| Basic Information | |
|---|---|
| Family ID | F055092 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 139 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MAHQRYNPSALDNPKVSIVIPVYNEKATIDEILRRVLDT |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 16.55 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 86.33 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.245 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.619 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.338 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.324 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.91% β-sheet: 0.00% Coil/Unstructured: 82.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF00919 | UPF0004 | 41.73 |
| PF04055 | Radical_SAM | 27.34 |
| PF00196 | GerE | 10.79 |
| PF01648 | ACPS | 2.16 |
| PF02543 | Carbam_trans_N | 2.16 |
| PF02687 | FtsX | 1.44 |
| PF00535 | Glycos_transf_2 | 1.44 |
| PF02578 | Cu-oxidase_4 | 1.44 |
| PF01266 | DAO | 0.72 |
| PF16861 | Carbam_trans_C | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG0621 | tRNA A37 methylthiotransferase MiaB | Translation, ribosomal structure and biogenesis [J] | 41.73 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 2.16 |
| COG1496 | Copper oxidase (laccase) domain | Inorganic ion transport and metabolism [P] | 1.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.24 % |
| Unclassified | root | N/A | 5.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320005|FACEOR_FY84VJD01EDAH3 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300003220|JGI26342J46808_1025711 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aerophobetes → unclassified Aerophobetes → Aerophobetes bacterium SCGC AAA255-F10 | 580 | Open in IMG/M |
| 3300004082|Ga0062384_100133856 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300004082|Ga0062384_100574988 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300005177|Ga0066690_10792380 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005454|Ga0066687_10343970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
| 3300005529|Ga0070741_11456270 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005554|Ga0066661_10793424 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005561|Ga0066699_10295566 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300005602|Ga0070762_10929080 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300006050|Ga0075028_100524939 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300006086|Ga0075019_10295097 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300006174|Ga0075014_100536199 | Not Available | 660 | Open in IMG/M |
| 3300006176|Ga0070765_100439272 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300006800|Ga0066660_10523993 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300006903|Ga0075426_10904849 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300007258|Ga0099793_10076073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 1525 | Open in IMG/M |
| 3300007265|Ga0099794_10381924 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300009038|Ga0099829_10797925 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300009088|Ga0099830_10806801 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300009147|Ga0114129_13467604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300010048|Ga0126373_10010287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7529 | Open in IMG/M |
