| Basic Information | |
|---|---|
| Family ID | F054960 |
| Family Type | Metagenome |
| Number of Sequences | 139 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRHTSSREIRS |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 19.42 % |
| % of genes near scaffold ends (potentially truncated) | 99.28 % |
| % of genes from short scaffolds (< 2000 bps) | 92.81 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.842 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (13.669 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.619 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.079 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.39% β-sheet: 0.00% Coil/Unstructured: 67.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF01757 | Acyl_transf_3 | 6.47 |
| PF13091 | PLDc_2 | 6.47 |
| PF08386 | Abhydrolase_4 | 5.04 |
| PF13602 | ADH_zinc_N_2 | 2.16 |
| PF01699 | Na_Ca_ex | 1.44 |
| PF04365 | BrnT_toxin | 1.44 |
| PF16884 | ADH_N_2 | 1.44 |
| PF15919 | HicB_lk_antitox | 1.44 |
| PF05128 | DUF697 | 0.72 |
| PF01425 | Amidase | 0.72 |
| PF00282 | Pyridoxal_deC | 0.72 |
| PF00211 | Guanylate_cyc | 0.72 |
| PF04191 | PEMT | 0.72 |
| PF13155 | Toprim_2 | 0.72 |
| PF13847 | Methyltransf_31 | 0.72 |
| PF13302 | Acetyltransf_3 | 0.72 |
| PF06782 | UPF0236 | 0.72 |
| PF00672 | HAMP | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 1.44 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 1.44 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 1.44 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.72 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.72 |
| COG3768 | Uncharacterized membrane protein YcjF, UPF0283 family | Function unknown [S] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.84 % |
| Unclassified | root | N/A | 2.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01BL2VY | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
| 2199352025|deepsgr__Contig_117209 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 549 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1009971 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1247 | Open in IMG/M |
| 3300000955|JGI1027J12803_109219610 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 545 | Open in IMG/M |
| 3300000956|JGI10216J12902_110131301 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300001991|JGI24743J22301_10067980 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300002126|JGI24035J26624_1011737 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300002128|JGI24036J26619_10048193 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300002128|JGI24036J26619_10067312 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300003203|JGI25406J46586_10166284 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300004114|Ga0062593_101637793 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 700 | Open in IMG/M |
| 3300004114|Ga0062593_103518605 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 3300004479|Ga0062595_102482897 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005172|Ga0066683_10427172 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 815 | Open in IMG/M |
| 3300005288|Ga0065714_10190479 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300005331|Ga0070670_100332711 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300005332|Ga0066388_106672757 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005339|Ga0070660_100064547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2848 | Open in IMG/M |
| 3300005344|Ga0070661_100277743 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300005344|Ga0070661_100297197 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300005347|Ga0070668_100206536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1614 | Open in IMG/M |
