NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F054893

Metagenome / Metatranscriptome Family F054893

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054893
Family Type Metagenome / Metatranscriptome
Number of Sequences 139
Average Sequence Length 95 residues
Representative Sequence MGLAHQITDNEILLFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNSSLYAYGNDIYVHQYNIPEQKWSVIPKTSVVLPKQ
Number of Associated Samples 111
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 37.41 %
% of genes near scaffold ends (potentially truncated) 31.65 %
% of genes from short scaffolds (< 2000 bps) 74.10 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.122 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(16.547 % of family members)
Environment Ontology (ENVO) Unclassified
(38.129 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(54.676 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 5.74%    β-sheet: 33.61%    Coil/Unstructured: 60.66%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF13964Kelch_6 25.90
PF13418Kelch_4 7.19
PF01344Kelch_1 2.16
PF13672PP2C_2 0.72
PF04699P16-Arc 0.72
PF13415Kelch_3 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000136|KGI_S1_ANT02_95mDRAFT_c10126268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida644Open in IMG/M
3300002835|B570J40625_100064185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii4972Open in IMG/M
3300002835|B570J40625_100123047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii3078Open in IMG/M
3300002835|B570J40625_101498818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii554Open in IMG/M
3300004112|Ga0065166_10056144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1324Open in IMG/M
3300004795|Ga0007756_10572338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella644Open in IMG/M
3300005662|Ga0078894_10095008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2622Open in IMG/M
3300005662|Ga0078894_10116612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2372Open in IMG/M
3300005941|Ga0070743_10018530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2428Open in IMG/M
3300005987|Ga0075158_10140493All Organisms → Viruses → Predicted Viral1397Open in IMG/M
3300005988|Ga0075160_10110837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1515Open in IMG/M
3300005988|Ga0075160_10506456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii651Open in IMG/M
3300005989|Ga0075154_10701422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae544Open in IMG/M
3300006029|Ga0075466_1016658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2431Open in IMG/M
3300006037|Ga0075465_10007516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1986Open in IMG/M
3300006397|Ga0075488_1106087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii570Open in IMG/M
3300006415|Ga0099654_10085774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii675Open in IMG/M
3300006803|Ga0075467_10136560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1421Open in IMG/M
3300006803|Ga0075467_10268206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii919Open in IMG/M
3300006803|Ga0075467_10407168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii707Open in IMG/M
3300006805|Ga0075464_10131456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1460Open in IMG/M
3300006875|Ga0075473_10237872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea736Open in IMG/M
3300007094|Ga0102532_1172458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2510Open in IMG/M
3300007169|Ga0102976_1005631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2856Open in IMG/M
3300007169|Ga0102976_1115979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2458Open in IMG/M
3300007171|Ga0102977_1194891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2137Open in IMG/M
3300007523|Ga0105052_10087361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2152Open in IMG/M
3300007561|Ga0102914_1035145All Organisms → Viruses → Predicted Viral1573Open in IMG/M
3300007658|Ga0102898_1018326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1555Open in IMG/M
3300007670|Ga0102862_1137947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii620Open in IMG/M
3300007692|Ga0102823_1041234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1246Open in IMG/M
3300007957|Ga0105742_1011063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii936Open in IMG/M
3300008117|Ga0114351_1011350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii6273Open in IMG/M
3300008119|Ga0114354_1009199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii4617Open in IMG/M
3300008832|Ga0103951_10746488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii533Open in IMG/M
3300008999|Ga0102816_1074944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1021Open in IMG/M
3300009071|Ga0115566_10562316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida642Open in IMG/M