| 3300010325|Ga0134064_10379578 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300010326|Ga0134065_10078678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300010326|Ga0134065_10184158 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300010343|Ga0074044_10654180 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300010358|Ga0126370_11358759 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300010360|Ga0126372_10861614 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300010361|Ga0126378_11173021 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300010361|Ga0126378_12325376 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300010877|Ga0126356_10438340 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300011269|Ga0137392_10118644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_57_6 | 2107 | Open in IMG/M |
| 3300011269|Ga0137392_10822839 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300011271|Ga0137393_10190116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_57_6 | 1729 | Open in IMG/M |
| 3300011271|Ga0137393_11364708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300012096|Ga0137389_10087920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2444 | Open in IMG/M |
| 3300012203|Ga0137399_10018238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4512 | Open in IMG/M |
| 3300012205|Ga0137362_10303684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 1382 | Open in IMG/M |
| 3300012206|Ga0137380_10303969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_57_6 | 1429 | Open in IMG/M |
| 3300012206|Ga0137380_10363220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 1290 | Open in IMG/M |
| 3300012206|Ga0137380_10972909 | Not Available | 726 | Open in IMG/M |
| 3300012207|Ga0137381_11425830 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012208|Ga0137376_10510821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
| 3300012209|Ga0137379_11715700 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300012357|Ga0137384_10461580 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300012359|Ga0137385_10757617 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300012918|Ga0137396_10868308 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300012925|Ga0137419_10044901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2815 | Open in IMG/M |
| 3300012925|Ga0137419_11375629 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012927|Ga0137416_12061242 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300012929|Ga0137404_10288970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 1419 | Open in IMG/M |
| 3300012930|Ga0137407_10359500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_57_6 | 1342 | Open in IMG/M |
| 3300012930|Ga0137407_10805962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300012944|Ga0137410_11596452 | Not Available | 571 | Open in IMG/M |
| 3300012944|Ga0137410_11694518 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012971|Ga0126369_10609475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 1162 | Open in IMG/M |
| 3300012972|Ga0134077_10305182 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300014155|Ga0181524_10246319 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300014164|Ga0181532_10043586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3005 | Open in IMG/M |
| 3300014200|Ga0181526_10083748 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
| 3300015051|Ga0137414_1072987 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300015054|Ga0137420_1307456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 1278 | Open in IMG/M |
