Metagenome / Metatranscriptome Family F054900

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F054900
Family Type	Metagenome / Metatranscriptome
Number of Sequences	139
Average Sequence Length	42 residues
Representative Sequence	MISHGCANIGAMEYERAVLQLLVYGVTLVMLYVVDAWSRR
Number of Associated Samples	45
Number of Associated Scaffolds	138

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	58.27 %
% of genes near scaffold ends (potentially truncated)	48.20 %
% of genes from short scaffolds (< 2000 bps)	69.78 %
Associated GOLD sequencing projects	39
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (90.647 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat (72.662 % of family members)
Environment Ontology (ENVO)	Unclassified (97.842 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (72.662 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.49
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 138 Family Scaffolds
PF00145	DNA_methylase	4.35
PF01507	PAPS_reduct	1.45
PF01555	N6_N4_Mtase	0.72
PF01446	Rep_1	0.72

COG ID	Name	Functional Category	% Frequency in 138 Family Scaffolds
COG0270	DNA-cytosine methylase	Replication, recombination and repair [L]	4.35
COG0863	DNA modification methylase	Replication, recombination and repair [L]	0.72
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	0.72
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	0.72
COG5655	Replication initiaton protein REP (rolling circle plasmid replication)	Mobilome: prophages, transposons [X]	0.72

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
All Organisms	root	All Organisms	9.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
cellular organisms	root	All Organisms → cellular organisms	9.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	9.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	3.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2.16 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002493\|JGI24185J35167_1056219	Not Available	773	Open in IMG/M
3300002493\|JGI24185J35167_1090219	Not Available	525	Open in IMG/M
3300002510\|JGI24186J35511_1024476	Not Available	1044	Open in IMG/M
3300002510\|JGI24186J35511_1030607	Not Available	863	Open in IMG/M
3300002510\|JGI24186J35511_1035595	Not Available	755	Open in IMG/M
3300002510\|JGI24186J35511_1043992	Not Available	628	Open in IMG/M
3300002510\|JGI24186J35511_1057242	Not Available	508	Open in IMG/M
3300003688\|Ga0061020_1058411	Not Available	893	Open in IMG/M
3300003688\|Ga0061020_1090065	Not Available	633	Open in IMG/M
3300003688\|Ga0061020_1098430	Not Available	590	Open in IMG/M
3300005249\|Ga0068645_1044602	Not Available	778	Open in IMG/M
3300005251\|Ga0068634_1125403	Not Available	687	Open in IMG/M
3300005452\|Ga0068706_1012087	Not Available	2183	Open in IMG/M
3300005452\|Ga0068706_1034968	Not Available	991	Open in IMG/M
3300005452\|Ga0068706_1036830	Not Available	955	Open in IMG/M
3300005452\|Ga0068706_1041240	Not Available	882	Open in IMG/M
3300005452\|Ga0068706_1055400	Not Available	719	Open in IMG/M
3300005452\|Ga0068706_1056231	Not Available	712	Open in IMG/M
3300005452\|Ga0068706_1066842	Not Available	638	Open in IMG/M
3300005453\|Ga0068705_10090846	Not Available	838	Open in IMG/M
3300005453\|Ga0068705_10180582	Not Available	513	Open in IMG/M
3300005495\|Ga0068666_1018430	Not Available	562	Open in IMG/M
3300006380\|Ga0068664_1008633	Not Available	1262	Open in IMG/M
3300006380\|Ga0068664_1134118	Not Available	592	Open in IMG/M
3300010023\|Ga0130028_100225	Not Available	2972	Open in IMG/M
3300010023\|Ga0130028_101104	Not Available	1396	Open in IMG/M
3300010254\|Ga0124938_1002747	Not Available	587	Open in IMG/M
3300026237\|Ga0209750_1016520	Not Available	1658	Open in IMG/M
3300026237\|Ga0209750_1033524	Not Available	1005	Open in IMG/M
3300026237\|Ga0209750_1043989	Not Available	839	Open in IMG/M
3300026237\|Ga0209750_1081282	Not Available	555	Open in IMG/M