3300009086|Ga0102812_10530174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii644Open in IMG/M
3300009172|Ga0114995_10171161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1210Open in IMG/M
3300009243|Ga0103860_10108148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii606Open in IMG/M
3300009432|Ga0115005_11553654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea542Open in IMG/M
3300009436|Ga0115008_10038278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii3775Open in IMG/M
3300009436|Ga0115008_10173792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1555Open in IMG/M
3300009436|Ga0115008_10205844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1410Open in IMG/M
3300009436|Ga0115008_10251354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1258Open in IMG/M
3300009436|Ga0115008_10806800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii688Open in IMG/M
3300009440|Ga0115561_1318324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea573Open in IMG/M
3300009441|Ga0115007_10042068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2848Open in IMG/M
3300009470|Ga0126447_1060662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea931Open in IMG/M
3300009544|Ga0115006_10211729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1712Open in IMG/M
3300009544|Ga0115006_10766046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii850Open in IMG/M
3300009599|Ga0115103_1404483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2542Open in IMG/M
3300009679|Ga0115105_11089018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida508Open in IMG/M
3300009684|Ga0114958_10603015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii525Open in IMG/M
3300010885|Ga0133913_12585030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1233Open in IMG/M
3300012036|Ga0136600_1016075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1987Open in IMG/M
3300012408|Ga0138265_1234760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae2410Open in IMG/M
3300012504|Ga0129347_1113097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii777Open in IMG/M
3300012953|Ga0163179_10238267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1412Open in IMG/M
3300013004|Ga0164293_10443111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii867Open in IMG/M
(restricted) 3300013131|Ga0172373_10815108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella544Open in IMG/M
3300017748|Ga0181393_1088665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida805Open in IMG/M
3300017788|Ga0169931_10085794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida3101Open in IMG/M
3300018420|Ga0181563_10466756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii713Open in IMG/M
3300018585|Ga0193221_1002806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii959Open in IMG/M
3300018684|Ga0192983_1010484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1117Open in IMG/M
3300018692|Ga0192944_1028579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea805Open in IMG/M
3300018899|Ga0193090_1114927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii606Open in IMG/M
3300018974|Ga0192873_10126720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1101Open in IMG/M
3300018974|Ga0192873_10321132All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii652Open in IMG/M
3300018980|Ga0192961_10116202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii814Open in IMG/M
3300018980|Ga0192961_10206273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani588Open in IMG/M
3300018980|Ga0192961_10236364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii540Open in IMG/M
3300018986|Ga0193554_10202427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii738Open in IMG/M
3300019009|Ga0192880_10141869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii604Open in IMG/M
3300019021|Ga0192982_10325585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii551Open in IMG/M
3300019048|Ga0192981_10007373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2705Open in IMG/M
3300019048|Ga0192981_10010690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2438Open in IMG/M
3300019123|Ga0192980_1049709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea800Open in IMG/M
3300019123|Ga0192980_1076783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii615Open in IMG/M
3300019272|Ga0182059_1571228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida519Open in IMG/M
3300019459|Ga0181562_10194093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1069Open in IMG/M
3300020161|Ga0211726_10883292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1748Open in IMG/M
3300020172|Ga0211729_11206461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii776Open in IMG/M
3300020179|Ga0194134_10035196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2970Open in IMG/M
3300020546|Ga0208853_1004496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii3298Open in IMG/M
