKGEYAVVIFYRGIW
Ga0302046_1017658513300030620SoilLGPNDPFPTYTVSTADGGRMKIPADLEGEYAVIIFYRGVW
Ga0299914_1065100023300031228SoilMAKQLGPGDMFPHYTVPTVDGRTLNIPADIKAEYAVVIFYRGIW
Ga0310888_1081951423300031538SoilPGAPFPSYAVRTVGGGTLAIPAEIEGEYAVIIFYRGIW
Ga0310886_1107057623300031562SoilERLMAAQLGPGAPFPSYAVRTVGGGTLAIPAEIEGEYAVIIFYRGIW
Ga0307473_1000863843300031820Hardwood Forest SoilMAKRLNPGDPFPNYLIQVTDGGTLSIPQDLRSEYAVIIFYRGIW
Ga0307413_1090406223300031824RhizosphereLTPVRLQIDAEEDYMARQINPGDPFPTFNVSLTDGRTLMLPGDLDGQYAVIIYYRGIW
Ga0307410_1076393133300031852RhizosphereMDAEEDYMARQINPGDPFPTFNVSLTDGRTLMLPGDLDGQYAVIIYYRGIW
Ga0310892_1114868623300031858SoilMARQINPGDPFPAFNVSLTDGRRLNLPGDLEGEYAVIIYYRGIW
Ga0307412_1004568043300031911RhizosphereMARQINPGDPFPTFNVSLTDGRTLMLPGDLDGQYAVIIYYRGIW
Ga0326597_1028065613300031965SoilMARQLNPGDDFPNFTVPVTDGGTLNIPVDLTGEYAVIIFYRGIW
Ga0310906_1018721413300032013SoilMARQLNPGDPFPNYLIQVTDGRTLSIPRDLRSEYAVIIFYRGIW
Ga0310890_1010953743300032075SoilGPGDQFPNYTIGTTIGTTLGIPADLAGEYAVILFYRGIW
Ga0310890_1036481233300032075SoilIHAEEDYMARQINPGDPFPAFNVSLTDGRRLNLPGDLEGEYAVIIYYRGIW
Ga0315281_1038583433300032163SedimentMAKQLNPGDGFPNFTVPITDGRTLNIPADLKGEYAVIIYYRGIW
Ga0335085_1026541813300032770SoilMAQQLITGDRFPEYRVQTSAGRPLNIPADLPGDYAVLIFYRGIW
Ga0335070_1016088843300032829SoilMAKQLGPGDPFPSYVVATADGRTLNIPADINADYAVIIFYRGIW
Ga0316619_1085384123300033414SoilMAKQLNPGDPFPTFTVNLTDGRTLTLPANLQGEYAVIIYYRGIW
Ga0316620_1002756643300033480SoilMAKQLNPGDAFPTYIVPTTEGRTLNIPADLKGEYAVIIFYRGIW
Ga0364945_0004434_2506_26373300034115SedimentMSKQLNPGDLFPAYTVQLTDGRTVNIPQELRSEYAVIIFYRGI
Ga0364925_0036160_892_10263300034147SedimentMAKQLNPGDVFPNFRVPISDGRTMNIPADLKGDYAVIIFYRGVW
Ga0364931_0031550_2_1123300034176SedimentGDLFPAYTVQLTDGRTVNIPQELRSEYAVIIFYRGI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.