| 3300015054|Ga0137420_1360227 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
| 3300015245|Ga0137409_11112935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300016319|Ga0182033_10127850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 1924 | Open in IMG/M |
| 3300016387|Ga0182040_10893185 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300016422|Ga0182039_10173255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 1695 | Open in IMG/M |
| 3300017934|Ga0187803_10187030 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300017938|Ga0187854_10267056 | Not Available | 738 | Open in IMG/M |
| 3300017970|Ga0187783_10812460 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300018006|Ga0187804_10370648 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300018012|Ga0187810_10178326 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300018012|Ga0187810_10423449 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300018012|Ga0187810_10456686 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300018058|Ga0187766_11352128 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300018085|Ga0187772_11462631 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300018088|Ga0187771_10396034 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300018468|Ga0066662_10008699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5181 | Open in IMG/M |
| 3300020579|Ga0210407_10053641 | All Organisms → cellular organisms → Bacteria | 3013 | Open in IMG/M |
| 3300020579|Ga0210407_10333918 | Not Available | 1185 | Open in IMG/M |
| 3300020581|Ga0210399_10506816 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300020581|Ga0210399_11285046 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300020582|Ga0210395_10089723 | All Organisms → cellular organisms → Bacteria | 2269 | Open in IMG/M |
| 3300020583|Ga0210401_10137532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2286 | Open in IMG/M |
| 3300021180|Ga0210396_10794170 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300021405|Ga0210387_11472531 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300021407|Ga0210383_10074859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2832 | Open in IMG/M |
| 3300021407|Ga0210383_10297802 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300021433|Ga0210391_10669832 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300021475|Ga0210392_10567295 | Not Available | 840 | Open in IMG/M |
| 3300021479|Ga0210410_10444837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 1159 | Open in IMG/M |
| 3300021559|Ga0210409_10309877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 1422 | Open in IMG/M |
| 3300021559|Ga0210409_10327987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_57_6 | 1377 | Open in IMG/M |
| 3300024323|Ga0247666_1059642 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300025899|Ga0207642_10069439 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300025922|Ga0207646_10091772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2718 | Open in IMG/M |
| 3300025928|Ga0207700_11176203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300026277|Ga0209350_1056052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_57_6 | 1135 | Open in IMG/M |
| 3300026285|Ga0209438_1155337 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300026298|Ga0209236_1211135 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300026310|Ga0209239_1240748 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300026320|Ga0209131_1241254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_57_6 | 752 | Open in IMG/M |
