| Basic Information | |
|---|---|
| Family ID | F054973 |
| Family Type | Metagenome |
| Number of Sequences | 139 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MHTPYFPAFRSRLAALGRRTAGTLRQATLEQLQQHLRDLLPAPLL |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 55.40 % |
| % of genes near scaffold ends (potentially truncated) | 98.56 % |
| % of genes from short scaffolds (< 2000 bps) | 94.96 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.734 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog (11.511 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.863 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (30.216 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.21% β-sheet: 0.00% Coil/Unstructured: 54.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF02353 | CMAS | 2.16 |
| PF01609 | DDE_Tnp_1 | 2.16 |
| PF13542 | HTH_Tnp_ISL3 | 1.44 |
| PF00106 | adh_short | 0.72 |
| PF00730 | HhH-GPD | 0.72 |
| PF05960 | DUF885 | 0.72 |
| PF13669 | Glyoxalase_4 | 0.72 |
| PF07963 | N_methyl | 0.72 |
| PF01797 | Y1_Tnp | 0.72 |
| PF13495 | Phage_int_SAM_4 | 0.72 |
| PF04542 | Sigma70_r2 | 0.72 |
| PF00375 | SDF | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 2.16 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.16 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.16 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.16 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.16 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.16 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.16 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 2.16 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 2.16 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.72 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.72 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.72 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.72 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.72 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.72 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.72 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.72 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.72 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.72 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.73 % |
| Unclassified | root | N/A | 17.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_103702123 | All Organisms → cellular organisms → Bacteria → PVC group | 521 | Open in IMG/M |
| 3300001471|JGI12712J15308_10042536 | Not Available | 1161 | Open in IMG/M |
| 3300002347|JGIcombinedJ26865_1075468 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 541 | Open in IMG/M |
| 3300004282|Ga0066599_101015137 | All Organisms → cellular organisms → Bacteria → PVC group | 604 | Open in IMG/M |
| 3300005536|Ga0070697_101700793 | Not Available | 564 | Open in IMG/M |
| 3300005554|Ga0066661_10412891 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 827 | Open in IMG/M |
| 3300005602|Ga0070762_11218418 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 521 | Open in IMG/M |
| 3300005712|Ga0070764_10726590 | Not Available | 613 | Open in IMG/M |
| 3300005830|Ga0074473_10164457 | All Organisms → cellular organisms → Bacteria → PVC group | 615 | Open in IMG/M |
| 3300005901|Ga0075274_1062992 | Not Available | 585 | Open in IMG/M |
| 3300006031|Ga0066651_10560439 | All Organisms → cellular organisms → Bacteria → PVC group | 606 | Open in IMG/M |
| 3300006041|Ga0075023_100235619 | All Organisms → cellular organisms → Bacteria → PVC group | 724 | Open in IMG/M |
| 3300006102|Ga0075015_100589191 | All Organisms → cellular organisms → Bacteria → PVC group | 650 | Open in IMG/M |
| 3300006224|Ga0079037_101561975 | All Organisms → cellular organisms → Bacteria → PVC group | 659 | Open in IMG/M |
| 3300007265|Ga0099794_10806923 | Not Available | 502 | Open in IMG/M |
| 3300009137|Ga0066709_104086195 | All Organisms → cellular organisms → Bacteria → PVC group | 531 | Open in IMG/M |
| 3300009167|Ga0113563_12759941 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300009500|Ga0116229_11281472 | Not Available | 583 | Open in IMG/M |