| 3300005354|Ga0070675_100067491 | All Organisms → cellular organisms → Bacteria | 2960 | Open in IMG/M |
| 3300005434|Ga0070709_11049201 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 650 | Open in IMG/M |
| 3300005451|Ga0066681_10490949 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 756 | Open in IMG/M |
| 3300005554|Ga0066661_10837631 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 538 | Open in IMG/M |
| 3300005556|Ga0066707_10372808 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 931 | Open in IMG/M |
| 3300005560|Ga0066670_10531060 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 721 | Open in IMG/M |
| 3300005566|Ga0066693_10241391 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 713 | Open in IMG/M |
| 3300005566|Ga0066693_10351803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300005574|Ga0066694_10232090 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300005576|Ga0066708_10015719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3738 | Open in IMG/M |
| 3300005615|Ga0070702_100458860 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 926 | Open in IMG/M |
| 3300005764|Ga0066903_100400516 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
| 3300005764|Ga0066903_101740661 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300005764|Ga0066903_105659250 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 657 | Open in IMG/M |
| 3300005764|Ga0066903_105722309 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 653 | Open in IMG/M |
| 3300005764|Ga0066903_106122689 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 629 | Open in IMG/M |
| 3300005764|Ga0066903_106548637 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 607 | Open in IMG/M |
| 3300005937|Ga0081455_10732569 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 627 | Open in IMG/M |
| 3300005983|Ga0081540_1346910 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 508 | Open in IMG/M |
| 3300006031|Ga0066651_10118464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1356 | Open in IMG/M |
| 3300006058|Ga0075432_10526412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300006237|Ga0097621_100158044 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
| 3300006796|Ga0066665_10195420 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300006796|Ga0066665_10978942 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales | 650 | Open in IMG/M |
| 3300009137|Ga0066709_103740516 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 552 | Open in IMG/M |
| 3300009177|Ga0105248_12612053 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300009553|Ga0105249_13043082 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300009792|Ga0126374_10713407 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300010042|Ga0126314_11204786 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300010047|Ga0126382_10461960 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1009 | Open in IMG/M |
| 3300010301|Ga0134070_10409102 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
| 3300010320|Ga0134109_10331863 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 593 | Open in IMG/M |
| 3300010321|Ga0134067_10331608 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 594 | Open in IMG/M |
| 3300010335|Ga0134063_10613414 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010337|Ga0134062_10549572 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 588 | Open in IMG/M |
| 3300010360|Ga0126372_10693893 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300010360|Ga0126372_10920619 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 879 | Open in IMG/M |