| 3300026342|Ga0209057_1010801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5692 | Open in IMG/M |
| 3300026377|Ga0257171_1026995 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300026551|Ga0209648_10792906 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300026557|Ga0179587_11109932 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300026895|Ga0207758_1019816 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300027643|Ga0209076_1009928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2417 | Open in IMG/M |
| 3300027725|Ga0209178_1338348 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300027846|Ga0209180_10250782 | Not Available | 1018 | Open in IMG/M |
| 3300027846|Ga0209180_10564608 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300027862|Ga0209701_10334257 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300027884|Ga0209275_10529797 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300027911|Ga0209698_11239396 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300028906|Ga0308309_11206865 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300031057|Ga0170834_106016984 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300031090|Ga0265760_10238703 | Not Available | 625 | Open in IMG/M |
| 3300031122|Ga0170822_12027436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300031474|Ga0170818_109045723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300031525|Ga0302326_13566478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300031680|Ga0318574_10932098 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031718|Ga0307474_10233086 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300031718|Ga0307474_11503371 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300031724|Ga0318500_10748529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300031753|Ga0307477_10566872 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300031754|Ga0307475_10027947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4055 | Open in IMG/M |
| 3300031823|Ga0307478_10076872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2538 | Open in IMG/M |
| 3300031831|Ga0318564_10075054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1492 | Open in IMG/M |
| 3300031912|Ga0306921_10975581 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300031946|Ga0310910_10031409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3613 | Open in IMG/M |
| 3300031954|Ga0306926_11315673 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300032059|Ga0318533_11419835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300032060|Ga0318505_10054351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1726 | Open in IMG/M |
| 3300032205|Ga0307472_100324707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1250 | Open in IMG/M |
| 3300032205|Ga0307472_101545413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300032261|Ga0306920_101056737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 1180 | Open in IMG/M |