| 3300009521|Ga0116222_1040339 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2046 | Open in IMG/M |
| 3300009522|Ga0116218_1474653 | All Organisms → cellular organisms → Bacteria → PVC group | 558 | Open in IMG/M |
| 3300009548|Ga0116107_1028919 | All Organisms → cellular organisms → Bacteria → PVC group | 2075 | Open in IMG/M |
| 3300009623|Ga0116133_1143737 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin006 | 623 | Open in IMG/M |
| 3300009639|Ga0116122_1077798 | All Organisms → cellular organisms → Bacteria → PVC group | 1093 | Open in IMG/M |
| 3300009644|Ga0116121_1104055 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300009709|Ga0116227_11412634 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 523 | Open in IMG/M |
| 3300009762|Ga0116130_1149236 | All Organisms → cellular organisms → Bacteria → PVC group | 737 | Open in IMG/M |
| 3300010336|Ga0134071_10549278 | Not Available | 600 | Open in IMG/M |
| 3300010362|Ga0126377_11853218 | Not Available | 679 | Open in IMG/M |
| 3300011443|Ga0137457_1289747 | All Organisms → cellular organisms → Bacteria → PVC group | 559 | Open in IMG/M |
| 3300012096|Ga0137389_11778507 | Not Available | 512 | Open in IMG/M |
| 3300012168|Ga0137357_1095915 | All Organisms → cellular organisms → Bacteria → PVC group | 610 | Open in IMG/M |
| 3300012201|Ga0137365_10102100 | All Organisms → cellular organisms → Bacteria | 2158 | Open in IMG/M |
| 3300012205|Ga0137362_10966107 | Not Available | 726 | Open in IMG/M |
| 3300012285|Ga0137370_10599098 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 681 | Open in IMG/M |
| 3300012353|Ga0137367_10428284 | All Organisms → cellular organisms → Bacteria → PVC group | 937 | Open in IMG/M |
| 3300012361|Ga0137360_11554910 | All Organisms → cellular organisms → Bacteria → PVC group | 566 | Open in IMG/M |
| 3300012582|Ga0137358_10944649 | Not Available | 562 | Open in IMG/M |
| 3300012683|Ga0137398_10937996 | Not Available | 602 | Open in IMG/M |
| 3300012927|Ga0137416_11835420 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 554 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10414214 | All Organisms → cellular organisms → Bacteria → PVC group | 674 | Open in IMG/M |
| 3300014158|Ga0181521_10426342 | All Organisms → cellular organisms → Bacteria → PVC group | 648 | Open in IMG/M |
| 3300014167|Ga0181528_10178896 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → unclassified Pedosphaera → Pedosphaera sp. Tous-C6FEB | 1146 | Open in IMG/M |
| 3300014169|Ga0181531_10949747 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300014199|Ga0181535_10072011 | All Organisms → cellular organisms → Bacteria | 2293 | Open in IMG/M |
| 3300014498|Ga0182019_10359879 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 984 | Open in IMG/M |
| 3300014502|Ga0182021_13403013 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 530 | Open in IMG/M |
| 3300014872|Ga0180087_1087811 | All Organisms → cellular organisms → Bacteria → PVC group | 597 | Open in IMG/M |
| 3300015053|Ga0137405_1211963 | All Organisms → cellular organisms → Bacteria → PVC group | 1093 | Open in IMG/M |
| 3300016387|Ga0182040_11714458 | All Organisms → cellular organisms → Bacteria → PVC group | 537 | Open in IMG/M |
| 3300017938|Ga0187854_10251948 | All Organisms → cellular organisms → Bacteria → PVC group | 765 | Open in IMG/M |
| 3300017975|Ga0187782_11378436 | Not Available | 554 | Open in IMG/M |
| 3300017988|Ga0181520_10968414 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin006 | 564 | Open in IMG/M |
| 3300018014|Ga0187860_1352481 | All Organisms → cellular organisms → Bacteria → PVC group | 559 | Open in IMG/M |
| 3300018015|Ga0187866_1109776 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300018022|Ga0187864_10357665 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 638 | Open in IMG/M |
| 3300018024|Ga0187881_10417611 | All Organisms → cellular organisms → Bacteria → PVC group | 549 | Open in IMG/M |
| 3300018040|Ga0187862_10414132 | All Organisms → cellular organisms → Bacteria → PVC group | 825 | Open in IMG/M |