3300026280\|Ga0209017_10088557	Not Available	602	Open in IMG/M
3300026509\|Ga0209809_1074239	Not Available	939	Open in IMG/M
3300026509\|Ga0209809_1151658	Not Available	518	Open in IMG/M
3300027279\|Ga0209691_1004740	Not Available	5719	Open in IMG/M
3300027279\|Ga0209691_1026780	Not Available	1303	Open in IMG/M
3300027279\|Ga0209691_1038448	Not Available	981	Open in IMG/M
3300027279\|Ga0209691_1073278	Not Available	598	Open in IMG/M
3300031245\|Ga0308395_1011708	Not Available	3374	Open in IMG/M
3300031245\|Ga0308395_1017286	Not Available	2503	Open in IMG/M
3300031245\|Ga0308395_1019092	Not Available	2321	Open in IMG/M
3300031245\|Ga0308395_1023515	Not Available	1970	Open in IMG/M
3300031245\|Ga0308395_1053811	Not Available	1041	Open in IMG/M
3300031245\|Ga0308395_1109293	Not Available	625	Open in IMG/M
3300031245\|Ga0308395_1110057	Not Available	622	Open in IMG/M
3300031245\|Ga0308395_1120675	Not Available	583	Open in IMG/M
3300031245\|Ga0308395_1143209	Not Available	517	Open in IMG/M
3300031508\|Ga0308394_1032940	Not Available	1347	Open in IMG/M
3300031508\|Ga0308394_1060864	Not Available	848	Open in IMG/M
3300031508\|Ga0308394_1082433	Not Available	677	Open in IMG/M
3300031509\|Ga0308399_1017734	Not Available	1847	Open in IMG/M
3300031512\|Ga0308397_1076766	Not Available	752	Open in IMG/M
3300031512\|Ga0308397_1080420	Not Available	727	Open in IMG/M
3300031513\|Ga0308412_1028662	Not Available	2179	Open in IMG/M
3300031513\|Ga0308412_1033200	Not Available	1954	Open in IMG/M
3300031513\|Ga0308412_1052854	Not Available	1391	Open in IMG/M
3300031513\|Ga0308412_1071829	Not Available	1109	Open in IMG/M
3300031513\|Ga0308412_1110871	Not Available	810	Open in IMG/M
3300031514\|Ga0308390_1006305	Not Available	5638	Open in IMG/M
3300031514\|Ga0308390_1009381	All Organisms → cellular organisms → Bacteria	4112	Open in IMG/M
3300031514\|Ga0308390_1015823	Not Available	2716	Open in IMG/M
3300031514\|Ga0308390_1018143	Not Available	2437	Open in IMG/M
3300031514\|Ga0308390_1078648	Not Available	750	Open in IMG/M
3300031515\|Ga0308396_1068620	Not Available	753	Open in IMG/M
3300031515\|Ga0308396_1071284	Not Available	733	Open in IMG/M
3300031515\|Ga0308396_1108294	Not Available	552	Open in IMG/M
3300031516\|Ga0308398_1029317	Not Available	1524	Open in IMG/M
3300031517\|Ga0308392_1001572	All Organisms → cellular organisms → Bacteria	9099	Open in IMG/M
3300031518\|Ga0308389_1013392	Not Available	3347	Open in IMG/M
3300031518\|Ga0308389_1055859	Not Available	1043	Open in IMG/M
3300031518\|Ga0308389_1059792	Not Available	988	Open in IMG/M
3300031518\|Ga0308389_1103972	Not Available	636	Open in IMG/M
3300031567\|Ga0308391_1003069	Not Available	5791	Open in IMG/M
3300031567\|Ga0308391_1005334	Not Available	3937	Open in IMG/M
3300031568\|Ga0308393_1006887	Not Available	3793	Open in IMG/M
3300031568\|Ga0308393_1010920	Not Available	2771	Open in IMG/M
3300031568\|Ga0308393_1012835	Not Available	2477	Open in IMG/M
3300031568\|Ga0308393_1100870	Not Available	615	Open in IMG/M
3300031776\|Ga0308415_1001100	Not Available	11824	Open in IMG/M
3300031776\|Ga0308415_1001100	Not Available	11824	Open in IMG/M
3300031783\|Ga0308418_1017814	Not Available	2216	Open in IMG/M
3300031783\|Ga0308418_1027511	Not Available	1594	Open in IMG/M
3300031783\|Ga0308418_1050993	Not Available	1011	Open in IMG/M
3300031812\|Ga0308411_10008901	All Organisms → cellular organisms → Bacteria	6239	Open in IMG/M
3300031812\|Ga0308411_10018545	Not Available	3929	Open in IMG/M
3300031812\|Ga0308411_10045410	Not Available	2053	Open in IMG/M
3300031830\|Ga0308409_1003797	Not Available	5780	Open in IMG/M
3300031830\|Ga0308409_1021133	Not Available	1866	Open in IMG/M
3300031830\|Ga0308409_1034149	Not Available	1352	Open in IMG/M
3300031830\|Ga0308409_1045773	Not Available	1104	Open in IMG/M
3300031830\|Ga0308409_1124439	Not Available	554	Open in IMG/M
3300031875\|Ga0308405_1026058	All Organisms → cellular organisms → Bacteria	1844	Open in IMG/M
