| Basic Information | |
|---|---|
| Family ID | F054835 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 139 |
| Average Sequence Length | 43 residues |
| Representative Sequence | EATAALVFAQALPGGVEPGPDQSRSYAEWLGQRPGADSDTGA |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 86.33 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.014 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (23.022 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.022 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.201 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.86% β-sheet: 0.00% Coil/Unstructured: 77.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF06897 | DUF1269 | 2.16 |
| PF11139 | SfLAP | 2.16 |
| PF07508 | Recombinase | 2.16 |
| PF12277 | DUF3618 | 2.16 |
| PF01734 | Patatin | 2.16 |
| PF08279 | HTH_11 | 1.44 |
| PF02810 | SEC-C | 1.44 |
| PF03729 | DUF308 | 1.44 |
| PF00282 | Pyridoxal_deC | 1.44 |
| PF00583 | Acetyltransf_1 | 1.44 |
| PF02627 | CMD | 1.44 |
| PF02517 | Rce1-like | 0.72 |
| PF07885 | Ion_trans_2 | 0.72 |
| PF13520 | AA_permease_2 | 0.72 |
| PF09363 | XFP_C | 0.72 |
| PF01934 | HepT-like | 0.72 |
| PF08044 | DUF1707 | 0.72 |
| PF09851 | SHOCT | 0.72 |
| PF12697 | Abhydrolase_6 | 0.72 |
| PF10431 | ClpB_D2-small | 0.72 |
| PF10009 | DUF2252 | 0.72 |
| PF13669 | Glyoxalase_4 | 0.72 |
| PF02148 | zf-UBP | 0.72 |
| PF13537 | GATase_7 | 0.72 |
| PF03200 | Glyco_hydro_63 | 0.72 |
| PF04237 | YjbR | 0.72 |
| PF04672 | Methyltransf_19 | 0.72 |
| PF00296 | Bac_luciferase | 0.72 |
| PF03631 | Virul_fac_BrkB | 0.72 |
| PF10011 | DUF2254 | 0.72 |
| PF07332 | Phage_holin_3_6 | 0.72 |
| PF00589 | Phage_integrase | 0.72 |
| PF00230 | MIP | 0.72 |
| PF04972 | BON | 0.72 |
| PF13466 | STAS_2 | 0.72 |
| PF00027 | cNMP_binding | 0.72 |
| PF14659 | Phage_int_SAM_3 | 0.72 |
| PF03781 | FGE-sulfatase | 0.72 |
| PF13350 | Y_phosphatase3 | 0.72 |
| PF14016 | DUF4232 | 0.72 |
| PF00293 | NUDIX | 0.72 |
| PF06325 | PrmA | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 2.16 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 2.16 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 2.16 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 2.16 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 2.16 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.44 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.44 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 1.44 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 1.44 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.72 |
| COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 0.72 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.72 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 0.72 |
| COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.72 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.72 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.72 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.01 % |
| Unclassified | root | N/A | 17.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10200674 | Not Available | 785 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100957615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 739 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10409065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
| 3300005166|Ga0066674_10521960 | Not Available | 532 | Open in IMG/M |
| 3300005332|Ga0066388_106255723 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005445|Ga0070708_100236026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1716 | Open in IMG/M |
| 3300005553|Ga0066695_10823141 | Not Available | 534 | Open in IMG/M |
| 3300005614|Ga0068856_102085408 | Not Available | 577 | Open in IMG/M |
| 3300006028|Ga0070717_11983881 | Not Available | 525 | Open in IMG/M |