| 3300010362|Ga0126377_12092039 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300010366|Ga0126379_11797552 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300010366|Ga0126379_12237680 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300010376|Ga0126381_101380232 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300010398|Ga0126383_13649430 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 3300012096|Ga0137389_11607014 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 546 | Open in IMG/M |
| 3300012198|Ga0137364_10055728 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2651 | Open in IMG/M |
| 3300012199|Ga0137383_10096410 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2145 | Open in IMG/M |
| 3300012207|Ga0137381_10652518 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300012210|Ga0137378_10224939 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1747 | Open in IMG/M |
| 3300012356|Ga0137371_10308614 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300012913|Ga0157298_10392046 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012929|Ga0137404_10121443 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2136 | Open in IMG/M |
| 3300012929|Ga0137404_11051914 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 746 | Open in IMG/M |
| 3300012944|Ga0137410_10763953 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300012971|Ga0126369_11474462 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300012971|Ga0126369_12338974 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300012972|Ga0134077_10317482 | Not Available | 657 | Open in IMG/M |
| 3300012988|Ga0164306_11126957 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 654 | Open in IMG/M |
| 3300014154|Ga0134075_10430913 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300014157|Ga0134078_10214352 | Not Available | 792 | Open in IMG/M |
| 3300014969|Ga0157376_10774128 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 970 | Open in IMG/M |
| 3300015200|Ga0173480_10181874 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300015241|Ga0137418_10075924 | All Organisms → cellular organisms → Bacteria | 3054 | Open in IMG/M |
| 3300015356|Ga0134073_10328249 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 555 | Open in IMG/M |
| 3300015357|Ga0134072_10077437 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 981 | Open in IMG/M |
| 3300015359|Ga0134085_10461841 | Not Available | 577 | Open in IMG/M |
| 3300015372|Ga0132256_100284127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1734 | Open in IMG/M |
| 3300015372|Ga0132256_103835955 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300015373|Ga0132257_102841275 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 631 | Open in IMG/M |
| 3300015374|Ga0132255_104670913 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 580 | Open in IMG/M |
| 3300015374|Ga0132255_105787368 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 523 | Open in IMG/M |
| 3300016371|Ga0182034_10352142 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1196 | Open in IMG/M |
| 3300016404|Ga0182037_11990250 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 521 | Open in IMG/M |
| 3300017936|Ga0187821_10160766 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 852 | Open in IMG/M |
| 3300018027|Ga0184605_10031133 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2199 | Open in IMG/M |
| 3300018051|Ga0184620_10137635 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300018431|Ga0066655_10508623 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300018431|Ga0066655_10852865 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 621 | Open in IMG/M |
| 3300018431|Ga0066655_10962392 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 587 | Open in IMG/M |