3300031875\|Ga0308405_1077171	Not Available	847	Open in IMG/M
3300031878\|Ga0308404_1003362	All Organisms → cellular organisms → Bacteria → Terrabacteria group	4287	Open in IMG/M
3300031878\|Ga0308404_1022845	Not Available	1370	Open in IMG/M
3300031950\|Ga0308417_1014578	Not Available	4153	Open in IMG/M
3300031950\|Ga0308417_1026826	Not Available	2742	Open in IMG/M
3300031950\|Ga0308417_1034060	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2304	Open in IMG/M
3300031950\|Ga0308417_1034931	Not Available	2263	Open in IMG/M
3300031950\|Ga0308417_1038630	Not Available	2100	Open in IMG/M
3300031950\|Ga0308417_1041391	Not Available	1999	Open in IMG/M
3300031950\|Ga0308417_1041550	Not Available	1994	Open in IMG/M
3300031950\|Ga0308417_1052292	Not Available	1680	Open in IMG/M
3300031950\|Ga0308417_1058327	Not Available	1546	Open in IMG/M
3300031950\|Ga0308417_1062589	Not Available	1467	Open in IMG/M
3300031950\|Ga0308417_1124954	All Organisms → cellular organisms → Bacteria	879	Open in IMG/M
3300031950\|Ga0308417_1201409	Not Available	622	Open in IMG/M
3300031950\|Ga0308417_1212100	Not Available	600	Open in IMG/M
3300031950\|Ga0308417_1214447	Not Available	595	Open in IMG/M
3300031950\|Ga0308417_1220658	Not Available	583	Open in IMG/M
3300031950\|Ga0308417_1233473	Not Available	560	Open in IMG/M
3300031958\|Ga0308410_1000473	All Organisms → cellular organisms → Bacteria	21680	Open in IMG/M
3300031958\|Ga0308410_1060638	Not Available	1179	Open in IMG/M
3300031966\|Ga0308420_1096018	Not Available	961	Open in IMG/M
3300031980\|Ga0308403_1000609	Not Available	13191	Open in IMG/M
3300031980\|Ga0308403_1000703	All Organisms → cellular organisms → Bacteria → Terrabacteria group	12021	Open in IMG/M
3300031980\|Ga0308403_1000735	Not Available	11679	Open in IMG/M
3300031980\|Ga0308403_1004276	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	3878	Open in IMG/M
3300031980\|Ga0308403_1016053	Not Available	1785	Open in IMG/M
3300031980\|Ga0308403_1025046	Not Available	1357	Open in IMG/M
3300032033\|Ga0308402_1002494	All Organisms → cellular organisms → Bacteria	4853	Open in IMG/M
3300032033\|Ga0308402_1020279	Not Available	1464	Open in IMG/M
3300032034\|Ga0308407_1009733	Not Available	2882	Open in IMG/M
3300032034\|Ga0308407_1111991	Not Available	548	Open in IMG/M
3300032034\|Ga0308407_1127888	Not Available	501	Open in IMG/M
3300032045\|Ga0308400_1011450	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2349	Open in IMG/M
3300032045\|Ga0308400_1030124	Not Available	1297	Open in IMG/M
3300032045\|Ga0308400_1051070	Not Available	920	Open in IMG/M
3300032057\|Ga0308421_1012330	Not Available	3120	Open in IMG/M
3300032057\|Ga0308421_1092310	Not Available	746	Open in IMG/M
3300032058\|Ga0308419_1029915	Not Available	2227	Open in IMG/M
3300032058\|Ga0308419_1098759	Not Available	842	Open in IMG/M
3300033886\|Ga0308413_004353	All Organisms → cellular organisms → Bacteria	6553	Open in IMG/M
3300033886\|Ga0308413_030811	Not Available	1712	Open in IMG/M
3300033886\|Ga0308413_036052	Not Available	1524	Open in IMG/M
3300033886\|Ga0308413_037145	Not Available	1489	Open in IMG/M
3300033886\|Ga0308413_095389	Not Available	750	Open in IMG/M
3300034649\|Ga0372972_038015	Not Available	675	Open in IMG/M
3300034650\|Ga0372973_023077	Not Available	1018	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	100.00%

Habitat	Taxonomy	Distribution
Thermal Springs	Environmental → Aquatic → Thermal Springs	100.00%

Habitat	Taxonomy	Distribution
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	100.00%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	98.56%
Alkaline	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline	1.44%

Habitat	Taxonomy	Distribution
Hot Spring Phototrophic Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat	72.66%
Anoxygenic And Chlorotrophic Microbial Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat	15.11%