3300021108|Ga0214162_1004676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2695Open in IMG/M
3300021336|Ga0210307_1023157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2654Open in IMG/M
3300021350|Ga0206692_1496093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii632Open in IMG/M
3300021365|Ga0206123_10299386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea685Open in IMG/M
3300021887|Ga0063105_1024681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae2153Open in IMG/M
3300021889|Ga0063089_1070012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii519Open in IMG/M
3300021962|Ga0222713_10066258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2689Open in IMG/M
3300021962|Ga0222713_10334228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani953Open in IMG/M
3300023115|Ga0255760_10488130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii544Open in IMG/M
3300024343|Ga0244777_10092641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1948Open in IMG/M
3300024343|Ga0244777_10624764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii651Open in IMG/M
3300025645|Ga0208643_1139155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii626Open in IMG/M
3300025684|Ga0209652_1030943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2316Open in IMG/M
3300025887|Ga0208544_10031920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2690Open in IMG/M
3300025887|Ga0208544_10037024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2455Open in IMG/M
3300025887|Ga0208544_10114531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1198Open in IMG/M
3300025887|Ga0208544_10263474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii684Open in IMG/M
3300027243|Ga0208174_1003194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2013Open in IMG/M
3300027308|Ga0208796_1098658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii600Open in IMG/M
3300027760|Ga0209598_10055611All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae2013Open in IMG/M
3300027786|Ga0209812_10016060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae3653Open in IMG/M
3300027786|Ga0209812_10248161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae803Open in IMG/M
3300027833|Ga0209092_10053044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2503Open in IMG/M
3300027883|Ga0209713_10249756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1189Open in IMG/M
3300027883|Ga0209713_10609252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii703Open in IMG/M
3300027885|Ga0209450_10077803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2138Open in IMG/M
3300027885|Ga0209450_11203441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii526Open in IMG/M
3300028412|Ga0306910_1011007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1727Open in IMG/M
3300030670|Ga0307401_10457409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea580Open in IMG/M
3300030699|Ga0307398_10083963All Organisms → Viruses → Predicted Viral1512Open in IMG/M
3300030699|Ga0307398_10447943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii710Open in IMG/M
3300030788|Ga0073964_10855018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii593Open in IMG/M
3300031522|Ga0307388_10464504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida829Open in IMG/M
3300031569|Ga0307489_10575564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea774Open in IMG/M
3300031734|Ga0307397_10162759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii970Open in IMG/M
3300031738|Ga0307384_10499215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii575Open in IMG/M
3300031750|Ga0307389_10748079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii639Open in IMG/M
3300031758|Ga0315907_10827037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii688Open in IMG/M
3300031758|Ga0315907_10881906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii659Open in IMG/M
3300031784|Ga0315899_10565789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1078Open in IMG/M
3300031786|Ga0315908_10061706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2908Open in IMG/M
3300032092|Ga0315905_10957568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii725Open in IMG/M
3300032275|Ga0315270_10482010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii798Open in IMG/M
3300032463|Ga0314684_10456282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii751Open in IMG/M
3300032481|Ga0314668_10082330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1463Open in IMG/M
3300032519|Ga0314676_10152730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1250Open in IMG/M
3300032521|Ga0314680_10452168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii804Open in IMG/M
3300032521|Ga0314680_10636774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii673Open in IMG/M
3300032728|Ga0314696_10351249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii763Open in IMG/M