| 3300032892|Ga0335081_11003369 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300033804|Ga0314863_094623 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300033983|Ga0371488_0570641 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.04% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.60% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.16% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.16% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.44% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.44% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.72% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.72% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.72% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320005 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- | Environmental | Open in IMG/M |
| 3300003220 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026895 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033804 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20 | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORA_5643810 | 2032320005 | Soil | MAHPRHNPLALVDPKLSVVIPVYNEKATIDEILRRV |
| JGI26342J46808_10257111 | 3300003220 | Bog Forest Soil | MCALRRHPSALDNPKTSVVIPVYNEKNTVEEILRRVLETGIRVEIVIV |
| Ga0062384_1001338561 | 3300004082 | Bog Forest Soil | MTTRRRNPTALDNPKLSVVIPVYNEKDTILEILGRVLTMGLAEE |
| Ga0062384_1005749882 | 3300004082 | Bog Forest Soil | MCALRRHPSALDNPKLSVVIPVYNEKATIEEILRRVLETRMRME |
| Ga0066690_107923802 | 3300005177 | Soil | VRRYNLSTTMAHQRYNPSALDDPKVSIVIAVYNEKSTIDEILRRVLDT |
| Ga0066687_103439702 | 3300005454 | Soil | MANPRHNPLALINPKLSVVIPVYNERATIDEILRRVIETE |
| Ga0070741_114562701 | 3300005529 | Surface Soil | MMTPQRRNPQALQDPKLSVVIPVYNEKATIEEILR |
| Ga0066661_107934241 | 3300005554 | Soil | MAHQRHNPSALHDPKVSIVIPVYNEKSTIDEILRRVLDTGV |
| Ga0066699_102955661 | 3300005561 | Soil | MARKRTSPTALDNPTLSIVIPVYNERGTIEELLRRVLDMDIRKE |
| Ga0070762_109290802 | 3300005602 | Soil | MCALRRHPSALDDPKISIVIPVYNEKNTIEEILRRVQEMGMRME |
| Ga0075028_1005249391 | 3300006050 | Watersheds | MSHTRRNPSQLDDPKVSVVIPVYNEKNTISEILRRVEET |
| Ga0075019_102950971 | 3300006086 | Watersheds | MAHQRYNASALHDPKVSIVIPVYNEKSTIDEILRRVLDTAVR |
| Ga0075014_1005361992 | 3300006174 | Watersheds | MTKVKRRNPAALDDPKISVVIPVFNEKNTIDEILRRVLE |
| Ga0070765_1004392722 | 3300006176 | Soil | MSTPRRNPAALVDPKLSVVIPVYNEKNTIHEILRRVLEETDIRKEI |
| Ga0066660_105239931 | 3300006800 | Soil | MARQRHNPSALHDPKVSIVIPVYNEKTTIDEILRRVVDIEIRKEV |
| Ga0075426_109048491 | 3300006903 | Populus Rhizosphere | MAGPIQCVGLMSQHRRNPQALRDPKLSVVIPVYNEKNTLEELLRRVTDDPT |
| Ga0099793_100760731 | 3300007258 | Vadose Zone Soil | MAHKRYNPSALDNPKVSIVIPVYNEKSTIDEIVRRVLDTSVRKEV |
| Ga0099794_103819242 | 3300007265 | Vadose Zone Soil | MARQRHNPAALDNPKISIVIPVYNEKSTIDEILRR |
| Ga0099829_107979252 | 3300009038 | Vadose Zone Soil | MALSPRNPSALDNPMVSIVIPVYNEKNTVEEILRRVLESPFRK |
| Ga0099830_108068012 | 3300009088 | Vadose Zone Soil | MSTRRNPSGLHDPKLSVIIPVYNEKPTINEILRRVIETPARK |
| Ga0114129_134676041 | 3300009147 | Populus Rhizosphere | MTAHRRNPSAMADPKLSVVIPVYNEKATIDEILRRVIDT |
| Ga0126373_100102878 | 3300010048 | Tropical Forest Soil | MKHTRRNPTALPDAKVSVVIPVYNEKNTICEILRRVEE |
| Ga0134064_103795782 | 3300010325 | Grasslands Soil | VRRYNLSTAMAHQRYNPSALDNPKVSIVIPVYNEKSTIDEILRRVLDTAVRKEV |
| Ga0134065_100786781 | 3300010326 | Grasslands Soil | MAHPRHNPLALVDPKLSVVIPVYNEKATIDEILRR |
| Ga0134065_101841582 | 3300010326 | Grasslands Soil | MAHQRHNPSALHDPKVSIVIPVYNERSTIDEILRRVVD |
| Ga0074044_106541801 | 3300010343 | Bog Forest Soil | MAHTRRSPSQLVDPKVSVVIPVYNEKNTICEILRRVEEAEM |
| Ga0126370_113587591 | 3300010358 | Tropical Forest Soil | MASHRRNPTALDNPKLSVVIPAYNEKGTIEEIIRRVV |
| Ga0126372_108616141 | 3300010360 | Tropical Forest Soil | MARKRTNPTALNEPTVSIVIPVYNERGTIEEILRRVLDMDIRREVI |
| Ga0126378_111730212 | 3300010361 | Tropical Forest Soil | MAHTRKNPAALIDPKVSVVIPVYNEKTTICEILRRVEE |