| 3300018433|Ga0066667_10306250 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300018482|Ga0066669_10122270 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300019882|Ga0193713_1093212 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 842 | Open in IMG/M |
| 3300019883|Ga0193725_1111613 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300019886|Ga0193727_1019357 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2463 | Open in IMG/M |
| 3300020010|Ga0193749_1095229 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 535 | Open in IMG/M |
| 3300020062|Ga0193724_1036049 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300022756|Ga0222622_10603770 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300022756|Ga0222622_11356760 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 523 | Open in IMG/M |
| 3300025900|Ga0207710_10522963 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 617 | Open in IMG/M |
| 3300025905|Ga0207685_10475508 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 654 | Open in IMG/M |
| 3300025906|Ga0207699_10648145 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 771 | Open in IMG/M |
| 3300025912|Ga0207707_11177525 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 621 | Open in IMG/M |
| 3300025920|Ga0207649_11371588 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 559 | Open in IMG/M |
| 3300025923|Ga0207681_11025179 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300025936|Ga0207670_11035269 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300025941|Ga0207711_11562822 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 603 | Open in IMG/M |
| 3300025941|Ga0207711_11707465 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300025944|Ga0207661_12160250 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 503 | Open in IMG/M |
| 3300025960|Ga0207651_10682789 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300025972|Ga0207668_10910514 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300026035|Ga0207703_11598963 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 627 | Open in IMG/M |
| 3300026089|Ga0207648_10722403 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300026324|Ga0209470_1172231 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 940 | Open in IMG/M |
| 3300026325|Ga0209152_10277944 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300026331|Ga0209267_1199866 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300026332|Ga0209803_1133636 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 978 | Open in IMG/M |
| 3300026530|Ga0209807_1215890 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 661 | Open in IMG/M |
| 3300028828|Ga0307312_11112230 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 523 | Open in IMG/M |
| 3300028875|Ga0307289_10145691 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300028875|Ga0307289_10214532 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 792 | Open in IMG/M |
| 3300028878|Ga0307278_10318607 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 687 | Open in IMG/M |
| 3300031231|Ga0170824_114187565 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300031231|Ga0170824_120104557 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 553 | Open in IMG/M |
| 3300031474|Ga0170818_101817167 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1023 | Open in IMG/M |
| 3300031538|Ga0310888_10624788 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300031716|Ga0310813_12320048 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 509 | Open in IMG/M |