3300033984|Ga0334989_0034481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2740Open in IMG/M
3300034063|Ga0335000_0667706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii575Open in IMG/M
3300034068|Ga0334990_0394751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida745Open in IMG/M
3300034166|Ga0335016_0231190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1181Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine16.55%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine13.67%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.07%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine7.91%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.04%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.32%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent4.32%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.60%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.60%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.88%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.16%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.44%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.44%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.44%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.44%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.44%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.44%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.44%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.72%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.72%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.72%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.72%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.72%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.72%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.72%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.72%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.72%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.72%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.72%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.72%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.72%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000136Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5mEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004795Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005987Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNAEngineeredOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300005989Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNAEngineeredOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007094Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A)EnvironmentalOpen in IMG/M
3300007169Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007171Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007523Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007658Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3EnvironmentalOpen in IMG/M
3300007670Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007957Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_3.0umEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009243Microbial communities of water from Amazon river, Brazil - RCM13EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009470Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009684Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaGEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012036Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018585Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000269 (ERX1782265-ERR1712044)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020546Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021108Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300023115Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaGEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027243Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027308Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes)EnvironmentalOpen in IMG/M
3300027760Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027786Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300028412Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698 (v2)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034166Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
KGI_S1_ANT02_95mDRAFT_1012626813300000136MarineMSLAYQITDNEIMIFGGKSALTSQIFNGCFVFDAEKMEIREKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAEQEWVCIPKAFP*
B570J40625_10006418543300002835FreshwaterMVDKTKWVPAYMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVEQMQIKERGSLVNPCSFMNTPLVFNGSLFAYGNDVFVHKYDIPEQKWSVIPKTSAVLPRS*
B570J40625_10012304763300002835FreshwaterMGLAYQITDNEIILFGGKSAITFQIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDVYVHCYNIPEHKWSAIPKSSIVLPKA*