| 3300006052|Ga0075029_100564564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300006057|Ga0075026_100839393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
| 3300006580|Ga0074049_11644814 | Not Available | 558 | Open in IMG/M |
| 3300006580|Ga0074049_12068026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1110 | Open in IMG/M |
| 3300006604|Ga0074060_11896873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 983 | Open in IMG/M |
| 3300006797|Ga0066659_10801625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 779 | Open in IMG/M |
| 3300007076|Ga0075435_101091861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 697 | Open in IMG/M |
| 3300009038|Ga0099829_10149476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1863 | Open in IMG/M |
| 3300009519|Ga0116108_1015270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2741 | Open in IMG/M |
| 3300009520|Ga0116214_1141280 | Not Available | 894 | Open in IMG/M |
| 3300009520|Ga0116214_1368740 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300009523|Ga0116221_1177228 | Not Available | 926 | Open in IMG/M |
| 3300009524|Ga0116225_1371233 | Not Available | 637 | Open in IMG/M |
| 3300009525|Ga0116220_10469365 | Not Available | 568 | Open in IMG/M |
| 3300009630|Ga0116114_1119560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 688 | Open in IMG/M |
| 3300009672|Ga0116215_1009546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4800 | Open in IMG/M |
| 3300009698|Ga0116216_10375822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 863 | Open in IMG/M |
| 3300009698|Ga0116216_10404184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 829 | Open in IMG/M |
| 3300009698|Ga0116216_10907294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300009698|Ga0116216_10956361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300009700|Ga0116217_10111277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1863 | Open in IMG/M |
| 3300009700|Ga0116217_10198377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1320 | Open in IMG/M |
| 3300009700|Ga0116217_10516616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora → Acrocarpospora macrocephala | 749 | Open in IMG/M |
| 3300009764|Ga0116134_1115514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 963 | Open in IMG/M |
| 3300009824|Ga0116219_10254738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. SM1 | 995 | Open in IMG/M |
| 3300009824|Ga0116219_10506172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
| 3300009839|Ga0116223_10725786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
| 3300010043|Ga0126380_10507001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 928 | Open in IMG/M |
| 3300010343|Ga0074044_10169323 | Not Available | 1458 | Open in IMG/M |
| 3300010343|Ga0074044_11007933 | Not Available | 546 | Open in IMG/M |
| 3300010366|Ga0126379_10734641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1083 | Open in IMG/M |
| 3300010371|Ga0134125_12964197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → Candidatus Dormibacter → unclassified Candidatus Dormibacter → Candidatus Dormibacter sp. RRmetagenome_bin12 | 515 | Open in IMG/M |
| 3300010373|Ga0134128_11001854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 923 | Open in IMG/M |
| 3300010379|Ga0136449_100358304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2616 | Open in IMG/M |
| 3300010379|Ga0136449_101579963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
| 3300010379|Ga0136449_103039003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 654 | Open in IMG/M |
| 3300010379|Ga0136449_103069596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 649 | Open in IMG/M |
| 3300010379|Ga0136449_104217122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
| 3300010400|Ga0134122_11130419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae | 778 | Open in IMG/M |
| 3300010867|Ga0126347_1258336 | Not Available | 662 | Open in IMG/M |