| 3300032001|Ga0306922_10982580 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300032051|Ga0318532_10199757 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300032059|Ga0318533_10581845 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300032060|Ga0318505_10634788 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.16% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.16% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.16% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.44% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.44% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.44% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.72% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Host-Associated | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_11728080 | 2170459005 | Grass Soil | MLDPSADEMRNWGNSVMQLMTEYLGDLRDHRVYGRMSSREIRGRLD |
| deepsgr_01857250 | 2199352025 | Soil | MLDPSDDEMRNWGNSVIQLMTDYLRDIRDHRVYGRIS |
| AP72_2010_repI_A10DRAFT_10099714 | 3300000651 | Forest Soil | MLEPSADEIGEWANSVTQFMIDYLGGLRDRPVYRQTSSREIRSGLD |
| JGI1027J12803_1092196101 | 3300000955 | Soil | MDMLEPSASEMRDWGNSVSQFIIEYLGELRDRPVYRHTSSREIRSGLDW |
| JGI10216J12902_1101313011 | 3300000956 | Soil | MLDPSADEICDWGKSVIKFMTDYLGGLSDRGVYRHMSSRRIRGRLDS |
| JGI24743J22301_100679803 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEPSADEIREWGDSVIEFMTDYLGELRDLPAYRHSSSRE |
| JGI24035J26624_10117371 | 3300002126 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDPSADEIREWGDSVTQFVIEYLGWLRDRPVYRHTSSRE |
| JGI24036J26619_100481931 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEPSADEIREWGDSVIEFMTDYLGELRNRPAXRHSSSREIRSGL |
| JGI24036J26619_100673121 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEPSADEIGEWANSVTQFMIDYLGGLRDRPVYCQTS |
| JGI25406J46586_101662841 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MEMLEPSADEIRDWANLVTQFMIDYLGDLRDRPAYRHTSSHEIR |
| Ga0062593_1016377931 | 3300004114 | Soil | MLEPSADEIGDWGNSVTQFMIDYLGGLRDRPAYRHTSSREIRSGLDS |
| Ga0062593_1035186052 | 3300004114 | Soil | MLDPSDDEMRNWGNSVIQLMTDYLRDLRDHRVYGRMSSREIRDRLD |
| Ga0062595_1024828972 | 3300004479 | Soil | MRMLEPSADEIRDWGNSVTQLMIEYLGNLRDRPVYRQTSSREIRRGLDSK |
| Ga0066683_104271721 | 3300005172 | Soil | MLYPSADEIRDWGNSVTQFMIDYLGGLRDRPVYRHTSSREIRDGLD |
| Ga0065714_101904793 | 3300005288 | Miscanthus Rhizosphere | MLEPSADEIREWGDSVIQFMTDYLGWMRDRPVYRQTSSREIRSGLDLKLP |
| Ga0070670_1003327114 | 3300005331 | Switchgrass Rhizosphere | MLEPSADEIREWGDSIIQFIIEYLGWLRDRPVYRHTSSRAIRSGLESKLPIKG |
| Ga0066388_1066727572 | 3300005332 | Tropical Forest Soil | VNMLEPSADEIREWANSVTQFMIDYLGGLRDRPVYRQTSSR |
| Ga0070660_1000645471 | 3300005339 | Corn Rhizosphere | VNMLEPSADEIREWGDSIIQFIIEYLGWLRDRPVYRHTSS |
| Ga0070661_1002777431 | 3300005344 | Corn Rhizosphere | MLEPSADEIREWGDSVIQFMTDYLGWMRDRPVYRQTSSREIRSGLD |
| Ga0070661_1002971971 | 3300005344 | Corn Rhizosphere | MLEPSADEIREWENAVTQFMIEYLGGLRDRPVYRHTSSREIRSKLDSNLPAKG |
| Ga0070668_1002065363 | 3300005347 | Switchgrass Rhizosphere | MLEPSADEIREWGDSVTRFVIEYVGGLRNRRAYQHTSSREIRSGL |
| Ga0070675_1000674911 | 3300005354 | Miscanthus Rhizosphere | MLEPSADEIREWGDSVIEFMTDYLGELRNRPAYRHSSSREIRSGLDS |
| Ga0070709_110492012 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MDMLEPSPDEIRDWGNSVTQFIIDYLGGLRDRPAYRHTSSREIRSGLDSKLP |
| Ga0066681_104909491 | 3300005451 | Soil | MLDPSADEIRDWGNSVIQLMSDYLRSLRARGVYRHMFSRRIR |
| Ga0066661_108376311 | 3300005554 | Soil | MEMLDPSADEIRDWGNSVIQFMTDYLGDLRARPVYRHTSSHEIR |
| Ga0066707_103728082 | 3300005556 | Soil | MLDPSADEIRDWGNSVIQLMADYLGNLRDRKVYRHMSS |
| Ga0066670_105310602 | 3300005560 | Soil | MLDPSADEIRSWSNSVTQFMVDYLGDLRDRGVYRHMFSRAIRNRLD |
| Ga0066693_102413911 | 3300005566 | Soil | MVDPSADEICSWSNSVTQFMADYLGDLRDRGVYRHMVSRAIR |
| Ga0066693_103518032 | 3300005566 | Soil | MLEPSADEIRKWSNSVAQFMIDYLEGLRRRPVYRHTSSR |
| Ga0066694_102320901 | 3300005574 | Soil | MLDPSADEIRDWSNSVIQLMTDYLGDLRDRPVYRRISSREIRDRLDA |
| Ga0066708_100157195 | 3300005576 | Soil | MDMLDPSADEIRDWGNSVIQFMTDYLGDLRARPVYRHTSSHEIRS |