| Ga0126378_123253761 | 3300010361 | Tropical Forest Soil | MAAHRRNPAALDNPKLSVVIPVYNEKTTVEEIIRRVVDTEM |
| Ga0126356_104383402 | 3300010877 | Boreal Forest Soil | MSALRRHPSALDDPKISVVIPVYNEKNTIEEILRRVLE |
| Ga0137392_101186442 | 3300011269 | Vadose Zone Soil | MAHQRYNPSALHDPKVSIVIPVYNEKSTIDEILRRVLDTEVRKEV |
| Ga0137392_108228392 | 3300011269 | Vadose Zone Soil | MTPRRNPYGLKDPKLSIVMPVYNERATIDEILRRVQESKMR |
| Ga0137393_101901161 | 3300011271 | Vadose Zone Soil | MAHQRYNPSALHDPKVSIVIPVYNEKSTIDEILRRV |
| Ga0137393_113647081 | 3300011271 | Vadose Zone Soil | MAYPRYNPLALIDPKLSVVIPVYNERATIDEILRRV |
| Ga0137389_100879204 | 3300012096 | Vadose Zone Soil | MTPRRNPYGLKDPKLSIVMPVYNERATIDEILRRVQETT |
| Ga0137399_100182386 | 3300012203 | Vadose Zone Soil | MSTRRNPSGLHDPKLSVVIPVYNEKPTIDEILRRVIESP |
| Ga0137362_103036841 | 3300012205 | Vadose Zone Soil | MAHQRYNPSALDNPTVSIVIPVYNEKSTIDEILRRVLDTA |
| Ga0137380_103039692 | 3300012206 | Vadose Zone Soil | MAHQRRNPSALHDPKVSIVIPVYNEKSTIDEILRRVLDAEVR |
| Ga0137380_103632201 | 3300012206 | Vadose Zone Soil | MAHQRQNPSALHDPKVSIVIPVYNEKTTIDEILRRV |
| Ga0137380_109729091 | 3300012206 | Vadose Zone Soil | MAARRNPAAIPDAKLSVVIPVYNEKGTIEEILRRVQ |
| Ga0137381_114258301 | 3300012207 | Vadose Zone Soil | MAHQRRNPSALDNPKLTIVVPVYNEKATIDEILRRVLDTEV |
| Ga0137376_105108213 | 3300012208 | Vadose Zone Soil | MAHPRHNPLALVDPKLSVVMPVYNEKATIDEILRRVIETQFR |
| Ga0137379_117157002 | 3300012209 | Vadose Zone Soil | MAHQRQNPSALHDPKVSIVIPVYNEKTTIDEILRRVLDTEVR |
| Ga0137384_104615802 | 3300012357 | Vadose Zone Soil | MAHQRRNPSALDNPKLTIVVPVYNEKATIDEILRRVLD |
| Ga0137385_107576172 | 3300012359 | Vadose Zone Soil | MAHQRRSPSALDNPKLTIVVPVYNEKATIDEILRRVLDTEV |
| Ga0137396_108683082 | 3300012918 | Vadose Zone Soil | MARQRHNPAALDNPKTSIVIPVYNEKATIDEILRRVV |
| Ga0137419_100449014 | 3300012925 | Vadose Zone Soil | MTHTRRNPSQLNDPKVSVVIPVYNEKNTICEILRRVE |
| Ga0137419_113756292 | 3300012925 | Vadose Zone Soil | MTHTRRNPSELVDPKISVVIPVYNEKNTICEILRRVEET |
| Ga0137416_120612421 | 3300012927 | Vadose Zone Soil | MARQRSSPSDLIDPKVSIVIPVYNEKNTIDEILRRVLDTEPRKEV |
| Ga0137404_102889702 | 3300012929 | Vadose Zone Soil | MTHTRRNPSQLIDPRVSVVIPVYNEKNTICEILRRVEE |
| Ga0137407_103595002 | 3300012930 | Vadose Zone Soil | MARQRHNPAALDNPKISVVIPVYNEKSTIDEILRRVLD |
| Ga0137407_108059621 | 3300012930 | Vadose Zone Soil | MAHPRHNPLALVDPKLSVVIPVYNEKATIDEILRRVIETQF |
| Ga0137410_115964521 | 3300012944 | Vadose Zone Soil | MAHQRHNPSALRDPRVSIVIPVYNEKGTIDEILRRVLDTEI |
| Ga0137410_116945182 | 3300012944 | Vadose Zone Soil | MARQRHNPAALDNPKISIVIPVYNEKNTIDEILRRVL |
| Ga0126369_106094752 | 3300012971 | Tropical Forest Soil | MVHSRRNPGALRDPKLSIVIPVFNEKETIFEILRRVIDVSIRKEV |
| Ga0134077_103051822 | 3300012972 | Grasslands Soil | MAHQRRNPSALHDPKVSIVIPVYNEKSTIDEILRRVLDADVRK |
| Ga0181524_102463192 | 3300014155 | Bog | MTPPRKNPAALLDAKLSVVIPVYNEKDTICEILRRVQETEMRK |
| Ga0181532_100435863 | 3300014164 | Bog | MAHIRRTATSLTDPKISVVIPVYNEKETIFEILRRVLDTDVR |
| Ga0181526_100837481 | 3300014200 | Bog | MSHIRRTATSLTDPKISVVIPVYNEKETIFEILRR |
| Ga0137414_10729872 | 3300015051 | Vadose Zone Soil | MSRHRRNPQALSDPKLSVVIPVYNEKNTVEELLRRVTDDPTR |
| Ga0137420_13074561 | 3300015054 | Vadose Zone Soil | MAHQRYNPSALDNPKVSIVIPVYNEKATIDEILRRVLDT |
| Ga0137420_13602276 | 3300015054 | Vadose Zone Soil | MSKRRNPSGLHDPKVSVVIPVYNEKATIDEILRRVVEAPM |
| Ga0137409_111129351 | 3300015245 | Vadose Zone Soil | MAYPRHNPLALIDPKLSVVIPVYNEKATIDEILRRVIETEQ |
| Ga0182033_101278503 | 3300016319 | Soil | MAHSRRHPAALSDPKLSIVIPVFNERDTIFEILRR |