Anoxygenic And Chlorotrophic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic	10.79%
Terrestrial Hot Spring Microbial Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Terrestrial Hot Spring Microbial Mat	1.44%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002493	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012	Environmental	Open in IMG/M
3300002510	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012	Environmental	Open in IMG/M
3300003688	Coassembly of YNP Bryant MS undermat 2012 and YNP Bryant MS upper layer 2012	Environmental	Open in IMG/M
3300005249	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005251	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005452	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG	Environmental	Open in IMG/M
3300005453	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG	Environmental	Open in IMG/M
3300005495	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006380	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010023	Terrestrial hot spring microbial mat viral communities from Octopus Spring, Yellowstone National Park, Wyoming (2009) spADES assembly	Environmental	Open in IMG/M
3300010254	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_B MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300026237	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 (SPAdes)	Environmental	Open in IMG/M
3300026280	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 (SPAdes)	Environmental	Open in IMG/M
3300026509	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG (SPAdes)	Environmental	Open in IMG/M
3300027279	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes)	Environmental	Open in IMG/M
3300031245	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4	Environmental	Open in IMG/M
3300031508	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2	Environmental	Open in IMG/M
3300031509	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-60	Environmental	Open in IMG/M
3300031512	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T8	Environmental	Open in IMG/M
3300031513	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST1-BottomLayer	Environmental	Open in IMG/M
3300031514	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_149	Environmental	Open in IMG/M
3300031515	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_Pe2	Environmental	Open in IMG/M
3300031516	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T9	Environmental	Open in IMG/M
3300031517	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050624_m2	Environmental	Open in IMG/M
3300031518	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_148	Environmental	Open in IMG/M
3300031567	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050623_t1	Environmental	Open in IMG/M
3300031568	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050630_ee2	Environmental	Open in IMG/M
3300031776	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS55	Environmental	Open in IMG/M
3300031783	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090729_R4cd	Environmental	Open in IMG/M
3300031812	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer	Environmental	Open in IMG/M
3300031830	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe4	Environmental	Open in IMG/M
3300031875	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MS13	Environmental	Open in IMG/M
3300031878	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M4	Environmental	Open in IMG/M
3300031950	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS65	Environmental	Open in IMG/M
3300031958	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-MatCore	Environmental	Open in IMG/M
3300031966	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS55	Environmental	Open in IMG/M
3300031980	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M3	Environmental	Open in IMG/M