| 3300012200|Ga0137382_11096249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 569 | Open in IMG/M |
| 3300012208|Ga0137376_11225789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 640 | Open in IMG/M |
| 3300012349|Ga0137387_11160567 | Not Available | 547 | Open in IMG/M |
| 3300012353|Ga0137367_10656724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 732 | Open in IMG/M |
| 3300012355|Ga0137369_10076549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2816 | Open in IMG/M |
| 3300012363|Ga0137390_10742043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 942 | Open in IMG/M |
| 3300012955|Ga0164298_10964427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 626 | Open in IMG/M |
| 3300012971|Ga0126369_13072175 | Not Available | 546 | Open in IMG/M |
| 3300014159|Ga0181530_10435749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 662 | Open in IMG/M |
| 3300014165|Ga0181523_10159033 | Not Available | 1325 | Open in IMG/M |
| 3300014838|Ga0182030_11700493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
| 3300015371|Ga0132258_11667082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1608 | Open in IMG/M |
| 3300016294|Ga0182041_10589514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 975 | Open in IMG/M |
| 3300017821|Ga0187812_1019794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2325 | Open in IMG/M |
| 3300017822|Ga0187802_10182415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 805 | Open in IMG/M |
| 3300017822|Ga0187802_10357800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
| 3300017924|Ga0187820_1010115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2256 | Open in IMG/M |
| 3300017926|Ga0187807_1072316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1074 | Open in IMG/M |
| 3300017926|Ga0187807_1226097 | Not Available | 610 | Open in IMG/M |
| 3300017926|Ga0187807_1322989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300017932|Ga0187814_10192358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
| 3300017932|Ga0187814_10316783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 599 | Open in IMG/M |
| 3300017934|Ga0187803_10021713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2560 | Open in IMG/M |
| 3300017942|Ga0187808_10555870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300017943|Ga0187819_10398507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 791 | Open in IMG/M |
| 3300017955|Ga0187817_10083830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1994 | Open in IMG/M |
| 3300017994|Ga0187822_10392186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300017995|Ga0187816_10283987 | Not Available | 725 | Open in IMG/M |
| 3300018006|Ga0187804_10280915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 722 | Open in IMG/M |
| 3300018016|Ga0187880_1041116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2531 | Open in IMG/M |
| 3300018026|Ga0187857_10455469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
| 3300021401|Ga0210393_10160520 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300021402|Ga0210385_11036124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300021406|Ga0210386_10037255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3834 | Open in IMG/M |
| 3300021406|Ga0210386_10089299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2509 | Open in IMG/M |
| 3300021560|Ga0126371_12294043 | Not Available | 652 | Open in IMG/M |
| 3300025444|Ga0208189_1089786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300025464|Ga0208076_1014434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1346 | Open in IMG/M |
| 3300025480|Ga0208688_1022948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1575 | Open in IMG/M |
| 3300025627|Ga0208220_1080909 | Not Available | 898 | Open in IMG/M |