| Ga0182040_108931851 | 3300016387 | Soil | MAHSRRHPGALSDPKLSIVIPVFNEKDTIFEILRRVLDVSIRKEII |
| Ga0182039_101732552 | 3300016422 | Soil | MAHSRRNPAALADPKLSIVIPVFNEKETIFEILRRVLD |
| Ga0187803_101870302 | 3300017934 | Freshwater Sediment | MRHRRHPSALDNPKISIVIPAYNEKPTIEEILRRVLETDVR |
| Ga0187854_102670561 | 3300017938 | Peatland | MSDRRRRRYPTALENPRVSVVIPVYNERGTIEEILRRVHET |
| Ga0187783_108124601 | 3300017970 | Tropical Peatland | MFPSRRNAGALVDPKLSVVIPVYNEKDTIFEILRRVLETKM |
| Ga0187804_103706481 | 3300018006 | Freshwater Sediment | MIHARRNPAALVDPKLSVVIPVYNEKGTIHEILRR |
| Ga0187810_101783262 | 3300018012 | Freshwater Sediment | MPHVRRNPTALFDPKLKIVIPVYNEKDTIFEILRRV |
| Ga0187810_104234491 | 3300018012 | Freshwater Sediment | MTHKRKNPSALVDPVVSVVIPVYNEKNTICEILRRVEETGMRKEIVV |
| Ga0187810_104566862 | 3300018012 | Freshwater Sediment | MPHIRRRTPSSLTDPKLSVVIPVYNEKDTIFEILRRVLETETRKEII |
| Ga0187766_113521282 | 3300018058 | Tropical Peatland | MTPRRHNPSALEDPKVSIVIPVYNEKSTIDEILRRVVD |
| Ga0187772_114626312 | 3300018085 | Tropical Peatland | MSAKRRNRSALDDPKLSVVIPVYNEKKTIEEILRRVQE |
| Ga0187771_103960341 | 3300018088 | Tropical Peatland | MAHPRRNPAAMLDAKLSVVIPVYNEKDTICEILRRV |
| Ga0066662_100086995 | 3300018468 | Grasslands Soil | MAYRRNNPTALHNPTVSIVIPVYNERGTIEEILRRVLDAEVR |
| Ga0210407_100536413 | 3300020579 | Soil | MTHTRRNASQLVDPKVSVVIPVYNEKNTICEILRRVEEAEMRKEIV |
| Ga0210407_103339182 | 3300020579 | Soil | MARQRYNPAALKDPKLSVVIPVYNEKSTIDEILRRVLDTQICK |
| Ga0210399_105068162 | 3300020581 | Soil | MARQRYNPAALKDPKLSVVIPVYNEKSTIDEILRRVLDTEVRK |
| Ga0210399_112850461 | 3300020581 | Soil | MAAHRRNPSALDDPKLSVVIPVYNEKATIEEILRRVQDAA |
| Ga0210395_100897231 | 3300020582 | Soil | MAHTRRTASSLTDPKVSVVIPVYNEKDTIFEILRRVMDTD |
| Ga0210401_101375324 | 3300020583 | Soil | MTPRRNPFGLKDPRLSVVMPVYNERATIGEILRRVQETQMR |
| Ga0210396_107941701 | 3300021180 | Soil | MARQRYSPSAPIDPKLSIVIPVYNEKNTIDEILRRVLDT |
| Ga0210387_114725311 | 3300021405 | Soil | MCALRRHPSALDNPKISVVIPVYNEKGTIEEILRRVLETEMRL |
| Ga0210383_100748591 | 3300021407 | Soil | MTHTRRNPSQLVDPKVSVVIPVYNEKNTICEILRRVEEADARK |
| Ga0210383_102978022 | 3300021407 | Soil | MCALRRHPSALDNPKISVVIPVYNEKNTIEEILRRVLENG |
| Ga0210391_106698321 | 3300021433 | Soil | MTHTRRNASQLNDPKVSVVIPVYNEKNTICEILRRVEETDMRK |
| Ga0210392_105672952 | 3300021475 | Soil | MTIRRRNSKAIDNPKLSVVIPVYNEKGTILEILGRVL |
| Ga0210410_104448371 | 3300021479 | Soil | MSHTRRNPSQLVDPKVSVVIPVYNEKNTISEILRRVEEAD |
| Ga0210409_103098772 | 3300021559 | Soil | MARQRYNPAALKDPKLSVVIPVYNEKSTIDEILRRV |
| Ga0210409_103279872 | 3300021559 | Soil | MEHQRHNPSALPDPRVSIVIPVYNEKGTIDEILRRVLDTKIRRE |
| Ga0247666_10596421 | 3300024323 | Soil | MTHTRRNPSQLNDPKVSVVIPVYNEKNTICEILRRVEEADMR |
| Ga0207642_100694391 | 3300025899 | Miscanthus Rhizosphere | MARQRRNPSTLVDPKLSVTIPVYNERATIDEILRRVQE |
| Ga0207646_100917723 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHPRHNPLALIDPKLSVVIPVYNERATIDEILRRVIETAPRKEI |
| Ga0207700_111762031 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTHQRRNPFALVDPKLSVVIPVYNEKATIHEILRRVQE |
| Ga0209350_10560521 | 3300026277 | Grasslands Soil | MARQRYSPSALRDPKVSIVIPVYNEKSTIDEILRRVLDT |
| Ga0209438_11553372 | 3300026285 | Grasslands Soil | MAHQRYNPSALDNPKVSIVIPVYNEKATIDEILRRVLDTEIRKE |
| Ga0209236_12111351 | 3300026298 | Grasslands Soil | MAYQRRNPSALHDPKVSIVIPVYNEKSTIDEILRR |
| Ga0209239_12407481 | 3300026310 | Grasslands Soil | MAYRRNNPTALHNPTVSIVIPVYNERGTIEEILRRVLDAEE |
| Ga0209131_12412542 | 3300026320 | Grasslands Soil | MAHQRRNPSALDNPKVSIVIPVYNERSTIDEILRRVLDTE |