| 3300018043|Ga0187887_10561380 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 674 | Open in IMG/M |
| 3300018044|Ga0187890_10568388 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 639 | Open in IMG/M |
| 3300018082|Ga0184639_10513810 | All Organisms → cellular organisms → Bacteria → PVC group | 602 | Open in IMG/M |
| 3300019360|Ga0187894_10231162 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 885 | Open in IMG/M |
| 3300020005|Ga0193697_1118358 | Not Available | 618 | Open in IMG/M |
| 3300020057|Ga0163151_10549715 | All Organisms → cellular organisms → Bacteria → PVC group | 545 | Open in IMG/M |
| 3300020195|Ga0163150_10471379 | All Organisms → cellular organisms → Bacteria → PVC group | 560 | Open in IMG/M |
| 3300021086|Ga0179596_10655063 | Not Available | 532 | Open in IMG/M |
| 3300021181|Ga0210388_11600995 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 541 | Open in IMG/M |
| 3300021401|Ga0210393_11395973 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 559 | Open in IMG/M |
| 3300021402|Ga0210385_11290762 | Not Available | 559 | Open in IMG/M |
| 3300021420|Ga0210394_10983601 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 731 | Open in IMG/M |
| 3300021420|Ga0210394_11573970 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 554 | Open in IMG/M |
| 3300021962|Ga0222713_10766104 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300022835|Ga0224537_1017488 | Not Available | 608 | Open in IMG/M |
| 3300025463|Ga0208193_1080069 | All Organisms → cellular organisms → Bacteria → PVC group | 656 | Open in IMG/M |
| 3300025507|Ga0208188_1131501 | All Organisms → cellular organisms → Bacteria → PVC group | 542 | Open in IMG/M |
| 3300025548|Ga0208716_1073668 | All Organisms → cellular organisms → Bacteria → PVC group | 697 | Open in IMG/M |
| 3300025648|Ga0208507_1130726 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 709 | Open in IMG/M |
| 3300025807|Ga0208828_1117429 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 599 | Open in IMG/M |
| 3300025838|Ga0208872_1194738 | Not Available | 676 | Open in IMG/M |
| 3300025852|Ga0209124_10123605 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300026116|Ga0207674_12105432 | All Organisms → cellular organisms → Bacteria → PVC group | 528 | Open in IMG/M |
| 3300026823|Ga0207759_119230 | All Organisms → cellular organisms → Bacteria → PVC group | 530 | Open in IMG/M |
| 3300026895|Ga0207758_1026926 | All Organisms → cellular organisms → Bacteria → PVC group | 543 | Open in IMG/M |
| 3300027819|Ga0209514_10177571 | All Organisms → cellular organisms → Bacteria → PVC group | 1099 | Open in IMG/M |
| 3300027860|Ga0209611_10510574 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 674 | Open in IMG/M |
| 3300027903|Ga0209488_10991999 | Not Available | 582 | Open in IMG/M |
| 3300028560|Ga0302144_10172519 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 699 | Open in IMG/M |
| 3300028748|Ga0302156_10244105 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 824 | Open in IMG/M |
| 3300028779|Ga0302266_10338441 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300028792|Ga0307504_10410234 | All Organisms → cellular organisms → Bacteria → PVC group | 535 | Open in IMG/M |
| 3300028873|Ga0302197_10200209 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 933 | Open in IMG/M |
| 3300029911|Ga0311361_10002560 | All Organisms → cellular organisms → Bacteria | 39054 | Open in IMG/M |
| 3300029911|Ga0311361_10099877 | All Organisms → cellular organisms → Bacteria | 4124 | Open in IMG/M |
| 3300029911|Ga0311361_11219773 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300029915|Ga0311358_10252244 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1541 | Open in IMG/M |
| 3300029915|Ga0311358_10412712 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 1086 | Open in IMG/M |
| 3300029922|Ga0311363_10772860 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300029953|Ga0311343_11063845 | Not Available | 629 | Open in IMG/M |
| 3300029956|Ga0302150_10391348 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300029990|Ga0311336_10880192 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 774 | Open in IMG/M |
| 3300029990|Ga0311336_11700955 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 557 | Open in IMG/M |
| 3300029992|Ga0302276_10218598 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 870 | Open in IMG/M |
| 3300030004|Ga0302186_10298826 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 538 | Open in IMG/M |
| 3300030294|Ga0311349_11692619 | All Organisms → cellular organisms → Bacteria → PVC group | 585 | Open in IMG/M |
| 3300030294|Ga0311349_11841400 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 558 | Open in IMG/M |
| 3300030339|Ga0311360_11249944 | Not Available | 583 | Open in IMG/M |
| 3300030620|Ga0302046_11090401 | All Organisms → cellular organisms → Bacteria → PVC group | 632 | Open in IMG/M |
| 3300030838|Ga0311335_11231895 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031232|Ga0302323_100799607 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 1037 | Open in IMG/M |
| 3300031258|Ga0302318_10042557 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 1786 | Open in IMG/M |
| 3300031525|Ga0302326_12994378 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300031576|Ga0247727_10316610 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300031708|Ga0310686_110827784 | Not Available | 716 | Open in IMG/M |
| 3300031708|Ga0310686_118303116 | Not Available | 717 | Open in IMG/M |
| 3300031772|Ga0315288_11062716 | All Organisms → cellular organisms → Bacteria → PVC group | 713 | Open in IMG/M |
| 3300031788|Ga0302319_10007277 | All Organisms → cellular organisms → Bacteria | 21794 | Open in IMG/M |
| 3300031820|Ga0307473_11237694 | All Organisms → cellular organisms → Bacteria → PVC group | 556 | Open in IMG/M |
| 3300031834|Ga0315290_11379784 | All Organisms → cellular organisms → Bacteria → PVC group | 577 | Open in IMG/M |
| 3300031873|Ga0315297_11390290 | All Organisms → cellular organisms → Bacteria → PVC group | 570 | Open in IMG/M |
| 3300031879|Ga0306919_10170158 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 1603 | Open in IMG/M |
| 3300031897|Ga0318520_10919774 | All Organisms → cellular organisms → Bacteria → PVC group | 551 | Open in IMG/M |
| 3300031902|Ga0302322_101479170 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 829 | Open in IMG/M |
| 3300031997|Ga0315278_12041319 | All Organisms → cellular organisms → Bacteria → PVC group | 534 | Open in IMG/M |
| 3300032042|Ga0318545_10355198 | All Organisms → cellular organisms → Bacteria → PVC group | 528 | Open in IMG/M |
| 3300032076|Ga0306924_11446114 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 731 | Open in IMG/M |
| 3300032118|Ga0315277_11402510 | All Organisms → cellular organisms → Bacteria → PVC group | 605 | Open in IMG/M |
| 3300032143|Ga0315292_10973660 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300032163|Ga0315281_12281017 | All Organisms → cellular organisms → Bacteria → PVC group | 511 | Open in IMG/M |
| 3300032397|Ga0315287_12110059 | All Organisms → cellular organisms → Bacteria → PVC group | 617 | Open in IMG/M |
| 3300032401|Ga0315275_10356753 | Not Available | 1638 | Open in IMG/M |
| 3300032401|Ga0315275_12507040 | All Organisms → cellular organisms → Bacteria → PVC group | 533 | Open in IMG/M |
| 3300032516|Ga0315273_11252970 | All Organisms → cellular organisms → Bacteria → PVC group | 930 | Open in IMG/M |
| 3300033416|Ga0316622_101524825 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300033480|Ga0316620_11787456 | All Organisms → cellular organisms → Bacteria → PVC group | 610 | Open in IMG/M |
| 3300033483|Ga0316629_10361217 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1008 | Open in IMG/M |
| 3300033486|Ga0316624_12076679 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 528 | Open in IMG/M |
| 3300033488|Ga0316621_10522394 | All Organisms → cellular organisms → Bacteria → PVC group | 833 | Open in IMG/M |
| 3300033890|Ga0334810_133382 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 598 | Open in IMG/M |
| 3300034156|Ga0370502_0218475 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin006 | 609 | Open in IMG/M |