| 3300025916|Ga0207663_11078929 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300025929|Ga0207664_10757661 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300026294|Ga0209839_10138082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 811 | Open in IMG/M |
| 3300027783|Ga0209448_10253140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
| 3300027905|Ga0209415_10026014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 8707 | Open in IMG/M |
| 3300027911|Ga0209698_11111474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
| 3300028679|Ga0302169_10183704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 536 | Open in IMG/M |
| 3300028813|Ga0302157_10069872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2338 | Open in IMG/M |
| 3300028877|Ga0302235_10157850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1010 | Open in IMG/M |
| 3300030707|Ga0310038_10164423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → unclassified Cellulomonas → Cellulomonas sp. URHD0024 | 1090 | Open in IMG/M |
| 3300030707|Ga0310038_10167513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1076 | Open in IMG/M |
| 3300030707|Ga0310038_10457899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
| 3300031226|Ga0307497_10559845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300031231|Ga0170824_113140050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 793 | Open in IMG/M |
| 3300031549|Ga0318571_10337529 | Not Available | 575 | Open in IMG/M |
| 3300031640|Ga0318555_10365951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300031668|Ga0318542_10450493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
| 3300031723|Ga0318493_10334460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 821 | Open in IMG/M |
| 3300031778|Ga0318498_10422233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300031819|Ga0318568_10354358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 913 | Open in IMG/M |
| 3300031954|Ga0306926_10407848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1677 | Open in IMG/M |
| 3300032001|Ga0306922_12275111 | Not Available | 521 | Open in IMG/M |
| 3300032055|Ga0318575_10063144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1730 | Open in IMG/M |
| 3300032160|Ga0311301_10176425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 3752 | Open in IMG/M |
| 3300032160|Ga0311301_10294693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 2607 | Open in IMG/M |
| 3300032160|Ga0311301_10434182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1988 | Open in IMG/M |
| 3300032160|Ga0311301_10807262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 1287 | Open in IMG/M |
| 3300032160|Ga0311301_11225670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
| 3300032160|Ga0311301_12739476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300032770|Ga0335085_10889819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 971 | Open in IMG/M |
| 3300032770|Ga0335085_12369631 | Not Available | 529 | Open in IMG/M |
| 3300032782|Ga0335082_10054743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4105 | Open in IMG/M |
| 3300032783|Ga0335079_10051524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4711 | Open in IMG/M |
| 3300032783|Ga0335079_10482033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1325 | Open in IMG/M |
| 3300032783|Ga0335079_10511458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1279 | Open in IMG/M |
| 3300032783|Ga0335079_11040742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 832 | Open in IMG/M |
| 3300032783|Ga0335079_11678241 | Not Available | 622 | Open in IMG/M |
| 3300032805|Ga0335078_10184596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2914 | Open in IMG/M |
| 3300032805|Ga0335078_11168921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 892 | Open in IMG/M |
| 3300032828|Ga0335080_10030434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 5891 | Open in IMG/M |