B570J40625_10149881813300002835FreshwaterMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVEKMQIRERGSLVNPCSFMNTPLVFNRCLFAYGNDIFVHKYDIPEQKWSVIPKTSSVLSR*
Ga0065166_1005614413300004112Freshwater LakeMGLAHQITENEILIFGGKSAVTFQIFNGCFVFDVEKMQIRERGSLVNPCSFMNTPLVFNRCLYAYGNDPYIHKYDIPEEKWSVIPKAKEVLPR*
Ga0007756_1057233813300004795Freshwater LakeMSNAYQISDKEIMIFGGKSALTFQIFDGCFIFDLERMSIKERGSLVNPCSFMNTPLVFNHTLYAYGNDVYIHKYSIPEQKWSVIPKVNV*
Ga0078894_1009500863300005662Freshwater LakeVDKSKWVPAYMGLAHQITENEILIFGGKSAVTFQIFNGCFVFDVEKMQIRERGSLVNPCSFMNTPLVFNRCLYAYGNDPYIHKYDIPEEKWSVIPKAKEVLPR*
Ga0078894_1011661213300005662Freshwater LakeMSNAYQITDKEIMIFGGKSALTFQIFDGVFIFDLERMQIKERGTLVNPCSFMNTPLVFNHTLYAYGNDVYIHKYHIPE*
Ga0070743_1001853053300005941EstuarineMIFGGKSALTSQIFNGCFVFDVQKMEMREKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAEQEWVCIPKAFP*
Ga0075158_1014049313300005987Wastewater EffluentMSLAYQITDKEIMIFGGKSALTFQIFNGVFVFDIERMEVVERGSLVNPCSYMNTPLVFNHHLYAYGNDIYIHKYSIPEQKWTCIPKAIL*
Ga0075160_1011083713300005988Wastewater EffluentMSLAYQITDKEIMIFGGKSALTFQIFNGVFVFDIERMEVVERGSLVNPCSYMNTPLVFNHNLYAYGNDIYIHKYSIPEQKWTCIPKAIL*
Ga0075160_1050645623300005988Wastewater EffluentMIFHEMFGEIPTSLVDKTKWVPAYMGLAYQITDNEILIFGGKSALTSRSLMDALCLMLKKCRFVREVVLSTPASFMNTPLVFNRCLYAYGNDIYVHKYDIPEQKWSVIPKTGAVLQRP*
Ga0075154_1070142213300005989Wastewater EffluentMSLAYQITDKEIMIFGGKSALTFQIFNGVFVFDIERMEVVERGSLVNPCSYMNTPLVFNHNLYAYGNDIYIHKYSIPEQKWTCIPKAIL**FNSI
Ga0075466_101665813300006029AqueousMDKSQWIQGYMSLAYQITDNEIMIFGGKSALTSQIFNGCFVFDVQKMEIREKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAEQEWVCIPKAFP*
Ga0075465_1000751613300006037AqueousMWQEIQSPLVNKTEWVPAYMGLAYQITDNEILLFGGKSAITFNIFNGCFVFDIEKMEIKERGSLVNPCSFMNTPLVFNKTLYAYGNDVYVHCYDIPEMKWSVIPKASVVRQRS*
Ga0075488_110608713300006397AqueousEILLFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNSCLFAYGNDIYVHQYNIPEQRWSVIPKSSIVLPKQ*
Ga0099654_1008577423300006415LakeMGLAYQITDNEIILFGGKSAITFQIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDVYVHCYNIPEHKWSAISKSSIVLPKA*
Ga0075467_1013656013300006803AqueousVWQEIPTQLVDKTKWVPAYMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVESMQIKERGSLVNPCSFMNTPLVFNRSLYAYGNDIYVHQYDIPEQNWSVIAKTNVVLPRN*
Ga0075467_1026820613300006803AqueousMGLAHQITDNEILLFGGKSASTFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNHSLYAYGNDIYVHQYNIPEQ*
Ga0075467_1040716813300006803AqueousCAPKVNKSHWVPSYMGLAHQITDNEILLFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNQNLYAYGNDIYVHQYNIPEQKWSVIPKSGVVLPKA*
Ga0075464_1013145613300006805AqueousVDKSKWVPAYMGLAYQITENEILIFGGKSAVTFQIFNGCFVFDVEKMHIRERGSLVNPCSFMNTPLVFNRCLYAYGNDPYIHKYDIPAEKWSVIPKAKEVLPR*
Ga0075473_1023787213300006875AqueousMSLAYQITDNEMMIFGGKSALTSQIFNGCFVFDAQKMEIREKGKLVNPCSFMNTPLVFGGNLYAFGNDPYIHKYKIAEQEWVCIPKAFP*
Ga0102532_117245823300007094Freshwater LakeMGLAHQITDNEILLFGGKSAATFHIFNGCFVFDVEKMEIRERGGLVNPCSFMNTPLVFNQSLYAYGNDIYVHQYNIPEQKWSVIPKSGIVLPKV*
Ga0102976_100563173300007169Freshwater LakeMGLAYQITDNEIIVFGGKSAITFQIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDVYVHCYNIPEHKWSAIPKSSVVLPKS*
Ga0102976_111597953300007169Freshwater LakeMGLAYQITDNEILIFGGKSAVTFQIFNGCFVFDLEKMQIRERGSLVNPCSFMNTPLVFNRSLYAYGNDPYIHKYDIPEEKWSVI
Ga0102977_119489113300007171Freshwater LakeMGLAYQITDNEILIFGGKSAVTFQIFNGCFVFDLEKMQIRERGSLVNPCSFMNTPLVFNRSLYAYGNDPYIHKYDIPEEKWSVIPKASSVLPRQ*
Ga0105052_1008736113300007523FreshwaterMIFGGKSALTSQIFNGCFVFDVQKMEIREKGKLVNPCSFMNAPLVFGGNLYAFGNDIYIHKYKIAEQEWVCIQKAFP*
Ga0102914_103514513300007561EstuarineMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVEKMQIRERGSLVNPCSFMNTPLVFNRCLFAYGNDIFVHKY
Ga0102898_101832643300007658EstuarineVDTIEVYDISRNVWQEICAPKVDKSNWVPSYMGLAHQITDNEILLFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNHSLYAYGNDIYVH
Ga0102862_113794713300007670EstuarineMGLAYQITENEILIFGGKSALTFQIFNGCYVFDVEKMQIKERGSLVNPCSFMNTPLVFNRSLYAYGNDIFVHKYDIPEQKWSVIPKTSVVLTR
Ga0102823_104123413300007692EstuarineMIFGGKSALTSQIFNGCFVFDVQKMEMREKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAEQEWVCIPKAF
Ga0105742_101106323300007957Estuary WaterMGLAHQITDNEILLFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNSSLYAYGNDIYVHQYNIPEQKWSVIPKTSVVLPKQ*
Ga0114351_101135073300008117Freshwater, PlanktonVDKTKWVPAYMGLAYQITDNEIIVFGGKSAITFQIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDVYVHCYNIPEHKWSAIPKSSVVLPKS*
Ga0114354_100919913300008119Freshwater, PlanktonMVDKTKWVPAYMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVEQMQIKERGSLVNPCSFMNTPLVFNGSLFAYGNDVFVHKYDIPEQKWSVI
Ga0103951_1074648813300008832MarineMGIILFGGKSAVTFHIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDIYVHQYNIPEQKWAVIPKSGVVLPKS*
Ga0102816_107494423300008999EstuarineMGLAYQITENEILIFGGKSALTFQIFNGCYVFDVEKMQIKERGSLVNPCSFMNTPLVFNRSLYAYGNDIFVHKYDIPEQKWSVIPKTSVVLTRP*
Ga0115566_1056231613300009071Pelagic MarineQGPTLDKTAWIPGYMSLSYQITDNEIIIFGGKSALTQQIFNGCFVFDVQKMAITEKGKLVNPCSFMNTPLVFGGHLYAFGNDIYIHKYNIAEQKWSCIPKAFP*
Ga0102812_1053017423300009086EstuarineMSLAYQITDNEIMIFGGKSALTSQIFNGCFVFDVQKMEIREKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKY
Ga0114995_1017116133300009172MarineMSLSYQITDNEIIIFGGKSALTQQIFNGCFVFDVQKMEVREKGKLVNPCSFMNTPLVFGGNMYAYGNDIYIHKYNIAEQKWSCIPKAFP*
Ga0103860_1010814813300009243River WaterVDAIEVYDISRNVWQEIDSSQVDKSKWVPAYMGLAYQITDNEILLFGGKSAITFQIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDVYVHCYNIPEHKWSAIPKSSVVLPKS*
Ga0115005_1155365413300009432MarineMGLAHQITEKEIMIFGGKSAVMFQIFNGCYVFDVEKMCMREHGSLVNPCSFMNTPLVFGGSLYAYGNDVYVHHYNIQEAKWSVIAKTATVLPKH*
Ga0115008_1003827883300009436MarineMGLAYQITDNEIILFGGKSAITFQIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDVYVHQYNIPEHKWSAIPKSSVVLPKS*
Ga0115008_1017379233300009436MarineMGLAHQITDNEIILFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNSNLYAYGNDIYVHQYNIPEQKWSVIPKSGVVLPKA*
Ga0115008_1020584433300009436MarineMGLAHQITDKEIMIFGGKSAILFQIFNGCYVFDVEQMCMREHGSLVNPCSFMNTPLVFDGALYAYGNDVYVHRYNIQEAKWSVIAKTAAVLPKH*
Ga0115008_1025135423300009436MarineVWQEIPSSLVDKTRWVPAYMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVERMQIKERGSLVNPCSFMNTPLVFNRSLYAYGNDIYVHKYDIPEQKWSVIPKTNTVLQRI*
Ga0115008_1080680013300009436MarineWQEIVSPTVDKTSWVPSYMGLAHQITDNEIILFGGKSAVTFHIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDIYVHQYNIPEQKWAVIPKSGVVLPKS*
Ga0115561_131832413300009440Pelagic MarineILIFGGKSALTFLIFNGCFVFDVEKMEIREKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAEQQWVCIPKAFP*
Ga0115007_1004206813300009441MarineMGLSHQITDKEIMIFGGKSAIMFQIFNGCYVFDVEKMCMREHGSLVNPCSFMNTPLVFDGNLYAYGNDVYVHRYNI*
Ga0126447_106066223300009470Meromictic PondMSLSYQITDNEILIFGGKSALTFQIFNGCFVFDLQKMEIKEKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAE*
Ga0115006_1021172933300009544MarineVWQEIGGAKCDKTNWVPSYMGLAHQITDNEIILFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNSNLYAYGNDIYVHQYNIPEQKWSVIPKSGVVLPKA*
Ga0115006_1076604613300009544MarineVWQEIGGAKCDKTNWVPSYMGLAHQITDNELILFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNSNLYAYGNDIYVHQYNIPEQKWSVIPKSGVVLPKA*
Ga0115103_140448353300009599MarineMSLAYQITENEIMIFGGKSALTSLIFNGCFVFDVQKMEIREKGKLVNPCSFMNTPLVFGGNLYAYGNDIYIHKYKIAEQEWVCIPKAFP*
Ga0115105_1108901813300009679MarineWIPGYMSLAYQITDNEILLFGGKSALTFQIFNGCFVFDVEKMEIREKGKLVNPCSFMNTPLVFGGNLYAFGNDIFIHKYSIAEQKWNCIPKQFP*
Ga0114958_1060301513300009684Freshwater LakeITENEILIFGGKSAVTFQIFNGCFVFDVEKMQIRERGSLVNPCSFMNTPLVFNRSLYAYGNDPYIHKYEIPEEKWSVIPKASSVLPRQ*
Ga0133913_1258503033300010885Freshwater LakeMSNAYQITDKEIMIFGGKSALTFQIFDGVFVLDLERMQIKERGTLVNPCSFMNTPLVFNHTLYAYGNDVYIHRYHIPEQRWSCIHK*
Ga0136600_101607513300012036Saline LakeMSLAYQITDNEIMIFGGKSALTSQIFNGCFVLDAEKMEIREKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAEQEWVCIPKAFP*
Ga0138265_123476063300012408Polar MarineMVDKSNWMPSYMGLAHQITEKEIMIFGGKSAVMFQIFNGCYVFDVEKMCMREHGSLVNPCSFMNTPLVFDGSLYAYGNDVYVHRYNIQEAKWSVIAKTAVVLPKH*
Ga0129347_111309713300012504AqueousLAHQITDNEIIIFGGKSALTFHIFNGVFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNSLFAYGNDIYVHQYNIPEQKWSVIPKTSVVLPKS*
Ga0163179_1023826733300012953SeawaterMGLAHQITDNEIILFGGKSAVTFHIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNSNLYAYGNDIYVHQYNIPEQKWSVIPKSGVVLPKS*
Ga0164293_1044311113300013004FreshwaterMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVEKMQIRERGSLVNPCSFMNTPLVFNRCLYAYGNDIFVHKYDIPEQKWSVIPKTSSVLSR*
(restricted) Ga0172373_1081510813300013131FreshwaterMSNAYQITDKEVMIFGGKSALTFQIFDGVFVFDIERMAIKERGSLVNPCSFMNTPLVFNHHLYAYGNDVYVHRYNIPEQKWSCIPKTLV*
Ga0181393_108866513300017748SeawaterMSLAYQITDNEILIFGGKSALTFQIFNGCFVFDVEKMEIREKGKLVNPCSFMNTPLVFGGNLYAFGNDIFIHKYSIAEQKWNCIPKQFP
Ga0169931_1008579413300017788FreshwaterMSNAYQITDKEIMIFGGKSALTFQIFDGVFVLDLERMAIRERGSLVNPCSFMNTPLVFNHHLYAYGNDVYVHKYNIPEQKWSCIPKGQH
Ga0181563_1046675613300018420Salt MarshMGLAYQITENEIILFGGKSAITFQIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDVYVH
Ga0193221_100280623300018585MarineMGLAHQITDNEILLFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLIFNHSLYAYGNDIYIH
Ga0192983_101048423300018684MarineMVDKSNWMPSYMGLAHQITEKEIMIFGGKSAVMFQIFNGCYVFDVEKMCMREHGSLVNPCSFMNTPLVFDGSLYAYGNDVYVHRYNIQEAKWSVIAKTAVVLPKH
Ga0192944_102857913300018692MarineMSLAYQITDNEILIFGGKSALTFLIFNGCFVLDVEKMEIKEKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAEQQWVCIPKAFP
Ga0193090_111492713300018899MarineKRIVDTIECYDIKRNVWQEIQTPMVDKSNWMPSYMGLAHQITEKEIMIFGGKSAVMFQIFNGCYVFDVEKMCMREHGSLVNPCSFMNTPLVFDGSLYAYGNDVYVHRYNIQEAKWSVIAKTAVVLPKH
Ga0192873_1012672013300018974MarineMGLAHQITDNEIILFGGKSAVTFHIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNSNLYAYGNDIYVHQYNIPEQKWSVIPKSGVVLPKS
Ga0192873_1032113213300018974MarineMGILLFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNSCLYAYGNDIYVHQYNIPEQKWSVIPKSSIVLPKQ
Ga0192961_1011620223300018980MarineMGLAHQITDNEIILFGGKSAVTFHIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDIYVHQYNIPEQKWAVIPKSGVVLPKS
Ga0192961_1020627313300018980MarineMSLSYQITDNEIIIFGGKSALTQQIFNGCFVFDVQKMEVREKGKLVNPCSFMNTPLVFGGNMYAYGNDIYIHKYNIAEQKWSC