3300032033	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M2	Environmental	Open in IMG/M
3300032034	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe2	Environmental	Open in IMG/M
3300032045	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-65	Environmental	Open in IMG/M
3300032057	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS60	Environmental	Open in IMG/M
3300032058	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS50	Environmental	Open in IMG/M
3300033886	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090729_t10cd	Environmental	Open in IMG/M
3300034649	Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1400_MSt11 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034650	Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1600_MSt12 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24185J35167_10562192	3300002493	Anoxygenic And Chlorotrophic Microbial Mat	MICRARGSIGAMEYERAMXQLAVYCVTLVMLYVVDRWSRG*
JGI24185J35167_10902192	3300002493	Anoxygenic And Chlorotrophic Microbial Mat	MISRGCANIGAMEYERAVFQLVVYVAVLAMLYVVDVWSR*
JGI24186J35511_10244762	3300002510	Anoxygenic And Chlorotrophic Microbial Mat	MISHGCANIGAMEYERAVFQLAVYVVVLVMLYVVDAWSR*
JGI24186J35511_10306072	3300002510	Anoxygenic And Chlorotrophic Microbial Mat	MISHGCANVGAMEYERAVLQLLVYGVTLLMLYVVDVWSRR*
JGI24186J35511_10355951	3300002510	Anoxygenic And Chlorotrophic Microbial Mat	MSSLGGASIGAMEYERAVLQLLVYGVTLVMLYVVDVWSRR*
JGI24186J35511_10439922	3300002510	Anoxygenic And Chlorotrophic Microbial Mat	MGIYWMISHGCANIGAMEYERAVLQLLVYCVTLVMLYVVDSWSRR*
JGI24186J35511_10572421	3300002510	Anoxygenic And Chlorotrophic Microbial Mat	RREIYLMICRARGSIGAMEYERAMLQLMVYCVTLLMLYAVDRWSR*
Ga0061020_10584112	3300003688	Anoxygenic And Chlorotrophic Microbial Mat	MICRARGSIGAMEYERAVFQLVVYVAVLAMLYVVDAWSRR*
Ga0061020_10900652	3300003688	Anoxygenic And Chlorotrophic Microbial Mat	MISHGCANIGAMEYERAMLQLAVYCVTLVMLYVVDRWSRG*
Ga0061020_10984302	3300003688	Anoxygenic And Chlorotrophic Microbial Mat	SSTPANGCRFSTPGRTGIYWMISHGCANIGAMEYERAVFQLVVYVAVLAMLYVVDVWSR*
Ga0068645_10446021	3300005249	Anoxygenic And Chlorotrophic Microbial Mat	VKTETCLTICRARGSIGAMEYERAMLQLMVYVAVLAMIYVVDRWYRG*
Ga0068634_11254033	3300005251	Anoxygenic And Chlorotrophic Microbial Mat	NGCRFSTLGRTGIYWMISHGCANIGAMEYERAVLQLLVYGVTLVMLYVVDAWSRR*
Ga0068706_10120873	3300005452	Anoxygenic And Chlorotrophic	MISRGCANIGAMEYERAVVQLLVYGVTLIMLYVVDRWSRG*
Ga0068706_10349681	3300005452	Anoxygenic And Chlorotrophic	GCRFSTPGRSEIYLMICRARINIGAMEYERAMLQLMVYVAVLAMLYVVDRWYRG*
Ga0068706_10368302	3300005452	Anoxygenic And Chlorotrophic	MICRARINIGAMEYERAMLQLAVYCVTLVMLYVVDAWSRR*
Ga0068706_10412402	3300005452	Anoxygenic And Chlorotrophic	MSSLGGASIGAMEYERAVFQLAVYVVVLVMLYVVDAWSR*
Ga0068706_10554002	3300005452	Anoxygenic And Chlorotrophic	MISRSCANIGAMEYERAIVQLVVYGVTLLMLYVVDAWSRR*
Ga0068706_10562311	3300005452	Anoxygenic And Chlorotrophic	MGIYWMISHGCANIGAMEYERAVLQLLVYGVTLVMLYVVDVWSRR*
Ga0068706_10668421	3300005452	Anoxygenic And Chlorotrophic	MICRARGSIGAMEYERAMLQLMVYVAVLAMIYVVDRWSRG*
Ga0068705_100908463	3300005453	Anoxygenic And Chlorotrophic	MISHGCANIGAMEYERAVLQLLVYGVTLVMLYVVDAWSRR*
Ga0068705_101805821	3300005453	Anoxygenic And Chlorotrophic	LMICRARINIGAMEYERAVFQLAVYVVVLVMLYVVDVWSR*
Ga0068666_10184305	3300005495	Anoxygenic And Chlorotrophic Microbial Mat	ICRARGSIGAMEYERAVFQLVVYVAVLAMLYVVDAWSRR*
Ga0068664_10086331	3300006380	Anoxygenic And Chlorotrophic Microbial Mat	GIYWMISHGCANIGAMEYERAVFQLAVYVVVLVMLYVVDAWSR*
Ga0068664_11341181	3300006380	Anoxygenic And Chlorotrophic Microbial Mat	GIYWMISHGCANIGAMEYERAMLQLVVYVAVLAMIYVVDRWSRG*
Ga0130028_1002257	3300010023	Terrestrial Hot Spring Microbial Mat	LMICRARGSIGAMEYERAMLQLMVYCVTLLMLYAVDRWSR*
Ga0130028_1011044	3300010023	Terrestrial Hot Spring Microbial Mat	NGCRFSTPGRSEIYLMICRARSSIGAMEYERAVFQLAVYVVVLVMLYVVDAWSR*
Ga0124938_10027473	3300010254	Anoxygenic And Chlorotrophic Microbial Mat	STLGRTGIYWMICRARGSIGAMEYERAMLQLMVYVAVLAMIYVVDRWYRG*