| 3300032828|Ga0335080_10277743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1824 | Open in IMG/M |
| 3300032828|Ga0335080_10384730 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300032892|Ga0335081_12645741 | Not Available | 514 | Open in IMG/M |
| 3300032893|Ga0335069_10245554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2156 | Open in IMG/M |
| 3300032893|Ga0335069_12257372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300032895|Ga0335074_11191325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300032898|Ga0335072_10417845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1430 | Open in IMG/M |
| 3300032955|Ga0335076_10184167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1995 | Open in IMG/M |
| 3300033158|Ga0335077_10642779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1101 | Open in IMG/M |
| 3300033290|Ga0318519_10677450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 23.02% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 14.39% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 11.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.04% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.16% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.16% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.16% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.44% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.44% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.44% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.44% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.72% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.72% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.72% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.72% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.72% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_102006741 | 3300001356 | Peatlands Soil | LVFAQPLPAGVEPGPDHSRSYAEWLGRPPGAESDADT* |
| JGIcombinedJ26739_1009576152 | 3300002245 | Forest Soil | LVFDEPLPGGVEPGPDDSRSYAEWLGQRPGTGSDDDA* |
| JGIcombinedJ51221_104090652 | 3300003505 | Forest Soil | LQAIAALVFAQALPGGVEPGPDESRSYAEWLGWPPAAESEADT* |
| Ga0066674_105219601 | 3300005166 | Soil | QATAAHVFAQALPGGVKPGPDNSTSYPQWLDRQPPTGSDTGP* |
| Ga0066388_1062557232 | 3300005332 | Tropical Forest Soil | ADLLRSGLQATAALVFAQAVPGEVQLGTDDSRSYADWLGQRPGAGRDGRA* |
| Ga0070708_1002360263 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TELLRSELQATVALVFAQALPGGVEPGMDDSRSYAQWLRQQADAKSDADT* |
| Ga0066695_108231411 | 3300005553 | Soil | GPAGLLRGQLQATAAHVFAQALPGGVKPGPDNSTSYPQWLDRQPPTGSDTGP* |
| Ga0068856_1020854081 | 3300005614 | Corn Rhizosphere | ALVFAQALPAGVQPGPDQSRSYAQWLSQRPGADSDASA* |
| Ga0070717_119838812 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DLLRSELQATAALVFAHALPAGMEPGPDQSRSYAEWLSPQPGAESHA* |
| Ga0075029_1005645642 | 3300006052 | Watersheds | LQATAALVFAQPLPAGVEPGPDYSRSYAEWLGRPPGAESDVDT* |
| Ga0075026_1008393932 | 3300006057 | Watersheds | KPGHRSSAQPGSTLVFAQALPGGVEPGPDDSRSYAQWLGWPPGAESGR* |
| Ga0074049_116448142 | 3300006580 | Soil | ELETAAAAVFSHAMPGGMEPGPDESRSYAEWLGQMPDRENDGDA* |
| Ga0074049_120680263 | 3300006580 | Soil | ATAALVFAQALPSGAQPGPDESSSYAQWLSLRPGADSNANA* |
| Ga0074060_118968731 | 3300006604 | Soil | LQATAALVFARALPGGVEPGPDESRSYAEWLGQQPGPKSDAGA* |
| Ga0066659_108016251 | 3300006797 | Soil | EATGPAGLLRGQLQATAAHVFAQALPGGVKPGPDNSTSYPQWLDRQPPTGSDTGP* |
| Ga0075435_1010918611 | 3300007076 | Populus Rhizosphere | RSELQATAALVFAHALPGGVQPGPDESRSYAQWLGQRPDADADG* |
| Ga0099829_101494764 | 3300009038 | Vadose Zone Soil | VFAQALPGGMEPGPDESRSYAQWLSLRPGAEGDAGA* |
| Ga0116108_10152701 | 3300009519 | Peatland | RGQLEATAALVFAQALPGGVEPGTDDSRSFAEWLCQQPGTGSDAGA* |
| Ga0116214_11412802 | 3300009520 | Peatlands Soil | VFAQPLPAGVEPGPDHSRSYAEWLGRPPGAESDAGT* |
| Ga0116214_13687401 | 3300009520 | Peatlands Soil | AAAALVFAQAMHGGMEPGTDEARSYAEWLGQRPGADSDAVE* |