| Ga0070702_1004588601 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEPSADEIREWENAVTQFMIEYFGELRDRPVYRHTSSREIRS |
| Ga0066903_1004005161 | 3300005764 | Tropical Forest Soil | MLEPSANEIRDWGNSITQFMIEYLGGLRDRPAYRHTSSREI |
| Ga0066903_1017406612 | 3300005764 | Tropical Forest Soil | MLEPSADEIRAWSNSVIQFLTDYLSELRDHPVYRR |
| Ga0066903_1056592502 | 3300005764 | Tropical Forest Soil | MLEPSANEIRDWGDSVIRFMTDYLGNLRDRGVYRHMVSRRIRDRLD |
| Ga0066903_1057223092 | 3300005764 | Tropical Forest Soil | MLEPSADEIRDWGDSVIRFMTDYLGNLRDRGVYRHMVSRRIRDRLD |
| Ga0066903_1061226892 | 3300005764 | Tropical Forest Soil | MLEPSVDEIGEWANSVTQFMIDYLGGLRDRPVYRQTSSREIRSGLDSKLPIKGTDL |
| Ga0066903_1065486371 | 3300005764 | Tropical Forest Soil | MLEPSADEIREWGNSVTQFMIDYLGGLRDRPAYRH |
| Ga0081455_107325692 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLDPSANEMRKWGDSTVQFMTDYLGDLRDRGVYRHMFSRAIRSRL |
| Ga0081540_13469102 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MLDPSSDEIRDWGNSVIQFMTDYLGGLSDRGVYRHMSSKRIRGR |
| Ga0066651_101184641 | 3300006031 | Soil | MLDPSADEIRSWSNSVSQFMADYLGDLRDRGVYRHMVSRAI |
| Ga0075432_105264122 | 3300006058 | Populus Rhizosphere | MLEPSADEIREWGNLVTQFMIEYLGDLRDRPVYRQTSSRELRSGLDSK |
| Ga0097621_1001580441 | 3300006237 | Miscanthus Rhizosphere | MLEPSADEIREWGDSVIEFMTDYLGELRDLPAYRHSSSREIRSGLDS |
| Ga0066665_101954201 | 3300006796 | Soil | MLDPSADEIRDWGNSVIQLMADYLGNLRDRKVYRHMSSR |
| Ga0066665_109789421 | 3300006796 | Soil | MLDPSADEIRDWGNSVIQLMSDYLRSLRDRGVYRHMFSRRI |
| Ga0066709_1037405161 | 3300009137 | Grasslands Soil | MLDPSADEIRDWGNSVIELMADYLGDLRDRRVYRHMSSREIRGRL |
| Ga0105248_126120531 | 3300009177 | Switchgrass Rhizosphere | MLEPSADEIREWENAVTQFMIEYLGGLRDRPVYRHTTSHE |
| Ga0105249_130430821 | 3300009553 | Switchgrass Rhizosphere | MLEPSADEIGEWANSVTQFMIDYLGGLRDRPVHRQTSSREIRSGLDSKLPIKGTD |
| Ga0126374_107134072 | 3300009792 | Tropical Forest Soil | MLEPSADEIHDWGNSISQFMIEYLGSLRDRPAYRHPSSREIRSRLDLKLP |
| Ga0126314_112047861 | 3300010042 | Serpentine Soil | MLEPSADEIRDWGNSITQFTIDYLGGLRDRPAYRHTSSREIRRGLDSKLPIKGT |
| Ga0126382_104619603 | 3300010047 | Tropical Forest Soil | MLEPSADEIREWENAVTQFMVEYLGGLRDRPVYRHTSSREIRSGLDSKL |
| Ga0134070_104091022 | 3300010301 | Grasslands Soil | MLEPSADEIRKWSNSVAQFMIDYLGGLRDRPVYRQSSSREIRSG |
| Ga0134109_103318632 | 3300010320 | Grasslands Soil | MLDPSADEIRDWGNSVIQLMIDYLRTLRDRGVYRHMSSREIRN |
| Ga0134067_103316082 | 3300010321 | Grasslands Soil | MLEPSADELRDWGNSVTQFMIDYLGGLRDRPAYRQTSSREIRSGLDLTLPIRGTA |
| Ga0134063_106134142 | 3300010335 | Grasslands Soil | MLDPSADEIRDWGNSVTEFMIKYLADLRDRRVYRYTSSREIRDGLDAA |
| Ga0134062_105495721 | 3300010337 | Grasslands Soil | MLDPSADEIRNWGNSVIQLMTNYLGDLRDHRVYGRMSSREIR |
| Ga0126372_106938932 | 3300010360 | Tropical Forest Soil | MLEPSADQIREWGNSVTQFMIDYLGGLRGRSVYRQTSSREIRSGLDSKLPI |
| Ga0126372_109206192 | 3300010360 | Tropical Forest Soil | MTMLDPSADELRNWGNSAIQLMTDYLGDLRDRKVYGRMSSREIRD |
| Ga0126377_120920391 | 3300010362 | Tropical Forest Soil | MLDPSADEIRAWGNSVTPFIIEYLGGLRDRPAYRHTSSREIRSGLDSKLP |
| Ga0126379_117975523 | 3300010366 | Tropical Forest Soil | MLEPSADEIREWENAVTQFMIEYLGGLRDRPVYRH |
| Ga0126379_122376802 | 3300010366 | Tropical Forest Soil | MLEPSADEIREWANSVTQFMIDYLGGLRGRPVYRQTSSREIRSGLDSKLPI |
| Ga0126381_1013802323 | 3300010376 | Tropical Forest Soil | MLEPSADEIREWENAVTQFMIEYLGGLRDRPVYRHTSS |
| Ga0126383_136494301 | 3300010398 | Tropical Forest Soil | MLEPSADEIRDWANSVTQFIIDYLGELRDRPVYRHTCSREIRGGFDSKLP |
| Ga0137389_116070142 | 3300012096 | Vadose Zone Soil | MDMLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRHTSSRE |
| Ga0137364_100557284 | 3300012198 | Vadose Zone Soil | MLEPSADEIRDWGNSVIQFMIEYRGGLRARPVYRHTSSREIRSRLDLKLPT |
| Ga0137383_100964104 | 3300012199 | Vadose Zone Soil | MLEPSADEIREWANSVTQFMIDYLGGLRDRPVYRQTSSREIRSGLDS |