Ga0209750_10165202	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	MICRARGSIGAMEYERAVFQLVVYVAVLAMLYVVDAWSRR
Ga0209750_10335244	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	MICRARINIGAMEYERAMLQLAVYCVTLVMLYVVDAWSRR
Ga0209750_10439892	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	MSSLGGASIGAMEYERAVLQLLVYGVTLVMLYVVDVWSRR
Ga0209750_10812822	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	MISHGCANIGAMEYERAVLQLLVYGVTLFMLYAVDRWYRG
Ga0209017_100885571	3300026280	Anoxygenic And Chlorotrophic Microbial Mat	MISRSCANIGAMEYERAMLQLMVYVAVLAMLYVVDRWY
Ga0209809_10742391	3300026509	Anoxygenic And Chlorotrophic	TISRSCANIGAMEYERAIVQLVVYGVTLLMLYVVDAWSRR
Ga0209809_11516581	3300026509	Anoxygenic And Chlorotrophic	LMICRARGSIGAMEYERAMLQLAVYCVTLVMLYVVDRWS
Ga0209691_10047404	3300027279	Anoxygenic And Chlorotrophic	MISRGCANIGAMEYERAVVQLLVYGVTLIMLYVVDRWSRG
Ga0209691_10267801	3300027279	Anoxygenic And Chlorotrophic	GCANIGAMEYERAVFQLVVYVAVLAMLYVVDAWSRR
Ga0209691_10384482	3300027279	Anoxygenic And Chlorotrophic	MISRSCANIGAMEYERAIVQLVVYGVTLLMLYVVDAWSRR
Ga0209691_10732782	3300027279	Anoxygenic And Chlorotrophic	MISHGCANIGAMEYERAMLQLVVYVAVLAMIYVVDRWSRG
Ga0308395_10117082	3300031245	Hot Spring Phototrophic Mat	MLGRSEIYLMICRARGSIGAMEYERAVLQLLVYGVTLFMLYAVDRWYRG
Ga0308395_10172862	3300031245	Hot Spring Phototrophic Mat	MVSHGCANIGAMEYERAVLQLLVYCVTLVMLYVVDVWSRR
Ga0308395_10190925	3300031245	Hot Spring Phototrophic Mat	MICRARGSIGAMEYERAVLQLLVYCVTLVMLYVVD
Ga0308395_10235155	3300031245	Hot Spring Phototrophic Mat	MIGTCLTISRSCANIGAMEYERAIVQLVVYGVTLLMLYVVDAWSRR
Ga0308395_10538111	3300031245	Hot Spring Phototrophic Mat	MLGRSEIYLMICRARGSIGAMEYERAVFQLVVYVAVLAMLYVVDAWSRR
Ga0308395_11092932	3300031245	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVFQLVVYVAVLAMLYVVDAWSRR
Ga0308395_11100571	3300031245	Hot Spring Phototrophic Mat	TLGRIRIFLMSSLGGASIGAMEYERAVLQLLVYGVTLVMLYVVDVWSRR
Ga0308395_11206754	3300031245	Hot Spring Phototrophic Mat	GRSEIYLMICRARGSIGAMEYERAVLQLLVYCVTLVMLYVVDSWSRR
Ga0308395_11432092	3300031245	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVLQLLVYGVTLVMLYVVDAWSRR
Ga0308394_10329404	3300031508	Hot Spring Phototrophic Mat	MKIFLMSSLGGASIGAMEYERAIVQLLVYVAVLAMLYVVDRWSRG
Ga0308394_10608642	3300031508	Hot Spring Phototrophic Mat	LMICRARGSIGAMEYERAVLQLLVYGVTLFMLYAVDRWY
Ga0308394_10824334	3300031508	Hot Spring Phototrophic Mat	MISRGCANIGAMEYERAVFQLVVYVAVLAMLYVVDAWSRR
Ga0308399_10177342	3300031509	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVVQLLVYGVTLIMLYVVDRWSRG
Ga0308397_10767661	3300031512	Hot Spring Phototrophic Mat	GCRFSTPGRIRIFLMSSLGGASIGAMEYERAVLQLLVYGVTLVMLYVVDVWSRR
Ga0308397_10804201	3300031512	Hot Spring Phototrophic Mat	STPGRTGIYWMISHGCANIGAMEYERAVLQLLVYGVTLVMLYVVDAWSRR
Ga0308412_10286622	3300031513	Hot Spring Phototrophic Mat	MISHGCANIGAMECERAVFQLVVYVAVLAMLYVVDAWSRR
Ga0308412_10332001	3300031513	Hot Spring Phototrophic Mat	CLTICRARINIGAMEYERAMLQLAVYCVTLVMLYVVDAWSRR
Ga0308412_10528541	3300031513	Hot Spring Phototrophic Mat	MSSLGGASIGAMEYERAVLQLLVYGVTLVMLYVVDAWSRR
Ga0308412_10718292	3300031513	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVFQLAVYVVVLVMLYVVDAWSR
Ga0308412_11108711	3300031513	Hot Spring Phototrophic Mat	LMILHVRANIGAMEYERAVFQLAVYVVVLVMLYVVDAWSR
Ga0308390_10063055	3300031514	Hot Spring Phototrophic Mat	MICRVRANIGAMEYERAMLQLLVYGVTLVMLYVVDAWSR
Ga0308390_10093816	3300031514	Hot Spring Phototrophic Mat	MISRSCANIGAMEYERAMLQLMVYVAVLAMLYVVDRWYRG
Ga0308390_10158236	3300031514	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVFQLVVYVAVLAMLYVVDVWSR
Ga0308390_10181434	3300031514	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAMLQLAVYCVTLVMLYVVDRWSRG
Ga0308390_10786481	3300031514	Hot Spring Phototrophic Mat	MICRARGSIGAMEYERAMLQLMVYVAVLAMIYVVDRWYR
Ga0308396_10686201	3300031515	Hot Spring Phototrophic Mat	MLGRSEIYLMICRARGSIGAMEYERAVLQLLVYGVTLFMLYAVD
Ga0308396_10712844	3300031515	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVLQLLVYGVTLVMLYVVDVWSRR