| Ga0116221_11772281 | 3300009523 | Peatlands Soil | TAALVFAQPLPAGVEPGPDHSRSYAEWLGRPPGAESDAGT* |
| Ga0116225_13712331 | 3300009524 | Peatlands Soil | LEATAALVFAHALPGRMEFGPDKARSYAEWLGQRPGAGSDAGA* |
| Ga0116220_104693652 | 3300009525 | Peatlands Soil | QATAALVFAQPLPAGVEPGPDHSRSYAEWLGRPPGAESDADT* |
| Ga0116114_11195601 | 3300009630 | Peatland | LVFAQALPGGVEPGTDDSRSFAEWLCQQPGTGSDAGA* |
| Ga0116215_10095461 | 3300009672 | Peatlands Soil | TAALVFAQALPGGVEPGTDDSRSFAEWLCQQPGTGSDAGA* |
| Ga0116216_103758221 | 3300009698 | Peatlands Soil | TGPASQLRSALQATAALIFAHALPGDVEPGPDESRSYAEWLCLRPGADSDADA* |
| Ga0116216_104041842 | 3300009698 | Peatlands Soil | FAQPLPGGVEPGPDESRSYAEWLCWPPGAERDRDA* |
| Ga0116216_109072941 | 3300009698 | Peatlands Soil | LLHGELQATAALVFAQPLPAGVEPGPDHSRSYAEWLRRPPGAQSDAGT* |
| Ga0116216_109563611 | 3300009698 | Peatlands Soil | LLRSELQATAALVFAHALPGSAQPGPDQSRSYAEWLCQQSGTESYAAWKASDHRS* |
| Ga0116217_101112775 | 3300009700 | Peatlands Soil | LRSELQATAALVFAQPLPGGVEPGPDESRSYAEWLCWPPGAERDRDA* |
| Ga0116217_101983775 | 3300009700 | Peatlands Soil | VFAQALPGGVEPGPDESRSYAEWLGQWPGGKNDA* |
| Ga0116217_105166162 | 3300009700 | Peatlands Soil | RSALQATAALVFAHALRGGVQPGTDESRSYAEWLSRRPGAESDA* |
| Ga0116134_11155141 | 3300009764 | Peatland | ELQAAVALVFAHVLPGGVEPGPDQARSYGQWLGQLPGVGSDAGA* |
| Ga0116219_102547381 | 3300009824 | Peatlands Soil | ALIFAHALPGDVEPGPDESRSYAEWLCLRPGADSDADA* |
| Ga0116219_105061723 | 3300009824 | Peatlands Soil | IFAHALPGDVEPGPDESRSYAEWLCLRPGADSDADA* |
| Ga0116223_107257862 | 3300009839 | Peatlands Soil | QATAALVFAHPLPGGVEPGPDNSTSYAQWLGQRPGTDSDAGT* |
| Ga0126380_105070011 | 3300010043 | Tropical Forest Soil | TLVCAQALPGSAHPGPDGSSSYAQWLSLRPGAGHDADV* |
| Ga0074044_101693233 | 3300010343 | Bog Forest Soil | SFSGPTPKAALVFPQALPGGMEPGMDHSRSYAEWLCRRPGAETDVGA* |
| Ga0074044_110079332 | 3300010343 | Bog Forest Soil | ATAALVFAHALPGRMEFGPDKARSYAEWLGQRPGAGSDAGA* |
| Ga0126379_107346412 | 3300010366 | Tropical Forest Soil | ALVFAQALPGGLTLGMDDSKSYAQWLRRWPATAPSGWP* |
| Ga0134125_129641971 | 3300010371 | Terrestrial Soil | TAALVFAQALPGGVEPGPDESRSYAKWLSRRPGAETDADAR* |
| Ga0134128_110018541 | 3300010373 | Terrestrial Soil | SELQATAALVFAHALPGGVEPGLDQSRSYAEWLSPQPGAESHA* |
| Ga0136449_1003583045 | 3300010379 | Peatlands Soil | RSALQATAALIFAHALPGDVEPGPDESRSYAEWLCLRPGADSDADA* |
| Ga0136449_1015799631 | 3300010379 | Peatlands Soil | VFAQPLPAGVEPGPDHSRSYAEWLGQPPGAETDTHT* |
| Ga0136449_1030390032 | 3300010379 | Peatlands Soil | RSALQATAALVFAQALPGGVEPGPDESRSYAEWLAQWTGGKNDA* |
| Ga0136449_1030695961 | 3300010379 | Peatlands Soil | AALVFAQAMPGGMEPGTDEARSYAEWLGQRPGADSDAVE* |
| Ga0136449_1042171222 | 3300010379 | Peatlands Soil | ALVFAQAPPGGVEPGPDDSRSYAQWLCWPPGAESGR* |
| Ga0134122_111304191 | 3300010400 | Terrestrial Soil | QATAALVFAQALPGGMEPGPDDSRSYAQWLGWPPGAESGR* |
| Ga0126347_12583362 | 3300010867 | Boreal Forest Soil | LRSELQATATLVFAQALPGGAQPGPEQSSSYAQWLSQQPGAGGEADA* |
| Ga0137382_110962491 | 3300012200 | Vadose Zone Soil | QAAATLAFAQALPRGVQPGPDESSSYAQWLSLRPGAGSDADA* |
| Ga0137376_112257892 | 3300012208 | Vadose Zone Soil | ELQAAATLAFAQALPRGVQPGPDESSSYAQWLSLRPGAGSDADA* |
| Ga0137387_111605671 | 3300012349 | Vadose Zone Soil | HVFAQALPGAVQPGPDDSRSYAQWLGRPPGPESDAGA* |
| Ga0137367_106567243 | 3300012353 | Vadose Zone Soil | LRSELEATAALVFAHALPGGMKPGPDESSSYAEWLCQRSGAGSDSGA* |
| Ga0137369_100765491 | 3300012355 | Vadose Zone Soil | TAALVFAETLPGGVEPGTDDSRSYAEWLCQWPAAGSDAGA* |
| Ga0137390_107420431 | 3300012363 | Vadose Zone Soil | EATASLVFAEPLPRGVKPSTDDSRSYAEWLGQWPNADGDTSP* |
| Ga0164298_109644271 | 3300012955 | Soil | RSELEATAAVVFARALPGETEPGPNESRSYAELLGQRPGRENDVDA* |
| Ga0126369_130721751 | 3300012971 | Tropical Forest Soil | QATATLVFAQALPGSAQPGPDGSSSYAQWLSLRPGAGHDADA* |
| Ga0181530_104357492 | 3300014159 | Bog | VFAQALPGGVEPGPDESMSYAQWLGQRPGTDTDAGA* |