| 3300034157|Ga0370506_083360 | All Organisms → cellular organisms → Bacteria → PVC group | 700 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 11.51% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.35% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.91% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.76% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 5.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.04% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.60% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.16% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.16% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 2.16% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.44% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.44% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 1.44% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.44% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.44% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.44% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.44% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.44% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.72% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.72% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.72% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.72% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.72% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.72% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300002347 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219) | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005901 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012168 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020057 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2 | Environmental | Open in IMG/M |
| 3300020195 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IB | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022835 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E2 10-14 | Environmental | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025548 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025648 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025807 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_160m (SPAdes) | Environmental | Open in IMG/M |
| 3300025838 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025852 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026823 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19 (SPAdes) | Environmental | Open in IMG/M |
| 3300026895 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300030004 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033890 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-M | Environmental | Open in IMG/M |
| 3300034156 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18 | Environmental | Open in IMG/M |
| 3300034157 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1037021231 | 3300001213 | Wetland | MHTPFFPALRCRLAALGRRTTTSLRQSTLAQLQQQLREFLPPPL |
| JGI12712J15308_100425361 | 3300001471 | Forest Soil | METPYFPQFRSRLAALGHRTHSMRQATLVQLQERLRDFLPAPLLS |
| JGIcombinedJ26865_10754682 | 3300002347 | Arctic Peat Soil | MHTPYFPCLRSRLAPLGRRTTPNLRQTTLAQLQQHLRDFLPAPLL |
| Ga0066599_1010151371 | 3300004282 | Freshwater | MTPYFPALRSRLAALGRRTAQTVRQTTLAQLQEQLRDLLPAPLLS |
| Ga0070697_1017007932 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTPYFPALRSRVAALGRRTARTIRQATLDQLQEHLRDLLPAPLLSA |
| Ga0066661_104128912 | 3300005554 | Soil | MHTPYFPTLRSRLAALGRRTAHHTQQTTLVQLQQQLGDFLPPPLLCPQ |
| Ga0070762_112184182 | 3300005602 | Soil | MTTPYFPVFRSRLAALGRRTARTLRQTTLAQLQQHLR |
| Ga0070764_107265902 | 3300005712 | Soil | MNTPFFPEFRSRLAALGRRTTQTLRQTTLAQLQRHLSDFIPAPLLSAEDEGPNS |
| Ga0074473_101644572 | 3300005830 | Sediment (Intertidal) | MNTPFFPHWRSRLAALGRRTLRTVRQATLAQLQEHLRDFLPAPLLS |
| Ga0075274_10629921 | 3300005901 | Rice Paddy Soil | METPYFPCLRSRLAALGRRSAQTLRQATLTQLQEHLRELLPPPLLSATDEGPN |
| Ga0066651_105604391 | 3300006031 | Soil | MLHTPYFPTLRSRLAALGRRTAQTLRQTTLSQLQEHLRDLLPVPLLC |
| Ga0075023_1002356193 | 3300006041 | Watersheds | MSTPFFPAFRSRLAALGRRTAHAIRQATLAQLQQHLGDYL |