| Ga0209057_10108011 | 3300026342 | Soil | MAYRRNNPTALHNPTVSIVIPVYNERGTIEEILRRVLDAEVRKQVLIV |
| Ga0257171_10269952 | 3300026377 | Soil | MRGTKMSRQRRNPQALEDPKLSVVIPVYNEKNTLEELLRRVID |
| Ga0209648_107929062 | 3300026551 | Grasslands Soil | MSTRRNPSGLHDPKLSVVIPVYNEKPTIDEILRRVIESPM |
| Ga0179587_111099322 | 3300026557 | Vadose Zone Soil | MAHQRYNPSALDNPKVSIVIPVYNEKSTIDEIVRRVLD |
| Ga0207758_10198161 | 3300026895 | Tropical Forest Soil | MAHSRRHPAALSDPKLSIVIPVFNERDTIFEILRRVLD |
| Ga0209076_10099281 | 3300027643 | Vadose Zone Soil | MAHQRYNPSALDNPKVSIVIPVYNEKSTIDEIVRRVLDTS |
| Ga0209178_13383482 | 3300027725 | Agricultural Soil | MCALRRHPSALDNPKLSVVIPVYNEKNTIEEILRRVVETGM |
| Ga0209180_102507821 | 3300027846 | Vadose Zone Soil | MTRQRWNPAALIDPKISVIIPVYNEKATIFELLRRVLDTERKLEIVVV |
| Ga0209180_105646082 | 3300027846 | Vadose Zone Soil | MTRRRRRNPGALSDPKVSIVMPVYNERATIEEILRRVMDTDL |
| Ga0209701_103342572 | 3300027862 | Vadose Zone Soil | MAHQRQNPSALHDPKVSIVIPVYNEKSTIDEILRRVLD |
| Ga0209275_105297972 | 3300027884 | Soil | MCALRRHPSALDNPKLSVVIPVYNEKATIEEILRRVQETQM |
| Ga0209698_112393961 | 3300027911 | Watersheds | MTRTRQNPLALKDPKVSVVIPVYNEKTTIEEILRRVVDTGVRKE |
| Ga0308309_112068652 | 3300028906 | Soil | MSHSRRNPSSLQDPKVSVVIPVYNEKDTIFEILRR |
| Ga0170834_1060169842 | 3300031057 | Forest Soil | MTHTRRNPSQLFDPKISVVIPVYNEKNTICEILRRVEEADMRKEI |
| Ga0265760_102387031 | 3300031090 | Soil | MCALRRHPSALDNPKISVVIPVYNEKATIEEILRRVSENGLRKEI |
| Ga0170822_120274362 | 3300031122 | Forest Soil | MAYPRHNPLALIDPKLSVVIPVYNERATIDEILRRVIETEPRK |
| Ga0170818_1090457232 | 3300031474 | Forest Soil | MAYPRHNPLALIDAKLSVVIPVYNERATIDEILRRVIETAPR |
| Ga0302326_135664782 | 3300031525 | Palsa | MTVKRRNPAALDNPKVSVVIPVYNEKSTIDEILRRV |
| Ga0318574_109320981 | 3300031680 | Soil | MVHSRRNPGALRDPRLSIVIPVFNEKETIFEILRRVIDVS |
| Ga0307474_102330862 | 3300031718 | Hardwood Forest Soil | MCALRRHPSALDNPKISVVIPVYNEKNTIEEILRRVQET |
| Ga0307474_115033712 | 3300031718 | Hardwood Forest Soil | MCALRRHPSALDNPKTSVVIPVYNEKNTIEEILRRVLETEMRLEIV |
| Ga0318500_107485291 | 3300031724 | Soil | MTAHRRNPSAMADPKLSVVIPVYNERATIDEILRRVI |
| Ga0307477_105668722 | 3300031753 | Hardwood Forest Soil | MSTRRNPSGLRDPKLSVVIPVYNEKPTIDEILRRVIESPIR |
| Ga0307475_100279475 | 3300031754 | Hardwood Forest Soil | MAHQRHNPSALHNPKVSIVIPVYNEKGTIDEILRRVLDT |
| Ga0307478_100768721 | 3300031823 | Hardwood Forest Soil | MGYRRNNPTALDNPKISIVIPAYNEKATIEEILRRVL |
| Ga0318564_100750543 | 3300031831 | Soil | MTAHRRNPSAMADPKLSVVIPVYNERATIDEILRRVIDT |
| Ga0306921_109755811 | 3300031912 | Soil | MVHSRRNPGALRDPKLSIVIPVFNEKETIFEILRRVI |
| Ga0310910_100314093 | 3300031946 | Soil | MTAHRRNPSAMADPKLSVVIPVYNERDTIDEILRR |
| Ga0306926_113156731 | 3300031954 | Soil | MPRIRRRTPGSLVDPKVSVVIPVYNEKDTIFEILRRVLET |
| Ga0318533_114198351 | 3300032059 | Soil | MTAHRRNPSALVDPKLSVVIPVYNEKATIDEILRRVIET |
| Ga0318505_100543512 | 3300032060 | Soil | MVHSRRNPGALRDPKLSIVIPVFNEKETIFEILRRVIDVSIR |
| Ga0307472_1003247071 | 3300032205 | Hardwood Forest Soil | MAYPRHNPLALIDPKLSVVIPVYNERATIDEILRRVIETE |
| Ga0307472_1015454132 | 3300032205 | Hardwood Forest Soil | MAHPRHNPLALVDPKLSVVIPVYNERATIDEILRR |
| Ga0306920_1010567372 | 3300032261 | Soil | MSHTRRNPTALPDPKVSVVIPVYNEKNTICEILRRVEE |
| Ga0335081_110033692 | 3300032892 | Soil | MSAKRRNPSALDDPKLSVVIPVYNEKNTIEEILRRVQDTAM |
| Ga0314863_094623_3_116 | 3300033804 | Peatland | MANPRRNPATLMDAKLSVVMPVYNEKDTICEILRRVLE |
| Ga0371488_0570641_385_504 | 3300033983 | Peat Soil | MTRPRRNPAALLDAKLSVVIPVYNEKDTICEILRRVQETE |
| ⦗Top⦘ |