| Ga0181523_101590331 | 3300014165 | Bog | LEATAALVFAQALPGGVEPGPDESMSYAQWLGQRPGTDTDAGA* |
| Ga0182030_117004931 | 3300014838 | Bog | TAALVFAQALPGGVEPGTDDSRSYAQWLCQRPGADSDAGA* |
| Ga0132258_116670823 | 3300015371 | Arabidopsis Rhizosphere | ATAALVFAQALPGGVKPGPGESRSYAQWLGQRPDAKSDASA* |
| Ga0182041_105895141 | 3300016294 | Soil | MLRSELQATAALVFAHALPGGVAPGPDQSTSYADWLSPRPGAESHA |
| Ga0187812_10197941 | 3300017821 | Freshwater Sediment | TAALVFAQALPGGMEPGPDESRSYAEWLGRLGADSDADA |
| Ga0187802_101824152 | 3300017822 | Freshwater Sediment | LVFAHPLPGGVEPGPDDSRSYAQWLGQCPGAGNDAGT |
| Ga0187802_103578002 | 3300017822 | Freshwater Sediment | AAAALVFAQALPGGVEPGPEDSRSYAQWLGRSPGARSGR |
| Ga0187820_10101151 | 3300017924 | Freshwater Sediment | LLRSELHATAALVFAQALPGSVEPGPDESRSYAEWLCQRPGAESNA |
| Ga0187807_10723165 | 3300017926 | Freshwater Sediment | LRSTLQATAALVFAHPLPGGVEPGPDDSRSHAQWLGRRPGADSDAGA |
| Ga0187807_12260972 | 3300017926 | Freshwater Sediment | LEATAALVFTEALPAGMEPGPDDSRSYAQWLGQRPGADNDAGA |
| Ga0187807_13229891 | 3300017926 | Freshwater Sediment | ADLLRSELETTAALVFAQALPGGMEPGPDESRSYAEWLGRLGADSDADA |
| Ga0187814_101923582 | 3300017932 | Freshwater Sediment | LLRSTLQATAALVFAHPLPGGMEPGPDDSRSYAKWLGQRPGAGSDAGT |
| Ga0187814_103167832 | 3300017932 | Freshwater Sediment | ATGPVGLLRSALAAAAALVFAQALPGGMQPGPDESRSYPQWLGRPPGAGSGR |
| Ga0187803_100217131 | 3300017934 | Freshwater Sediment | AGLLRSTLAAAAALVFTQALPGGMQPGPDESRSYAQWLARPPGAGSGR |
| Ga0187808_105558702 | 3300017942 | Freshwater Sediment | GLLHSALQAAAALVFAQALPGGVEPGPEDSSSYAQWLGRAPGARSGR |
| Ga0187819_103985071 | 3300017943 | Freshwater Sediment | AALVFAQALPGGMEPGPDESRSYAEWLGLRPGADSDGRDITRLV |
| Ga0187817_100838301 | 3300017955 | Freshwater Sediment | TGPAHLLRSTLQATAALVFAHPLPGGMEPGPDDSRSYAKWLGQRPGAGSDAGT |
| Ga0187822_103921861 | 3300017994 | Freshwater Sediment | RSELQATVALVFAQALPGGVEPGMGDSRSYAQWLRQQADAKSDAGA |
| Ga0187816_102839872 | 3300017995 | Freshwater Sediment | LEATAALVFAHALPGHMEFGPDEARSYAEWLGQRPGAGNNAGA |
| Ga0187804_102809151 | 3300018006 | Freshwater Sediment | LLHSELQATAALVFAQPLPAGVEPGPDHSRSYAEWLGRPPGPEK |
| Ga0187880_10411162 | 3300018016 | Peatland | GQLEATAALVFAQALPGGVEPGTDDSRSFAEWLCQQPGTGSDAGA |
| Ga0187857_104554691 | 3300018026 | Peatland | LEATAALVFTHALPGGLRPGPQESRSYAEWLAQRTGHGNRA |
| Ga0210393_101605201 | 3300021401 | Soil | LQATAALVFAQALPGGVEPSPDESRSYADWLGQSPGADSDADT |
| Ga0210385_110361242 | 3300021402 | Soil | ELQATAALVFAQALPGGVEPSPDESRSYADWLGQSPGADSDA |
| Ga0210386_100372551 | 3300021406 | Soil | LVFAQALPGCVAPGPDESRSYAQWLGQRPGGGSDAGA |
| Ga0210386_100892991 | 3300021406 | Soil | EREAAAALVFAEALPGGVEPGPDESRSYAEWLGQRPGADSDAGA |
| Ga0126371_122940433 | 3300021560 | Tropical Forest Soil | FAHALPGGVEPGPDQSRSYAEWLSPAAGSPVTRYR |
| Ga0208189_10897861 | 3300025444 | Peatland | LVFAQALPGGVEPGTDDSRSFAEWLCQQPGTGSDAGA |
| Ga0208076_10144341 | 3300025464 | Arctic Peat Soil | DLLRSELEAAAALVFAEALPGGMEPGPDESRSYADWLYQRPGGKNDV |
| Ga0208688_10229482 | 3300025480 | Peatland | LRGQLEATAALVFAQALPGGVEPGTDDSRSFAEWLCQQPGTGSDAGA |
| Ga0208220_10809091 | 3300025627 | Arctic Peat Soil | LRSELQATATLVFAQALPSAAQPGPDESSSYAQWLRLGADSNANA |
| Ga0207663_110789292 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AALVYAQALPAGVQPGPDQSRSYAQWLSQRPGADSDASA |
| Ga0207664_107576611 | 3300025929 | Agricultural Soil | VFAQALPAGVQPGPDQSRSYAQWLSQRPGADSDASA |
| Ga0209839_101380822 | 3300026294 | Soil | APHLLRSELQATAALVFAQALPGGAQPGTDESRSFAEWLCRQPGAGRVADA |
| Ga0209448_102531401 | 3300027783 | Bog Forest Soil | EAAAALVFAQALPGGVEPGPDESRSYAEWLCRSPGADSNADT |
| Ga0209415_100260141 | 3300027905 | Peatlands Soil | TAALVFAQPLPAGVEPGPDHSRSYAEWLGRPPGAESDADT |
| Ga0209698_111114741 | 3300027911 | Watersheds | PRSALVFAQALPGGVEPGPDDSRSYAQWLCWPPGAESGR |
| Ga0302169_101837041 | 3300028679 | Fen | HSELQATAALVFAQALPGGVPPGPDNSRSYAQWLGQRPGASSDAGT |
| Ga0302157_100698723 | 3300028813 | Bog | LRSELHATAALVFAQALPGGVEPGMDDSGSYAEWLSRRPGSGSNDGV |