| Ga0075015_1005891912 | 3300006102 | Watersheds | MSTPFFPTFRSRLAALGRRTAHALGQATLVQLQQHLGDYLPAGLLSAEEEGAHS |
| Ga0079037_1015619751 | 3300006224 | Freshwater Wetlands | METPFFPALRARLAAYGRRSLQTVRQWTLAQLGQQLHDLL |
| Ga0099794_108069232 | 3300007265 | Vadose Zone Soil | MHTPYFPALRSGLAALGRRTAHALRQATLGQLQEHLR |
| Ga0066709_1040861951 | 3300009137 | Grasslands Soil | MLTPYFPALRSRLAALGRRTAHSLRQATLGQLQEHLRDLLPAPLFSAEDQ |
| Ga0113563_127599411 | 3300009167 | Freshwater Wetlands | MHTPFFPVFRARFAALGRRTASPLRQNTLQQLAQHLA |
| Ga0116229_112814722 | 3300009500 | Host-Associated | MHTPFFPAFRPRLAALGRRTAQTLRQTTLAQLQHHLRDFLPPPLLA |
| Ga0116222_10403392 | 3300009521 | Peatlands Soil | MHTPCFPAFRSRLAALGRRTTPNLRQTTLAQLQQHLRDFLPAPLLGRGGRPQQP* |
| Ga0116218_14746531 | 3300009522 | Peatlands Soil | MPTPYFPAFRSRLAALGRRTVQGLRQATLAQLQQHLRDFLPAPLLAAE |
| Ga0116107_10289191 | 3300009548 | Peatland | MHTPYFPTFRCRLAALGRRTTHSVRQATLAQLEEHLRDFLPAPL |
| Ga0116133_11437371 | 3300009623 | Peatland | MHTPFFPAFRSRLAALGRRTAHTLRQATLTQLQQHLRDVLSPP |
| Ga0116122_10777983 | 3300009639 | Peatland | MHTPYFSILRSRLAALGRRTARVIRQATLAQLQEQLRDFLPAPLLSAED |
| Ga0116121_11040551 | 3300009644 | Peatland | MHTPLFPAFRPRLAALGRRTAHTLRQATLTQLQEHLRNLLPAPLALGYR* |
| Ga0116227_114126341 | 3300009709 | Host-Associated | MNTPCFPAFRSRLAALGRHTTQTVRQTTLAQLQQHLRDFL |
| Ga0116130_11492361 | 3300009762 | Peatland | MPTPYFPAIRSRLAALGRRTVHGLRQATLAQLQEHLRDF |
| Ga0134071_105492782 | 3300010336 | Grasslands Soil | MQTPYFPSFRSRLAALGRRAAQTIRQATLNQLQEHLRNLLPVPLLSATDEGP |
| Ga0126377_118532182 | 3300010362 | Tropical Forest Soil | MNTPNTPYFPALRSRLAALGRRTAQHLRQTTMAQLQYHLHDLLPAPLLCSEDQ |
| Ga0137457_12897471 | 3300011443 | Soil | MNTPCFPHWRSRLAALGRRTTQTVRQTTLTQLQQHLRDFLPAP |
| Ga0137389_117785072 | 3300012096 | Vadose Zone Soil | MHTPYFPALRSRLAALGRRTAQTVRQTTVAQLQAHLRD |
| Ga0137357_10959153 | 3300012168 | Soil | MNTSFFPPWRGRLAALGRRTTHALRQTTMAQLQQHLRDFLPAPLLST |
| Ga0137365_101021003 | 3300012201 | Vadose Zone Soil | MDTPYFCAFRSRLAALGRRTAQTIRQATLGQLQEHLAHLLPAPLLSATDEG |
| Ga0137362_109661071 | 3300012205 | Vadose Zone Soil | MHTPYFPALRSGLAALGRRTAHALRQATLGQLQEHLRHLLPAPLLSATD |
| Ga0137370_105990981 | 3300012285 | Vadose Zone Soil | MQTPYFPTFRSRLAALGRRTAGSLRQATLAQLQQHL |
| Ga0137367_104282842 | 3300012353 | Vadose Zone Soil | MHTPYFPALRSRLAALGRRTAHSLRQTTLAQLQEYLRD |
| Ga0137360_115549102 | 3300012361 | Vadose Zone Soil | MRDTPFFPAFRCRLAALGRRSFQPLRQNTLAQFQEQMRNLIPAHLLSQE |
| Ga0137358_109446492 | 3300012582 | Vadose Zone Soil | MHTPYFPSLHCRLAALGRRTAKTVRQATLAQLQHNLRQLLPAPLLSAEDEG |
| Ga0137398_109379962 | 3300012683 | Vadose Zone Soil | MQTLYFPSLRSRLAALGRRTAGSIRQGTLSQLQEHLR |
| Ga0137416_118354201 | 3300012927 | Vadose Zone Soil | MPTPYFPAFRSRLAPLGRRTVQTLRQTTLAQLQQHLRDFLPPPLLAAE |
| (restricted) Ga0172369_104142142 | 3300013125 | Freshwater | MHTPFLPAFRSRLAALGRRAAATLRQATLGQLQDQLRDLLPA |
| Ga0181521_104263421 | 3300014158 | Bog | MPTPFFPAFRSRLAALGRRTVHSLRQATLAQLQEHLRDFLPAPLLAAQDNGPNSRQ |
| Ga0181528_101788964 | 3300014167 | Bog | MVVVTPFFPGLRSRLAALGRRTAHPLRQTTLVQLQ |
| Ga0181531_109497472 | 3300014169 | Bog | MNTPVFPAFRSRLAALGRRTVQLRQATLGQLQEHLRDFLPAQL |
| Ga0181535_100720113 | 3300014199 | Bog | MDTPFFPPWRSRLAALGRRTAHALRQTTLSQLQQHLRDVLPAPLLSATDQGPN |
| Ga0182019_103598793 | 3300014498 | Fen | MHTPYFPAFRSRLAALGRRTAGTLRQATLEQLQQH |
| Ga0182021_134030132 | 3300014502 | Fen | MHTPLFPAFRSRLAALGRRTARTLRQATLAQLQEHLRNL |
| Ga0180087_10878113 | 3300014872 | Soil | MLTPYFPALRSRLAALGRRTTQTVRQATLAQLQEHLRDLL |
| Ga0137405_12119631 | 3300015053 | Vadose Zone Soil | MHTPYLPAFRSRLAALGRRTVHSVRQATLAQLQQHLRDLLPDPLLSSEDEGCSHPKMK |
| Ga0182040_117144581 | 3300016387 | Soil | MSHTPYFPAFRSRLAAQGRRTAHSVRQATLGQLQAHFRQLLPAPLLSSEE |
| Ga0187854_102519481 | 3300017938 | Peatland | MKRYIYRPMPTPYFPAIRSRLAALGRRTVHGLRQATLAQLQEHLRDFLPAP |
| Ga0187782_113784361 | 3300017975 | Tropical Peatland | MHTPCFPALRSRLAALGRRTAQKLRDYTLDQLDDCL |
| Ga0181520_109684142 | 3300017988 | Bog | MSTTPFFPAFRSRLASLGRGVSRTLPRLRQCTLSQIEA |
| Ga0187860_13524812 | 3300018014 | Peatland | MHTPYFSILRSRLAALGRRTARVIRQATLAQLQEQLRDFLPAPLL |
| Ga0187866_11097761 | 3300018015 | Peatland | MPTPFFPAFRSRLAALGRRTVHSLRQATLAQLQEHLRDFLPAPLLAAQDNGPN |