Ga0308396_11082941	3300031515	Hot Spring Phototrophic Mat	HGCANIGAMEYERAVFQLVVYVAVLAMLYVVDAWSRR
Ga0308398_10293175	3300031516	Hot Spring Phototrophic Mat	MISHGCANIGVMEYERAVFQLVVYVAVLAMLYVVDAWSRR
Ga0308392_10015724	3300031517	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVLQLLVYGVTLIMLYVVDRWSRG
Ga0308389_10133924	3300031518	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAMLQLMVYVAVLAMIYVVDRWYRG
Ga0308389_10558591	3300031518	Hot Spring Phototrophic Mat	GIYWMISHGCANIGAMEYERAVLQLLVYCVTLVMLYVVDSWSRR
Ga0308389_10597922	3300031518	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVLQLLVYCVTLVMLYVVDSWS
Ga0308389_11039724	3300031518	Hot Spring Phototrophic Mat	PGRMGIYWMISHGCANIGAMEYERAVLQLLVYGVTLVMLYVVDAWSR
Ga0308391_100306913	3300031567	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVVQLLVYLVTLAMLYVVDRWYRG
Ga0308391_10053347	3300031567	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAMLQLLVYGVTLVMLYVVDAWSRR
Ga0308393_10068877	3300031568	Hot Spring Phototrophic Mat	MREIYLMICRARGSIGAMEYERAVLQLLVYGVTLFMLYAVDRWYRG
Ga0308393_10109205	3300031568	Hot Spring Phototrophic Mat	MICRARGSIGAMEYERAMLQLMVYCVTLLMLYAVDRWSR
Ga0308393_10128354	3300031568	Hot Spring Phototrophic Mat	MISRGCANIGAMEYERAVFQLVVYVAVLAMLYVVDVWSR
Ga0308393_11008702	3300031568	Hot Spring Phototrophic Mat	MICRARGSIGAMEYERAVFQLVVYVAVLAMLYVVDAWSR
Ga0308415_100110023	3300031776	Hot Spring Phototrophic Mat	MCLTISGDCASIGAMEYERAMLQLMVYGVTLLMVYVVDRWCRG
Ga0308415_10011008	3300031776	Hot Spring Phototrophic Mat	MCLTISGDCASIGAMEYERAMLQLMVYGVTLFMLYVVDRWYRG
Ga0308418_10178142	3300031783	Hot Spring Phototrophic Mat	MICRARINIGAMEYERAVFQLAVYVVVLVMLYVVDVWSR
Ga0308418_10275114	3300031783	Hot Spring Phototrophic Mat	MISRGCANIGAMEYERAVVQLLVYGVTLIMLYLVDRWSRG
Ga0308418_10509934	3300031783	Hot Spring Phototrophic Mat	YWMISHGCANIGAMEYERAVLQLLVYGVTLFMLYVVDRWSRG
Ga0308411_100089012	3300031812	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAMLQLLVYGVTLFMLYAVDRWYRG
Ga0308411_100185459	3300031812	Hot Spring Phototrophic Mat	IYWMISHGCANIGAMEYERAVLQLLVYGVTLVMLYVVDVWSRR
Ga0308411_100454104	3300031812	Hot Spring Phototrophic Mat	MISRGCANIGAMEYERAMLQLMVYVAVLAMIYVVDRWYRG
Ga0308409_10037972	3300031830	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAMLQLGVYCVTLVMLYVVDRWSRG
Ga0308409_10211332	3300031830	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVLQLLVYCVTLVMLYVVDVWSRR
Ga0308409_10341492	3300031830	Hot Spring Phototrophic Mat	MICRVRANIGAMEYERAMLQLAVYCVTLVMLYVVDRWSRG
Ga0308409_10457731	3300031830	Hot Spring Phototrophic Mat	MLGRSEIYLMICRARGSIGAMEYERAVLQLLVYCVTLVMLYVVDSWSRR
Ga0308409_11244393	3300031830	Hot Spring Phototrophic Mat	ICRARGSIGAMEYERAMLQLAVYCVTLVMLYVVDAWSRR
Ga0308405_10260581	3300031875	Hot Spring Phototrophic Mat	LMICRARGSIGAMEYERAVLQLLVYGVTLLMLYAVDR
Ga0308405_10771711	3300031875	Hot Spring Phototrophic Mat	GRIRIFLMSSLGGASIGAMEYERAVLQLLVYGVTLVMLYVVDVWSRR
Ga0308404_10033625	3300031878	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVFQLAVYVVVLVMLYVVDVWSR
Ga0308404_10228454	3300031878	Hot Spring Phototrophic Mat	STPGRTGIYWMISHGCANIGAMEYERAVLQLLVYGVTLLMLYAVDRWYRG
Ga0308417_10145787	3300031950	Hot Spring Phototrophic Mat	MICRARGSIGAMEYGRAMLQLMVYVVVLAMIYVVDGWSRG
Ga0308417_10268265	3300031950	Hot Spring Phototrophic Mat	RTGIYWMISHGCANIGAMEYERAVFQLAVYVVVLVMLYVVDAWSR
Ga0308417_10340601	3300031950	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAMLQLLVYGVTLFMLYAVD
Ga0308417_10349311	3300031950	Hot Spring Phototrophic Mat	CANIGAMEYERAVLQLLVYGVTLLMLYVVDVWSRR
Ga0308417_10386303	3300031950	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVLQLLVYGVTLLMLYVVDVWSRR
Ga0308417_10413911	3300031950	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVFQLAVYVVVLVMLYVVDA
Ga0308417_10415504	3300031950	Hot Spring Phototrophic Mat	ICRARGSIGAMEYERAMLQLMVYVAVLAMIYVVDRWSRG
Ga0308417_10522922	3300031950	Hot Spring Phototrophic Mat	MICRTRGSIGAMEYERAVLQLLVYGVTLVMLYVVDVWSRR