| Ga0302235_101578501 | 3300028877 | Palsa | VFGQALPGGVEPGPDDSRSYAQWLCQRPGADSDAGA |
| Ga0310038_101644234 | 3300030707 | Peatlands Soil | LQATAALIFAHALPGDVEPGPDESRSYAEWLCLRPGADSDADA |
| Ga0310038_101675131 | 3300030707 | Peatlands Soil | EATAALVFAQALPGGVEPGPDQSRSYAEWLGQRPGADSDTGA |
| Ga0310038_104578991 | 3300030707 | Peatlands Soil | LQATAALMFAQALPGDVEPGPDESRSYAEWLCLRPGADSDADA |
| Ga0307497_105598451 | 3300031226 | Soil | AAHVFAQALPGATEPGPDDSRSYAEWLCRPPGAESDADT |
| Ga0170824_1131400501 | 3300031231 | Forest Soil | AALMFAQALPGGVEPGPDESRSYAQWLGQRPRAGSDAGA |
| Ga0318571_103375292 | 3300031549 | Soil | DMLRSELQATAALVFAHALPGGVEPGLDQSRSYADWLSPRPGAESHA |
| Ga0318555_103659512 | 3300031640 | Soil | AAAALVFAHALPGGVEPGPDQSRSYAEWLSPRPGHV |
| Ga0318542_104504931 | 3300031668 | Soil | LRSQLQAAAALVFAHALPGGVEPGPDQSRSYAEWLSPRPGHV |
| Ga0318493_103344602 | 3300031723 | Soil | LQATAALVFAHALPGGVEPGLDQSRSYADWLSPRPGAESHA |
| Ga0318498_104222331 | 3300031778 | Soil | AGLPGGALQAAAALVFARALPGGIQYGLDDSRSYAEWLGQQPGTGRDAGT |
| Ga0318568_103543582 | 3300031819 | Soil | LQATAALVFAHALPGGVEPGPDQSRSYAEWLSPRPGHV |
| Ga0306926_104078483 | 3300031954 | Soil | SELQATAALVFAHALPGGVEPGLDQSRSYADWLSPRPGAESHA |
| Ga0306922_122751111 | 3300032001 | Soil | ELQATAALVFAHALPGGVEPGPDQSRSYADWLSPRPGAESHA |
| Ga0318575_100631444 | 3300032055 | Soil | HSELQATAALVFAHALPGGVEPGPDQSRSYADWLSPRPGAESHA |
| Ga0311301_101764253 | 3300032160 | Peatlands Soil | ALVFAQPLPAGVEPGPDHSRSYAEWLGRPPGAESDAGT |
| Ga0311301_102946931 | 3300032160 | Peatlands Soil | LRSALQATAALVFAQALPGDVEPGPGESRSYAEWLCLRPGADSDADA |
| Ga0311301_104341821 | 3300032160 | Peatlands Soil | LRSALQATAALIFAHALPGDVEPGPDESRSYAEWLCLRPGADSDADA |
| Ga0311301_108072621 | 3300032160 | Peatlands Soil | FAQAMPGGMEPGTDEARSYAEWLGQRPGADSDAVE |
| Ga0311301_112256701 | 3300032160 | Peatlands Soil | QICSAALEATAALVFARALPGGVEPGPDESRSYAKWLGQSRGGKNDV |
| Ga0311301_127394762 | 3300032160 | Peatlands Soil | LRSALQATAALVFTQALPGGVEPGPDESRSYTEWLFLQPGADIGA |
| Ga0335085_108898192 | 3300032770 | Soil | GLLRSALAAAAALVFAQALPGGRQPGPDQSRSYAQWLARPPGAGSGR |
| Ga0335085_123696312 | 3300032770 | Soil | SELQATVALVFAQALPGDMKSGPQDSRSYAEWLGQRPGTDS |
| Ga0335082_100547436 | 3300032782 | Soil | LQATAALVFAQPLPAGVQPGPGYSRSYAEWLGRPPGAERDAGT |
| Ga0335079_100515246 | 3300032783 | Soil | AVFARALPGGVEPGPDDSRSYAEWLGQLPGAGSDADAEPHR |
| Ga0335079_104820331 | 3300032783 | Soil | RELQATAALVFAQALPGGVVPGPADSRSYAQWLGQRPGGHSDAEA |
| Ga0335079_105114582 | 3300032783 | Soil | TAALVFAQALPGGVVPGPADSRSYAQWLGQRPGTG |
| Ga0335079_110407422 | 3300032783 | Soil | PELQATAALVFAQALPGGVEPGPDDSRSYAQWLCWPPGAESRR |
| Ga0335079_116782411 | 3300032783 | Soil | AAVFARALPGGAEPGPDDSMSYAEWLSRLPDADAESHW |
| Ga0335078_101845964 | 3300032805 | Soil | ELEAAAALVFARALPGEVVPGPADSRSYAQWLGQRLGAGSVTGA |
| Ga0335078_111689212 | 3300032805 | Soil | RALPGGVEPGPDDSRSYAEWLGQLPGADSDADTEPHR |
| Ga0335080_100304341 | 3300032828 | Soil | AVVFARALPGGVEPGPDDSRSYAEWLGQLPGADSDADAEPHR |
| Ga0335080_102777431 | 3300032828 | Soil | TAALVFAQALPGGVVPGPADSRSYAQWLGQRPGGHSDAEA |
| Ga0335080_103847301 | 3300032828 | Soil | DSLLRSELQAAAALMFARAMPGGVEPDMDDSGSYQQWLRRRPGTGSRS |
| Ga0335081_126457411 | 3300032892 | Soil | VLVFAHAMPGGVEPGPEESRSYAEWLGQRPSAAGDADADADADA |
| Ga0335069_102455545 | 3300032893 | Soil | AAAALVFAQALPGGMQPGPDQSMSYAQWLARPPGAGSGR |
| Ga0335069_122573721 | 3300032893 | Soil | ALLRGVLEAAAAVVFARALPGGVEPGPDDSRSYAEWLGQLPGAGRDADAEPHR |
| Ga0335074_111913252 | 3300032895 | Soil | AAAAAIVFAQALPGRMQPGPDQSRSYAQWLGQAPGPGSGR |
| Ga0335072_104178454 | 3300032898 | Soil | STLAAAAAIVFAQALPGRMQPGPDQSRSYAQWLGQAPGADADA |
| Ga0335076_101841674 | 3300032955 | Soil | ATAALVFAQALPGGVEPGPDDSRSYAQWLCWPPGAESRR |
| Ga0335077_106427791 | 3300033158 | Soil | LVFAQALPGGVEPGPDESRSYAEWLGQWPGAGSDAGA |
| Ga0318519_106774501 | 3300033290 | Soil | LPGGALQAAAALVFARALPGGIQYGLDDSRSYAEWLGQQPGTGRDAGT |
| ⦗Top⦘ |