Ga0192961_1023636423300018980MarineMGLSYQITDNEILLFGGKSAITFQIFNGCFVFDVEKMTIKERGSLVNPCSFMNTPLVFNNNLYAYGNDIFVHQYDIPEQKWSVIPK
Ga0193554_1020242713300018986MarineYDISRNVWQEIAAPKVDKSNWVPSYMGLAHQITDNEILLFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNSCLYAYGNDIYVHQYNIPEQKWSVIPKSSIVLPKQ
Ga0192880_1014186913300019009MarinePTVDKTSWVPSYMGLAHQITDNEIILFGGKSAVTFHIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDIYVHQYNIPEQKWAVIPKSGVVLPKS
Ga0192982_1032558513300019021MarineNVWQEIVAPKVDKSSWVPSYMGLAHQITDNEILLFGGKSAATFHIFNGCFVFDVEKMELRERGSLVNPCSFMNTPLVFNHSLYAYGNDIYIHQYNIPEQKWSVIPKSSVVLPKA
Ga0192981_1000737313300019048MarineVDTIECYNISKNVWQEVQSPSINKQDWIPGYMSLAYQITDNEILIFGGKSALTFLIFNGCFVFDVEKMEIKEKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAEQQWVCIPKAFP
Ga0192981_1001069013300019048MarineMIFGGKSAIMFQIFNGCYVFDVEKMCMREHGSLVNPCSFMNTPLVFDGNLYAYGNDVYVHRYNITECKWSVIAKTAAVLPKH
Ga0192980_104970913300019123MarineKNIVDTIECYNISKNVWQEVQSPSINKQDWIPGYMSLAYQITDNEILIFGGKSALTFLIFNGCFVFDVEKMEIKEKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAEQQWVCIPKAFP
Ga0192980_107678313300019123MarineIVDTIECYDIKRNVWQEIQTPMVDKSNWMPSYMGLAHQITEKEIMIFGGKSAVMFQIFNGCYVFDVEKMCMREHGSLVNPCSFMNTPLVFDGSLYAYGNDVYVHRYNIQEAKWSVIAKTAVVLPKH
Ga0182059_157122813300019272Salt MarshMSLAYQVTDNEILIFGGKSALTFQIFNGCFVFDVKKMEIREKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYNIAEQKW
Ga0181562_1019409323300019459Salt MarshMSLSYQITDNEILIFGGKSALTFQIFNGCFVFDLQKMEIKEKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAEQQWTCIPKAFP
Ga0211726_1088329233300020161FreshwaterMGLAHQITDNEILLFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNQSLYAYGNDIYVHQYNIPEQKWSVIPKSGIVLPKV
Ga0211729_1120646123300020172FreshwaterMGLAYQITDNEIIVFGGKSAITFQIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDVYVHCYNIPEHKWSAIPKSSVVLPKS
Ga0194134_1003519613300020179Freshwater LakeLFGGKSAITFQIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDVYVHCYSIPEHKWSAIPKSSKVLPKS
Ga0208853_100449613300020546FreshwaterMGLAYQITDNEIILFGGKSAITFQIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDVYVHCYNIPEHKWSAIPKSSIVLPKA
Ga0214162_100467613300021108FreshwaterVDKSKWVPAYMGLAYQITENEILIFGGKSAVTFQIFNGCFVFDVEKMHIRERGSLVNPCSFMNTPLVFNRCLYAYGNDPYIHKYDIPAEKWSVIPKAKEVLPR
Ga0210307_102315713300021336EstuarineMGLAYQITENEILIFGGKSALTFQIFNGCYVFDVEKMQIKERGSLVNPCSFMNTPLVFNRSLYAYGNDIFVHKYDIPEQKWSVIPKTSVVLTRP
Ga0206692_149609313300021350SeawaterMGLAHQITDKEILLFGGKSALTFQIFNGCFVFDVEKMQIREQGSLVNPCSFMNTPLVFNSSLYAYGNDIYVHKYDVPEQKWSVIPKTSVVLPRS
Ga0206123_1029938613300021365SeawaterVQSPSINKQDWIPGYMSLAYQITDNEILIFGGKSALTFLIFNGCFVFDVEKMEIKERGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAEQ
Ga0063105_102468153300021887MarineMGLAHQITDKEIMIFGGKSAILFQIFNGCYVFDVEQMCMREHGSLVNPCSFMNTPLVFDGALYAYGNDVYVHRYNIQEAKWSVIAKTAAVLPKH
Ga0063089_107001213300021889MarineDKTAWVPSYMGLAHQITDKEIMIFGGKSAILFQIFNGCYVFDVEQMCMREHGSLVNPCSFMNTPLVFDGALYAYGNDVYVHRYNIQEAKWSVIAKTAAVLPKH
Ga0222713_1006625813300021962Estuarine WaterMSLAYQITDNEIMIFGGKSALTSQIFNGVFVFDVEKMEIREKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAE
Ga0222713_1033422813300021962Estuarine WaterMIFGGKSALTSQIFNGCFVFDVQKMEMREKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAEQEWVCIPKAFP
Ga0255760_1048813013300023115Salt MarshDISRNVWQEIPSSLVDKTKWVPAYMGLAYQITDNEILVFGGKSALTFQIFNGCFVFDVERMEIRERGSLVNPCSFMNTPLVFNRCLYAYGNDIFVHKYDIPEQRWSVIPKTSAVLSRP
Ga0244777_1009264123300024343EstuarineMAPKVDKSNWVPSYMGLAHQITDNEILLFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNSSLYAYGNDIYVHQYNIPEQKWSVIPKTSVVLPKQ
Ga0244777_1062476413300024343EstuarineMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVEKMQIRERGSLVNPCSFMNTPLVFNRCLFAYGNDIFVHKYDIPEQKWSVIPKTSSVLSR
Ga0208643_113915513300025645AqueousITRNVWQEIQTPFVNKVQWVPSYMGLAYQITDNEIILFGGKSAITFQIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDIFVHQYDIPEQKWSVIPKTSVVLPKQ
Ga0209652_103094313300025684MarineMGLAHQITDNEIIIFGGKSALTFHIFNGVFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNSLFAYGNDIYVHQYNIPEQKWSVIPKTSVVLPKS
Ga0208544_1003192013300025887AqueousMDKSQWIQGYMSLAYQITDNEIMIFGGKSALTSQIFNGCFVFDVQKMEIREKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAEQEWVCIPKAFP
Ga0208544_1003702453300025887AqueousMGLAHQITDNEILLFGGKSASTFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNHSLYAYGNDIYVHQYNIPEQ
Ga0208544_1011453113300025887AqueousMSLAYQITDNEIMIFGGKSALTSQIFNGCFVFDAEKMEIREKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAEQEWVCIPKAFP
Ga0208544_1026347413300025887AqueousHWVPSYMGLAHQITDNEILLFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNQNLYAYGNDIYVHQYNIPEQKWSVIPKSGVVLPKA
Ga0208174_100319433300027243EstuarineMGLAHQITDNEILLFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNSSLYAYGNDIYVHQYNIPEQKWSVIPKTSVVLPKQ
Ga0208796_109865823300027308EstuarineMSLAYQITDNEILIFGGKSALTFLIFNGCFVFDIEKMEIREKGKLVNPCSFMNTPLVFNNNLYAYGNDIYVHQYNIPEQKWAVIPKTSVVLPKS
Ga0209598_1005561113300027760Freshwater LakeMSNAYQVTDKEIMIFGGKSALTFQIFDGVFIFDLERMVITERGSMVNPCSFMNTPLVFNHSLYAYGNDIYIHKYNIPE