| Ga0187864_103576652 | 3300018022 | Peatland | MPTPYFPCLRSRLAPLGRRTTQRLRQTTLAQLQQHLRDFLPAPLLSAEEDGPNSR |
| Ga0187881_104176111 | 3300018024 | Peatland | MPTPFFPAFRSRLAALGRRTVHSLRQATPAQLQEHLR |
| Ga0187862_104141323 | 3300018040 | Peatland | MHTPYFSILRSRLAALGRRTARVIRQATLAQLQEQLRDFLPAPLLSAEDQGPNSR |
| Ga0187887_105613802 | 3300018043 | Peatland | MHTPLFPAFRPRLAALGRRTAHTLRQATLTQLQEHLRN |
| Ga0187890_105683881 | 3300018044 | Peatland | MHTPCFPCWRSRLAALGRRTTQNLRQTTLAQLQQHLRDFLPAPLLS |
| Ga0184639_105138101 | 3300018082 | Groundwater Sediment | MLTPYFPALRSRLAALGRRAAQTVLQTTLAQLQEHLRDLLPAPLL |
| Ga0187894_102311623 | 3300019360 | Microbial Mat On Rocks | MHTPFLPAFRSRLAALGRRTVHSLRQATLGQLQDRIRDLLPAPLLASQEAGPNSR |
| Ga0193697_11183581 | 3300020005 | Soil | MHTAYFPALRSRLAAMGRRTAQTVRQATLRQLQEHLRDFLPAPLLSSEDEGLNS |
| Ga0163151_105497151 | 3300020057 | Freshwater Microbial Mat | MNTPFFPRWRGRLAALGRRSAHPLRQTTLAQLQQHLRDFLPAPLLSSEDEG |
| Ga0163150_104713791 | 3300020195 | Freshwater Microbial Mat | MNTPFFPRWRGRLAALGRRSAHPLRQTTLAQLQQHLRDFLPAPLLSSEDEGLN |
| Ga0179596_106550632 | 3300021086 | Vadose Zone Soil | MQTPYFPSFRSRLAALGRRTAHHLRQVTLGQLQDHLRDLLPVPLLS |
| Ga0210388_116009952 | 3300021181 | Soil | MRTPYFPALRSRLAAYGRRTATALRQSTLAQLQQQLRDFLPAPLL |
| Ga0210393_113959731 | 3300021401 | Soil | MTTPYFPVFRSRLAALGRRTARTLRQTTLAQLQQHLRDFLPPPLLSAED |
| Ga0210385_112907621 | 3300021402 | Soil | MNTPFFPEFRPRLAALGRRTTQTLRQTTLAQLQRHLSDFIPPPFLSPETE |
| Ga0210394_109836012 | 3300021420 | Soil | MTTPYFPAFRSRLAALGRRTARTLRQTTLAQLQQHLRDFLPPPLLPAEP |
| Ga0210394_115739702 | 3300021420 | Soil | MHTPYFPSLRSRLAPLGRRAAHTVRQGTLAQLQQHLRDFLPAPLLAAEQDG |
| Ga0222713_107661041 | 3300021962 | Estuarine Water | MHTPFFPAFRARLAALGRRTTTHLRQATLQQLGAHLAGL |
| Ga0224537_10174882 | 3300022835 | Soil | MKTPYFPCWRSRLAPLGRRTAPVRQTTLAQLQEHLRDFLPAPL |
| Ga0208193_10800691 | 3300025463 | Peatland | MHTPYFPALRSRLAAWGRRTGAAVRQTTLAQLQTHLHDLLPPPLLAAA |
| Ga0208188_11315012 | 3300025507 | Peatland | MKRYIYRPMPTPYFPAIRSRLAALGRRTVHGLRQATLAQLQEHLRDFLPAPLL |
| Ga0208716_10736682 | 3300025548 | Arctic Peat Soil | MHTPCFPAFRARLAALGRRTTPNLRQTTLAQLQQHLRDFLPAPLLSSE |
| Ga0208507_11307263 | 3300025648 | Freshwater | MHTPWFPAFRSRLAALGGRTAQTLRQTTLVQLQEHLRDFLPPHLLS |
| Ga0208828_11174291 | 3300025807 | Freshwater | MTTPYFPALRPRLAALGRRTAQTVRQTTLAQLQEHL |
| Ga0208872_11947381 | 3300025838 | Freshwater | MHTPCFPAFRSRLAALGRHTAQTLRQTPLAQLQQQLRDF |
| Ga0209124_101236053 | 3300025852 | Arctic Peat Soil | MHTPCFPAFRARLAALGRRTTPNLRQTTLAQLQQHLRDFL |
| Ga0207674_121054322 | 3300026116 | Corn Rhizosphere | MLTTPYFPTLRSRLAALGRRTAQALRQTTLNQLQE |
| Ga0207759_1192302 | 3300026823 | Tropical Forest Soil | MQTPYFPNFRCRLAALGRRTAQRLRQATLAQVQQHLCDLL |
| Ga0207758_10269262 | 3300026895 | Tropical Forest Soil | MQTPYFPNFRCRLAALGRRTAQRLRQATLAQVQQHLCDLLPTPLLSSEDEGL |
| Ga0209514_101775713 | 3300027819 | Groundwater | MHTPFFPAFRSRLAALGRRTTHPLRQTTLAQLQEHLRDFLPAPLLAA |
| Ga0209611_105105742 | 3300027860 | Host-Associated | MHTPFFPAFRPRLAALGRRTAQTLRQTTLAQLQHHLRDFLPPPLLAAEDEGPNSR |
| Ga0209488_109919992 | 3300027903 | Vadose Zone Soil | METPYFPPLRSRLAALGRRTAQTIRQATLGQLQEH |
| Ga0302144_101725193 | 3300028560 | Bog | MVMVTPFFPGLRSRLAALGRRTAHTLRQTTLVQLQQHLRDLLPAPLLS |
| Ga0302156_102441053 | 3300028748 | Bog | MVMVTPFFPGLRSRLAALGRRTAHTLRQTTLVQLQQHLRDLLPAP |
| Ga0302266_103384411 | 3300028779 | Bog | MHTPFFPAFRSRLAALGRHTKPLRQATLAQLQEHLRDFLPAALLAS |
| Ga0307504_104102341 | 3300028792 | Soil | MLITPYFPSLRSRLAALGRRTAQALRQTTLNQLQEHLRDLLPVPLLSA |
| Ga0302197_102002091 | 3300028873 | Bog | MKTPYFPCWRSRLAPLGRRTTQNLRQTTLAQFQQHLRDFLPAPL |
| Ga0311361_100025601 | 3300029911 | Bog | MVLVTPFFPLFRARLAALGRRTAHTLRQTTLVQLQQHLRDLLPAPLLSAEDEGP |
| Ga0311361_100998775 | 3300029911 | Bog | MVMVTPFFPGLRSRLAALGRRTAHTLRQTTLVQLQQHLRDLLPAPLLSAEDEGP |
| Ga0311361_112197732 | 3300029911 | Bog | MITPCFPAFRPRLAALGRRTVHSLRQATLAQLQDQLR |
| Ga0311358_102522443 | 3300029915 | Bog | MNTPFFPAFRPRLAALGRRTEPLRQATLAQLQEHFRACLPPG |
| Ga0311358_104127123 | 3300029915 | Bog | MVLVTPFFPLFRARLAALGRRTAHTLRQTTLVQLQQHLRDLLPAPLL |
| Ga0311363_107728603 | 3300029922 | Fen | MITPCFPAFRPRLAALGRRTVHSLRQATLAQLQDQLRDFLPAPLLSSEDE |