| Ga0137381_106525182 | 3300012207 | Vadose Zone Soil | MLDPSADEIRDWGNSVIQLMSDYLGNLRNRGVYRHMFSRRIRDRLDA |
| Ga0137378_102249391 | 3300012210 | Vadose Zone Soil | MLYPSADEIRDWGNSVTQFMIDYLGGLRDRPVYRHTSSREIRDGLDRA |
| Ga0137371_103086141 | 3300012356 | Vadose Zone Soil | MLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRHT |
| Ga0157298_103920461 | 3300012913 | Soil | MLEPSADEIREWGDSIIQFIIEYLGWLRDRPVYRHTSSREIRSGLDSKLPIKGT |
| Ga0137404_101214431 | 3300012929 | Vadose Zone Soil | MNMLEPSAAEIRDWGNSVTQFMIDYLGDLRDRPVYRHIS |
| Ga0137404_110519142 | 3300012929 | Vadose Zone Soil | MLEPSADEIRDWGNSVTQFMIDYLGGLRDRPVYRQTSSHEIRSGLDSKL |
| Ga0137410_107639533 | 3300012944 | Vadose Zone Soil | MLEPSADEIRDWGNSVSQFMIDYLGGLRDRPAYRHTSSREIRSGLD |
| Ga0126369_114744622 | 3300012971 | Tropical Forest Soil | MLEPSANEIRDWGNSITQFMIEYLGGLRDRPAYRHTSSREIRSRLDLELPI |
| Ga0126369_123389742 | 3300012971 | Tropical Forest Soil | MGMLEPSADEIRDWGNSVTQFVNEYLGGLRDCPVYRHMSSLEIRSGLDSKLPV |
| Ga0134077_103174821 | 3300012972 | Grasslands Soil | MLDPSADEIRDWGTSVIQLVADYLGDLRDRKVYRHTSSREIRDWLDAAL |
| Ga0164306_111269573 | 3300012988 | Soil | MLEPSADEIREWGDSIIQFIIEYLGWLRDRPVYRHSSSRAIRTGLESKLPIKGT |
| Ga0134075_104309132 | 3300014154 | Grasslands Soil | MLYPSADEIRDWGNSVTQFMIDYLGGLRDRPVYRHTSSR |
| Ga0134078_102143521 | 3300014157 | Grasslands Soil | MLDPSADEIRDWGNSVIQLMSDYLGDLRDRPVYRHMFSRRI |
| Ga0157376_107741281 | 3300014969 | Miscanthus Rhizosphere | MLEPSADEIREWENAVTQFMIEYFGELRDRPVYRHTSSREIRSGLDSKLPIKGTD |
| Ga0173480_101818741 | 3300015200 | Soil | MLEPSADEIREWGDSVTQFMTDYLGWMRDRPVYRQTSSREI |
| Ga0137418_100759241 | 3300015241 | Vadose Zone Soil | MLDPSADELREWGNSVIQFMADYLGDLRNRNVYRHMSSGRIRNRI |
| Ga0134073_103282491 | 3300015356 | Grasslands Soil | MLEPSADEIRDWGNSVIQFMTDYLGNLRDRSVYRHMSSD |
| Ga0134072_100774371 | 3300015357 | Grasslands Soil | MLEPSADELRDWGNSVTQFMIDYLGGLRDRPAYRHTSSREIRGR |
| Ga0134085_104618412 | 3300015359 | Grasslands Soil | MLDPSADEIRDWGNSVTEFMIKYLGDLRDRRVYRHTSSREIRDR |
| Ga0132256_1002841273 | 3300015372 | Arabidopsis Rhizosphere | MLEPSAAEIREWENAVTQFMIEYLGGLRDRPVYRHTTSHEIRSGLDPKLP |
| Ga0132256_1038359552 | 3300015372 | Arabidopsis Rhizosphere | MLEPSADEIREWSNSVTQFMIDYLAGLRDRPVYRQTSSREIRSGLDSKLPIKG |
| Ga0132257_1028412752 | 3300015373 | Arabidopsis Rhizosphere | MLEPSADEIRKWENAVTQFMIEYLGGLRDRPVYRHTSSREIRS |
| Ga0132255_1046709131 | 3300015374 | Arabidopsis Rhizosphere | MLEPSADEIRKWENAVTQFMIEYLGDLRDRPVYRHTSSREIRSGLDSELP |
| Ga0132255_1057873681 | 3300015374 | Arabidopsis Rhizosphere | MLEPSADEIREWENAVTQFMIEYFGELRDRPVYRHTSSREIRSGL |
| Ga0182034_103521423 | 3300016371 | Soil | MLEPSADEIGEWADSVTQFMIDYLSGLRDRPVYRQTSSREIRSGLDSKLPIK |
| Ga0182037_119902502 | 3300016404 | Soil | MLEPSADEIREWGNSVTQFMIDYLGDLRDRPAYRQTSSGEIRSGLDPKLPI |
| Ga0187821_101607662 | 3300017936 | Freshwater Sediment | MLDPSAGEIRDWGNSVVQSMAEYLGGLRDRNVYRQMSS |
| Ga0184605_100311331 | 3300018027 | Groundwater Sediment | MDMLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRQTSSREIRSGLDSKLP |
| Ga0184620_101376351 | 3300018051 | Groundwater Sediment | MLEPSADEIREWGDSVTRFVIEYLGGLRNRPAYQRT |
| Ga0066655_105086231 | 3300018431 | Grasslands Soil | MLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRHTSSREIRS |
| Ga0066655_108528651 | 3300018431 | Grasslands Soil | MLEPSADEIRDWGNSVIQFMTDYLGNLRDRSVYRHM |
| Ga0066655_109623921 | 3300018431 | Grasslands Soil | MLDPSAEEIRDWGNSIVEFMADYLGDLRDRRVYRRMSSREIRDRL |
| Ga0066667_103062501 | 3300018433 | Grasslands Soil | MLDPSADEIRDWSNSVIQLMTDYLGDLRDRPVYRR |
| Ga0066669_101222701 | 3300018482 | Grasslands Soil | MLEPSADELRDWGNSVTQFMIDYLGGLRDRPAYRHTSSRE |
| Ga0193713_10932123 | 3300019882 | Soil | MLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRHTSSREIRSGLDSK |
| Ga0193725_11116131 | 3300019883 | Soil | MDMLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRHTSSREIRSGLDSKLP |
| Ga0193727_10193571 | 3300019886 | Soil | MDMLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRHTSSREI |
| Ga0193749_10952291 | 3300020010 | Soil | MLEPSAGEIRDWGNSVIQFMTEYLGNLRDRNVYRHM |
| Ga0193724_10360493 | 3300020062 | Soil | MLEPSADEIRDWGNSVTRFVIEYLGGLRDRPVYRHTSSRGIRSELDS |
| Ga0222622_106037701 | 3300022756 | Groundwater Sediment | MLEPSADEIREWADSVIEFMTDYLGGLRDRPVYRHT |
| Ga0222622_113567602 | 3300022756 | Groundwater Sediment | MLDPSADETREWGNSAIEFMADYFSELRERKVYRQMSSRDIRDRL |
| Ga0207710_105229632 | 3300025900 | Switchgrass Rhizosphere | MLEPSADEIREWENAVTQFMIEYLGDLRDRPVYRHTSSRE |
| Ga0207685_104755082 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MDMLEPSPDEIRDWGNSVTQFIIDYLGGLRDRPAYRHTSSREIRSGLD |
| Ga0207699_106481451 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MDMLEPSPDEIRDWGNSVTQFIIDYLGGLRDRPAYRHTSSREIRSGLDSKLPIKG |
| Ga0207707_111775253 | 3300025912 | Corn Rhizosphere | MLEPSADEIREWGDSVIEFMTDYLGELRNRPAYRHSSSREIRSG |
| Ga0207649_113715881 | 3300025920 | Corn Rhizosphere | MLEPSADEIREWGDSVIEFMTDYLGGLRDRPAYRHSS |
| Ga0207681_110251791 | 3300025923 | Switchgrass Rhizosphere | MIDPSDDKIRDWGKSVVDLMADYLGNLPDRPVYRPM |
| Ga0207670_110352691 | 3300025936 | Switchgrass Rhizosphere | MLEPSADEIREWGDSVIEFMTDYLGELRDLPAYRHSSSREIRSGLDSELPIK |
| Ga0207711_115628221 | 3300025941 | Switchgrass Rhizosphere | MLEPSADEIREWGDSVIEFMTDYLGGLRDRPAYRHSSSRK |
| Ga0207711_117074651 | 3300025941 | Switchgrass Rhizosphere | MLEPSADEIREWENAVTQFMIEYLGGLRDRPVYRHTT |
| Ga0207661_121602501 | 3300025944 | Corn Rhizosphere | MLEPSANEMREWENAVTQFMIEYFGELRDRPVYRHTSSREIRSGLDSKLPI |
| Ga0207651_106827893 | 3300025960 | Switchgrass Rhizosphere | MLEPSADEIREWGDSVIEFMTDYLGELRNRPAYRHSSSREI |
| Ga0207668_109105141 | 3300025972 | Switchgrass Rhizosphere | MLEPSADEIREWGDSVTRFVIEYVGGLRNRRAYQRTSSREIRS |
| Ga0207703_115989631 | 3300026035 | Switchgrass Rhizosphere | MLEPSADEIREWGDSVIEFMTDYLGGLRDRPAYRHSSSRKIRSGLD |
| Ga0207648_107224031 | 3300026089 | Miscanthus Rhizosphere | MLEPSADEIREWGDSVIQFMTDYLGWMRDRPVYRQTSSREIRSGLDL |
| Ga0209470_11722313 | 3300026324 | Soil | MLDPSADEIRDWGNSVIQLMSDYLRSLRDRGVYRHMFSR |
| Ga0209152_102779442 | 3300026325 | Soil | MLDPSAEEIRDWGNSVVEFMANYLGDLRDRPVYRRMCSREI |
| Ga0209267_11998661 | 3300026331 | Soil | MLDPSADEIRDWGNSVIQLMTDYLCNLRDRGVYRHMFSRR |
| Ga0209803_11336361 | 3300026332 | Soil | MLYPSADEIRDWGNSVTQFMIDYLGGLRDRPVYRHTSSREIRDGLDPALPTKG |
| Ga0209807_12158902 | 3300026530 | Soil | MLEPSADEIRDWGNSAIQLITEYLGGLRDRAVYRHMFS |
| Ga0307312_111122302 | 3300028828 | Soil | MLDPSADETREWGNSAIEFMADYFSELRERRVYRQMSSRDIRDRLDA |
| Ga0307289_101456911 | 3300028875 | Soil | MLEPSTDEIREWGNSVTRFVIEYLGGLRDRPVYRHTSSRGIRSEL |
| Ga0307289_102145323 | 3300028875 | Soil | MLEPSADEIREWGDSVTRFVIEYLGGLRNRPAYQHT |
| Ga0307278_103186071 | 3300028878 | Soil | MLEPSADEIRDWGNSVTQFMIDYLGGLRDRPAYRHTSSRE |
| Ga0170824_1141875651 | 3300031231 | Forest Soil | MLEPSADEIREWGDSLIQFMIDYLGGLRDRPVYRQTSSREIRSGLDSKLPIK |
| Ga0170824_1201045571 | 3300031231 | Forest Soil | MLDPSDDEMRNWGNSVIQLMTDYLRDLRDHRVYGRMSSR |
| Ga0170818_1018171671 | 3300031474 | Forest Soil | MLEPSADEIREWGNSVTQFIIEYLGGLRDRPVYRHTSSREIRSE |
| Ga0310888_106247882 | 3300031538 | Soil | MLEPSADEIREWGDSAIRLMIEYLGGLRDRPVYRHTSSGEIRSGLDSKLPIEGTD |
| Ga0310813_123200482 | 3300031716 | Soil | MLDPSADEIRDWGNSVMQFMADYLGDLRDRNVYRHMSS |
| Ga0306922_109825802 | 3300032001 | Soil | MLEPSADEIREWGNSVTQFMIDYLGDLRDRPAYRQTSSGEI |
| Ga0318532_101997571 | 3300032051 | Soil | MLEPSSDKIREWANSVTQFMIDYLGGLRDRPVYRQTSSRE |
| Ga0318533_105818452 | 3300032059 | Soil | MLEPSADEIGEWANSVTQFMIDYLGGLRDRPVYRQTSSREIRSGLDSKLP |
| Ga0318505_106347881 | 3300032060 | Soil | MLEPSADEIGEWANSVTQFMIDYLGGLRDRPVYRQTS |
| ⦗Top⦘ |