Ga0209812_1001606033300027786Wastewater EffluentMSLAYQITDKEIMIFGGKSALTFQIFNGVFVFDIERMEVVERGSLVNPCSYMNTPLVFNHNLYAYGNDIYIHKYSIPEQKWTCIPKAIL
Ga0209812_1024816113300027786Wastewater EffluentMSLAYQITDKEIMIFGGKSALTFQIFNGVFVFDIERMEVVERGSLVNPCSYMNTPLVFNHHLYAYGNDIYIHKYSIPEQKWTCIPKAIL
Ga0209092_1005304463300027833MarineMGLAYQITDNEIILFGGKSAITFQIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDVYVHQYNIPEHKWSAIPKSSVVLPKS
Ga0209713_1024975613300027883MarineMGLAHQITDNEIILFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNSNLYAYGNDIYVHQYNIPEQKWSVIPKSGVVLPKA
Ga0209713_1060925213300027883MarineFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNSNLYAYGNDIYVHQYNIPEQKWSVIPKSGVVLPKA
Ga0209450_1007780323300027885Freshwater Lake SedimentVDTIECYDISRNVWQEIAAPKVDKSNWVPSYMGLAHQITDNEILLFGGKSAATFHIFNGCYVFDVEKMEIRERGSLVNPCSFMNTPLVFNQSLYAYGNDIYVHQYNIPEQKWSVIPKSGTVLPKV
Ga0209450_1120344113300027885Freshwater Lake SedimentMGLAYQITENEILIFGGKSAVTFQIFNGCFVFDVEKMHIRERGSLVNPCSFMNTPLVFNRCLYAYGNDPYIHKYDIPAEKWSVIPKAKEVLPR
Ga0306910_101100733300028412Saline LakeMSLAYQITDNEIMIFGGKSALTSQIFNGCFVLDAEKMEIREKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYKIAEQEWVCIPKAFP
Ga0307401_1045740913300030670MarineIDQRNIVDTIECYDISKNVWQEIAGTSTPLDKSAWIPGYMSLAYQITDNEILIFGGKSALTFQIFNGCFVFDVEKMEIREKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYSIAEQKWNCIPKQFP
Ga0307398_1008396323300030699MarineMSLAYQITDNEIMIFGGKSALTSQIFNGCFVFDAQRMEIREKGKLVNPCSFMNTPLVFGGNLYAFGNDPYIHKYKIAEQEWVCIPKAFP
Ga0307398_1044794323300030699MarineMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVERMQIRERGSLVNPCSFMNTPLVFNRNLYAYGNDIFVHKYDIPDQKWSVIPKTSAVLSRP
Ga0073964_1085501813300030788MarineMGLAHQITDNEIILFGGKSAVTFHIFNGCFVFDVEKMTIKERGSLVNPCSFMNTPLVFNNNLYAYGNDIYVHQYNIPEQKWSVIPKTSIVLPKS
Ga0307388_1046450413300031522MarineRNVWQEIPNNLVDKTRWVPAYMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVEKMEIREKGKLVNPCSFMNTPLVFGGNLYAFGNDIYIHKYSIAEQKWNCIPKQFP
Ga0307489_1057556413300031569Sackhole BrineMSLSYQITDNEIIIFGGKSALTQQIFNGCFVFDVQKMSISEKGKLVNPCSFMNTPLVFGGYLYAFGNDIYIHKYNIAE
Ga0307397_1016275913300031734MarineMARDSYNLVDKTRWVPAYMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVERMQIRERGSLVNPCSFMNTPLVFNRNLYAYGNDIFVHKYDIPDQKWSVIPKTSAVLSRP
Ga0307384_1049921513300031738MarineNKTSWVPSYMGLAHQITDKEIMIFGGKSAILFQIFNGCYVFDVEQMCMREHGSLVNPCSFMNTPLVFDGSLYAYGNDVYVHRYNIQEAKWTVIPKTAAVLPKH
Ga0307389_1074807913300031750MarineMGLAHQITDNEILLFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNSSLYAYGNDIYVHQYNIPEQKWSVIPKSGVVLPKQ
Ga0315907_1082703713300031758FreshwaterMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVEKMQIRERGSLVNPCSFMNTPLVFNRCLYAYGNDIFVHKYDIPEQKWSVIPKTSSVLSR
Ga0315907_1088190613300031758FreshwaterRIVDAIEVYDISRNVWQEIDSSQVDKTKWVPAYMGLAYQITDNEIIVFGGKSAITFQIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDVYVHCYNIPEHKWSAIPKSSVVLPKS
Ga0315899_1056578923300031784FreshwaterMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVEKMQIRERGSLVNPCSFMNTPLVFNRCLYAYGNDIFVH
Ga0315908_1006170623300031786FreshwaterMVDKTKWVPAYMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVEQMQIKERGSLVNPCSFMNTPLVFNGSLFAYGNDVFVHKYDIPEQKWSVIPKTSAVLPRS
Ga0315905_1095756813300032092FreshwaterVDKTKWVPAYMGLAYQITENEIIIFGGKSALTFQIFNGCFVFDVEKMQLRERGSLVNPCSFMNTPLVFNRCLYAYGNDIFVHKYDIPEQKWSVIPKTS
Ga0315270_1048201013300032275SedimentVDTIECYDISRNVWQEIAAPKVDKSHWVPSYMGLAHQITDNEILLFGGKSAATFHIFNGCFVFDVEKMEIRERGSLVNPCSFMNTPLVFNQSLYAYGNDIYVHQYNIPEQKWSVIPKSGIVLPKV
Ga0314684_1045628213300032463SeawaterMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVERMQIKERGSLVNPCSFMNTPLVFNRSLYAYGNDIYVHKYDIPEQKWSVIPKTNTVLQRI
Ga0314668_1008233043300032481SeawaterVWQEIPSSLVDKTRWVPAYMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVERMQIKERGSLVNPCSFMNTPLVFNRSLYAYGNDIYVHKYDIPEQKWSVIPKTNTVLQRI
Ga0314676_1015273013300032519SeawaterMSLSYQITDNEIIIFGGKSALTQQIFNGCFVFDVQKMEIKEKGKLVNPCSFMNTPLVFGGHLYAFGNDIYIHKYNIAE
Ga0314680_1045216823300032521SeawaterMVDKSNWMPSYMGLAHQITEKEIMIFGGKSAVMFQIFNGCYVFDVEKMCMREHGSLVNPCSFMNTPLVFGGSLYAYGNDVYVHHYNIQEAKWSVIAKTATVLPKH
Ga0314680_1063677413300032521SeawaterMGLAYQITDNEIMIFGGKSAITFNIFNGCFVFDIEKMEIKERGSLVNPCSFMNTPLVFDNTLYAYGNDIYVHCYDIPD
Ga0314696_1035124923300032728SeawaterVWQEIPSSLVDKTRWVPAYMGLAYQITENEILIFGGKSALTFQIFNGCFVFDVERMQIKERGSLVNPCSFMNTPLVFNRSLYAYGNDIYVHKYDIPEQKWSVIPKTN
Ga0334989_0034481_262_5463300033984FreshwaterMGLAYQITENEILIFGGKSAVTFQIFNGCFVFDVEKMQIRERGSLVNPCSFMNTPLVFNRSLYAYGNDPYIHKYDIPEEKWSVIPKASSVLPRQ
Ga0335000_0667706_237_5183300034063FreshwaterMGLAYQITENEILIFGGKSAVTFQIFNGCFVFDVEKMQIRERGSLVNPCSFMNTPLVFNRCLYAYGNDPYIHKYDIPEEKWSVIPKAKEVLPR
Ga0334990_0394751_196_4653300034068FreshwaterMSLAYQITDNEIIIFGGKSKLTQQIFNGCFVFDVQKMEIKESGKLVNPCSFMNTPLVFGGNLYAFGNDVYIHKYNISEQKWSCIPKAFQ
Ga0335016_0231190_273_6353300034166FreshwaterVYDISRNVWQEIDSSQVDKTKWVPAYMGLAYQITDNEIIVFGGKSAITFQIFNGCFVFDVEKMEIKERGSLVNPCSFMNTPLVFNNNLYAYGNDVYVHCYNIPEHKWSAIPKSSVVLPKS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.