| Ga0311343_110638451 | 3300029953 | Bog | MNTPYFPAFRPRLAALGRHTVATVRQTALAQLQQHLRDFLPAPLLSAEDEGL |
| Ga0302150_103913481 | 3300029956 | Bog | MNTPFFPAFRPRLAALGRRTEPLRQATLAQLQEHFRACL |
| Ga0311336_108801922 | 3300029990 | Fen | MHTPFFPAFRSRLAGLGRRTTQTFRQTTLAQLQQQLRDCLPLS |
| Ga0311336_117009551 | 3300029990 | Fen | MNTPYFPPFRSRLAALGRRTVQPVRQTTLAQLQLHLRD |
| Ga0302276_102185982 | 3300029992 | Bog | MVLVTPFFPLFRARLAALGRRTAHTLRQTTLVQLQQ |
| Ga0302186_102988262 | 3300030004 | Bog | MKTPYFPCWRSRLAPLGRRTTQNLRQTTLAQFQQHLRDFLPAPLLSSEEDGPNSRD |
| Ga0311349_116926191 | 3300030294 | Fen | MHTPYFPCFRSRLAALGRRTAKTIRQATLDQLQQHLRNLLP |
| Ga0311349_118414002 | 3300030294 | Fen | MHTPFFPAFRSRLAGLGRRTTQTFRQTTLAQLQQQLRDCLPLSLLS |
| Ga0311360_112499441 | 3300030339 | Bog | MKTPYFPCWRSRLAPLGRRTTQNLRQTTLAQFQQHLRDFLPAPLLSSEEDGP |
| Ga0302046_110904011 | 3300030620 | Soil | MNTPFFPALRSRLAALGRRTVSTLRQATLSQLQEQLRGL |
| Ga0311335_112318952 | 3300030838 | Fen | MHTPYFPAFRSRLAALGRRTAGTLRQATLEQLQQHLR |
| Ga0302323_1007996073 | 3300031232 | Fen | MHTPYFPAFRSRLAALGRRTAGTLRQATLEQLQQHLRDLLPAPLL |
| Ga0302318_100425574 | 3300031258 | Bog | MVLVTPFFPLFRARLAALGRRTAHTLRQTTLVQLQQHL |
| Ga0302326_129943781 | 3300031525 | Palsa | MKTPFFPAFRARLAALGRRTARSLRQATLAQFQEQLRDCLPIPLLSGE |
| Ga0247727_103166103 | 3300031576 | Biofilm | MNTPFFPAFRSRLAAVGRRTARTLRQATLGQLQEQIRDL |
| Ga0310686_1108277842 | 3300031708 | Soil | MNTPYFPPFRSRLAPLGRRSVQPVRQATLAQLQQHLRDFL |
| Ga0310686_1183031163 | 3300031708 | Soil | METPYFPDWRSRLAALGRRCVPSVRQATLAQLQEHLRDFLPAPLLSAQDDGPNSRD |
| Ga0315288_110627161 | 3300031772 | Sediment | MHPPYFPALRSRLAALGRRTAQTVRQATLAQLQEHLRDFLPAPLLSAE |
| Ga0302319_1000727720 | 3300031788 | Bog | MVLVTPFFPLFRARLAALGRRTAHTLRQTTLVQLQQHLRDLLPAPL |
| Ga0307473_112376942 | 3300031820 | Hardwood Forest Soil | MLTTPYFPTLRSGLAALGRRTAQALRQTTLNQLQEHLRDLLPVPLLSAEDE |
| Ga0315290_113797842 | 3300031834 | Sediment | MHTPYFPAFRSRLAALGRRTAHLLRQATLAQIEEHLRDFLPAPLL |
| Ga0315297_113902901 | 3300031873 | Sediment | MLTPYFPALRSRLAALGRRTDQTVRQTTLTQLQQHLHDLLPAPLLAS |
| Ga0306919_101701583 | 3300031879 | Soil | MSTPFFPAFRCRLAALGRRTAHLLRQATLAQLQQQVGDYLPAGLLASEEEGPN |
| Ga0318520_109197742 | 3300031897 | Soil | MPTPFFPAFRCRLAALGRRTAHLLRQATLAQLQQQVGDYLPAGLLAS |
| Ga0302322_1014791703 | 3300031902 | Fen | MNTPYFPSFRSRLAALGRRTVQRVRQTTLAQLQQHLRDFLPPGLLSAEE |
| Ga0315278_120413191 | 3300031997 | Sediment | MHTPFFPAWRSRLAALGRRTARAVRPAILAQLQEH |
| Ga0318545_103551982 | 3300032042 | Soil | MSTPFFPAFRCRLAALGRRTAHLLRQATLAQLQQQVGDYLPAGLLASEEQG |
| Ga0306924_114461141 | 3300032076 | Soil | MSTPFFPAFRCRLAALGRRTAHLLRQATLAQLQQQVGDYLPAG |
| Ga0315277_114025101 | 3300032118 | Sediment | MHTPYFPAFRSRLAALGRRTAHLLRQATLAQLEEHLRDFLP |
| Ga0315292_109736603 | 3300032143 | Sediment | MHTPFFPAWRSRLAALGRRTARAVRETTLAQLQDYLRDFLP |
| Ga0315281_122810172 | 3300032163 | Sediment | MLTPYFPALRARLAARGRRTAQTVRQTTLAQLQEHLRDLLPAPLLA |
| Ga0315287_121100592 | 3300032397 | Sediment | MHTPYFPAFRSRLAALGRRTAHLLRQATLAQIEEHLRDF |
| Ga0315275_103567531 | 3300032401 | Sediment | MNTPCFPAFRCRLAALGHRTLHTVRQTTLTQLQQHLSDLLPAPLLCAEEDG |
| Ga0315275_125070401 | 3300032401 | Sediment | MHTPYFPALRSRLAALGRRTAQTVRQATLGQLQEHCRDLIPELLT |
| Ga0315273_112529703 | 3300032516 | Sediment | MNTPYFPAFRCRLAALGRHTRHAVRQTTLAQLQQHLSDLLPAPLLCAAEDGPNS |
| Ga0316622_1015248251 | 3300033416 | Soil | MHTPYFPSFRPHLAALGRRTTQRLRLTTLAQLQEHLSDFLPPPL |
| Ga0316620_117874561 | 3300033480 | Soil | MHTPFFPAWRSRLAALGRRTARAVRQATLAQLQEHLRDFLPAPLLSAEDEGPNSRE |
| Ga0316629_103612172 | 3300033483 | Soil | RRRYIYRPMHTPFLPAFRSRLAALGRRTARSLRQATLGPLQDQIRDLLPAPLLSTEEDGP |
| Ga0316624_120766792 | 3300033486 | Soil | MHTHFFPAFRSRLAALGRRTAQAIRQATLSQLQEHLRNLLPAPLLSATEEG |
| Ga0316621_105223941 | 3300033488 | Soil | MPETPFFPAFRARLAALGRRTATTIRQATLAQLQEHLREFLPAQVLAAADEGPHS |
| Ga0334810_133382_483_596 | 3300033890 | Soil | MKTPYFPCWRSRLAPLGRRTAPVRQTTLAQLQKHLRDF |
| Ga0370502_0218475_479_607 | 3300034156 | Untreated Peat Soil | MHTPLFPAFRSRLAALGRRTAHTLRQATLAQLQEHLRNLLPAP |
| Ga0370506_083360_1_111 | 3300034157 | Untreated Peat Soil | MNTPFFPSFRPRLAALGRRTLQRLRQTTLAQLQEQIR |
| ⦗Top⦘ |