Ga0308417_10583273	3300031950	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVFQLAVYCAVLLMLYVVDRWYRG
Ga0308417_10625891	3300031950	Hot Spring Phototrophic Mat	IYWMISHGCANIGAMEYERAVFQLAVYVVVLVMLYVVDVWSRR
Ga0308417_11249541	3300031950	Hot Spring Phototrophic Mat	MICRARGSIGAMEYERAIVQLLVYLVTLAMLYVVDRWS
Ga0308417_12014091	3300031950	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVLQLLVYGVTLIMLYVVDRWYRG
Ga0308417_12121001	3300031950	Hot Spring Phototrophic Mat	IYLMICRARGSIGAMEYERAIVQLLVYLVTLAMLYVVDRWSRG
Ga0308417_12144471	3300031950	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVFQLAVYCAVLLMLYVVDRWSR
Ga0308417_12206581	3300031950	Hot Spring Phototrophic Mat	IYWMISHGCANIGAMEYERAVFQLAVYVVVLVMLYVVDVWSR
Ga0308417_12334733	3300031950	Hot Spring Phototrophic Mat	MISRGCANIGAMEYERAVVQLLVYGVTLVMLYVVDVWSRR
Ga0308410_10004737	3300031958	Hot Spring Phototrophic Mat	MSEIYLMICRARGSIGAMEYERAVLQLLVYGVTLFMLYAVDRWYRG
Ga0308410_10606382	3300031958	Hot Spring Phototrophic Mat	MLGRSEIYLTICRARANIGAMEYERAVLQLMVYVAVLAMLYVVDRWSRG
Ga0308420_10960181	3300031966	Hot Spring Phototrophic Mat	MGIYWMISHGCANIGAMEYERAVLQLLVYGVTLVMLYVVDVWSRR
Ga0308403_100060919	3300031980	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVLQLLVYGVTLLMLYAVDRWYRG
Ga0308403_100070319	3300031980	Hot Spring Phototrophic Mat	PANGCRFSTLERTGIYWMISHGCANIGAMEYERAVFQLAVYVVVLVMLYVVDAWSR
Ga0308403_100073522	3300031980	Hot Spring Phototrophic Mat	GRSEIYLMICRARGSIGAMEYERAMLQLAVYCVTLVMLYVVDVWSRR
Ga0308403_10042762	3300031980	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAMLQLAVYCVTLVMLYVVDGWSRG
Ga0308403_10160532	3300031980	Hot Spring Phototrophic Mat	MICRARGSIGAMEYERAMLQLAVYCVTLVMLYVVDAWSRR
Ga0308403_10250461	3300031980	Hot Spring Phototrophic Mat	MISRGCANIGAMEYERAVLQLLVYGVTLLMLYAVDRWY
Ga0308402_10024946	3300032033	Hot Spring Phototrophic Mat	MICRARGSIGAMEYERAMLQLMVYVAVLAMIYVVDRWSRG
Ga0308402_10202796	3300032033	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVVQLLVYGVTLIMLYVVDRWYRG
Ga0308407_10097331	3300032034	Hot Spring Phototrophic Mat	TPANGCRFSTLGRTGIYWMICRARGSIGAMEYERAVFQLVVYVAVLAMLYVVDAWSRR
Ga0308407_11119913	3300032034	Hot Spring Phototrophic Mat	NGCRFSTLGRREIYLMICRARGSIGAMEYERAVFQLAVYVVVLVMLYVVDAWSR
Ga0308407_11278881	3300032034	Hot Spring Phototrophic Mat	YLMICRTRGSIGAMEYERAVFQLAVYCAVLLMLYVVDRWSRG
Ga0308400_10114501	3300032045	Hot Spring Phototrophic Mat	LMICRTRGSIGAMEYERAVFQLAVYCAVLLMLYVVD
Ga0308400_10301243	3300032045	Hot Spring Phototrophic Mat	CANIGAMEYERAVLQLLVYGVTLLMLYAVDRWYRG
Ga0308400_10510701	3300032045	Hot Spring Phototrophic Mat	YLMISRGCANVGAMEYERAVVQLLVYGVTLIMLYVVDRWSRG
Ga0308421_10123307	3300032057	Hot Spring Phototrophic Mat	GRREIYLMICRARGSIGAMEYERAVFQLAVYVVVLVMLYVVDVWSR
Ga0308421_10923101	3300032057	Hot Spring Phototrophic Mat	LMICRARINIGAMEYERAMLQLAVYCVTLVMLYVVDAW
Ga0308419_10299151	3300032058	Hot Spring Phototrophic Mat	WMISHGCANIGAMEYERAVFQLAVYVVVLVMLYVVDAWSR
Ga0308419_10987591	3300032058	Hot Spring Phototrophic Mat	YLMICRARGSIGAMEYERAVLQLLVYGVTLFMLYAVDRWYRG
Ga0308413_004353_2876_2998	3300033886	Hot Spring Phototrophic Mat	MISHGCANIGAMEYERAVLQLLVYGVTLIMLYVVDGWSRG
Ga0308413_030811_1521_1643	3300033886	Hot Spring Phototrophic Mat	MICRTRGSIGAMEYERAVLQLLVYGVTLFMLYAVDRWYRG
Ga0308413_036052_3_152	3300033886	Hot Spring Phototrophic Mat	TPGRSEIYLMICRARGSIGAMEYERAMLQLMVYVAVLAMIYVVDRWYRG
Ga0308413_037145_1317_1487	3300033886	Hot Spring Phototrophic Mat	ANGCRFSTPGRSEIYLMICRARGSIGAMEYERAMLQLMVYVAVLAMIYVVDRWSRG
Ga0308413_095389_602_748	3300033886	Hot Spring Phototrophic Mat	TPGRTGIYWMISHGCANIGAMEYERAVFQLAVYVVVLVMLYVVDVWSR
Ga0372972_038015_1_141	3300034649	Hot Spring Phototrophic Mat	RMKIFLMSSLGGASIGAMEYERAIVQLLVYVAVLAMLYVVDRWSRG
Ga0372973_023077_3_110	3300034650	Hot Spring Phototrophic Mat	MICRARGSIGAMEYERAVLQLVVYVAVLAMLYVVDV

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F054900

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences