| Basic Information | |
|---|---|
| Family ID | F054821 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 139 |
| Average Sequence Length | 43 residues |
| Representative Sequence | GAPETMPGLAMPGMGAEAPVAAPAGPPGIEQLLAQLGG |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.52 % |
| % of genes near scaffold ends (potentially truncated) | 92.81 % |
| % of genes from short scaffolds (< 2000 bps) | 74.82 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.151 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (25.899 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.446 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (42.446 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.12% β-sheet: 0.00% Coil/Unstructured: 87.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.15 % |
| All Organisms | root | All Organisms | 38.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2022920000|QLn_FQAYR3Y02Q1EYH | Not Available | 508 | Open in IMG/M |
| 3300002408|B570J29032_109656203 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300003393|JGI25909J50240_1037605 | Not Available | 1039 | Open in IMG/M |
| 3300003393|JGI25909J50240_1077491 | Not Available | 668 | Open in IMG/M |
| 3300003404|JGI25920J50251_10077201 | Not Available | 805 | Open in IMG/M |
| 3300005581|Ga0049081_10175446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 776 | Open in IMG/M |
| 3300005805|Ga0079957_1078879 | Not Available | 1869 | Open in IMG/M |
| 3300005943|Ga0073926_10115586 | Not Available | 555 | Open in IMG/M |
| 3300006637|Ga0075461_10050724 | All Organisms → Viruses → Predicted Viral | 1346 | Open in IMG/M |
| 3300006802|Ga0070749_10055684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2397 | Open in IMG/M |
| 3300006802|Ga0070749_10065259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C429 | 2191 | Open in IMG/M |
| 3300006802|Ga0070749_10218386 | Not Available | 1087 | Open in IMG/M |
| 3300006802|Ga0070749_10447134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 708 | Open in IMG/M |
| 3300006802|Ga0070749_10708245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 538 | Open in IMG/M |
| 3300006869|Ga0075477_10328780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 603 | Open in IMG/M |
| 3300006874|Ga0075475_10110616 | Not Available | 1234 | Open in IMG/M |
| 3300006874|Ga0075475_10376527 | Not Available | 574 | Open in IMG/M |
| 3300006916|Ga0070750_10046198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2122 | Open in IMG/M |
| 3300006919|Ga0070746_10392044 | Not Available | 623 | Open in IMG/M |
| 3300007538|Ga0099851_1016714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 2979 | Open in IMG/M |
| 3300007538|Ga0099851_1048045 | Not Available | 1678 | Open in IMG/M |
| 3300007539|Ga0099849_1362886 | Not Available | 513 | Open in IMG/M |
| 3300007540|Ga0099847_1236039 | Not Available | 528 | Open in IMG/M |
| 3300007541|Ga0099848_1014742 | Not Available | 3395 | Open in IMG/M |
| 3300007541|Ga0099848_1208442 | Not Available | 699 | Open in IMG/M |
| 3300007542|Ga0099846_1002775 | Not Available | 7163 | Open in IMG/M |
| 3300007960|Ga0099850_1045792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1877 | Open in IMG/M |
| 3300009039|Ga0105152_10533303 | Not Available | 503 | Open in IMG/M |
| 3300009158|Ga0114977_10321804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 877 | Open in IMG/M |
| 3300009158|Ga0114977_10321805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 877 | Open in IMG/M |
| 3300009165|Ga0105102_10776353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 544 | Open in IMG/M |
| 3300009168|Ga0105104_10776609 | Not Available | 555 | Open in IMG/M |
| 3300009169|Ga0105097_10076652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1817 | Open in IMG/M |
| 3300010293|Ga0116204_1070938 | Not Available | 1252 | Open in IMG/M |
| 3300010318|Ga0136656_1226182 | Not Available | 621 | Open in IMG/M |
| 3300010354|Ga0129333_10239082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1641 | Open in IMG/M |
| 3300010354|Ga0129333_10254973 | Not Available | 1580 | Open in IMG/M |
| 3300010354|Ga0129333_10736822 | Not Available | 845 | Open in IMG/M |
| 3300010370|Ga0129336_10070242 | Not Available | 2074 | Open in IMG/M |
| 3300010370|Ga0129336_10120938 | Not Available | 1526 | Open in IMG/M |
| 3300010370|Ga0129336_10297899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C429 | 897 | Open in IMG/M |
| 3300010370|Ga0129336_10463142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C449 | 686 | Open in IMG/M |
| 3300010389|Ga0136549_10004981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9567 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10039096 | Not Available | 4836 | Open in IMG/M |
| 3300013372|Ga0177922_11266663 | Not Available | 948 | Open in IMG/M |
| 3300016731|Ga0182094_1298982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 546 | Open in IMG/M |
| 3300017701|Ga0181364_1039279 | Not Available | 756 | Open in IMG/M |
| 3300017707|Ga0181363_1003122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 3734 | Open in IMG/M |
| 3300017716|Ga0181350_1064251 | Not Available | 952 | Open in IMG/M |
| 3300017716|Ga0181350_1106012 | Not Available | 686 | Open in IMG/M |
| 3300017723|Ga0181362_1029264 | Not Available | 1175 | Open in IMG/M |
| 3300017736|Ga0181365_1004835 | Not Available | 3308 | Open in IMG/M |
| 3300017736|Ga0181365_1044523 | All Organisms → Viruses → Predicted Viral | 1113 | Open in IMG/M |
| 3300017747|Ga0181352_1035004 | Not Available | 1504 | Open in IMG/M |
| 3300017761|Ga0181356_1085010 | Not Available | 1046 | Open in IMG/M |
| 3300017761|Ga0181356_1108819 | Not Available | 895 | Open in IMG/M |
| 3300017774|Ga0181358_1013485 | Not Available | 3333 | Open in IMG/M |
| 3300017774|Ga0181358_1054977 | Not Available | 1498 | Open in IMG/M |
| 3300017778|Ga0181349_1108443 | Not Available | 1033 | Open in IMG/M |
| 3300017784|Ga0181348_1098383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1144 | Open in IMG/M |
| 3300017785|Ga0181355_1363375 | Not Available | 530 | Open in IMG/M |
| 3300017967|Ga0181590_10088633 | All Organisms → Viruses → Predicted Viral | 2429 | Open in IMG/M |
| 3300018039|Ga0181579_10154641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1382 | Open in IMG/M |
| 3300018424|Ga0181591_10128175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2051 | Open in IMG/M |
| 3300019784|Ga0181359_1001212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6724 | Open in IMG/M |
| 3300019784|Ga0181359_1021651 | Not Available | 2438 | Open in IMG/M |
| 3300019784|Ga0181359_1179443 | Not Available | 701 | Open in IMG/M |
| 3300020109|Ga0194112_10807922 | Not Available | 613 | Open in IMG/M |
| 3300020200|Ga0194121_10020041 | Not Available | 6927 | Open in IMG/M |
| 3300020205|Ga0211731_11390999 | Not Available | 2144 | Open in IMG/M |
| 3300020221|Ga0194127_10287967 | Not Available | 1115 | Open in IMG/M |
| 3300020603|Ga0194126_10256869 | Not Available | 1198 | Open in IMG/M |
| 3300021958|Ga0222718_10543402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 554 | Open in IMG/M |
| 3300021961|Ga0222714_10041407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 3293 | Open in IMG/M |
| 3300021962|Ga0222713_10017971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 6027 | Open in IMG/M |
| 3300021963|Ga0222712_10275721 | Not Available | 1065 | Open in IMG/M |
| 3300022063|Ga0212029_1008027 | Not Available | 1244 | Open in IMG/M |
| 3300022168|Ga0212027_1031461 | Not Available | 702 | Open in IMG/M |
| 3300022176|Ga0212031_1010610 | Not Available | 1300 | Open in IMG/M |
| 3300022179|Ga0181353_1075324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
| 3300022190|Ga0181354_1052197 | Not Available | 1361 | Open in IMG/M |
| 3300022190|Ga0181354_1067264 | Not Available | 1189 | Open in IMG/M |
| 3300022198|Ga0196905_1083324 | Not Available | 868 | Open in IMG/M |
| 3300022198|Ga0196905_1109360 | Not Available | 732 | Open in IMG/M |
| 3300022407|Ga0181351_1097325 | Not Available | 1143 | Open in IMG/M |
| 3300022914|Ga0255767_1285896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 614 | Open in IMG/M |
| 3300023087|Ga0255774_10505418 | Not Available | 514 | Open in IMG/M |
| 3300023179|Ga0214923_10073473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2443 | Open in IMG/M |
| 3300024499|Ga0255195_1039714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 696 | Open in IMG/M |
| 3300025610|Ga0208149_1070216 | Not Available | 875 | Open in IMG/M |
| 3300025630|Ga0208004_1025994 | All Organisms → Viruses → Predicted Viral | 1763 | Open in IMG/M |
| 3300025646|Ga0208161_1164497 | Not Available | 540 | Open in IMG/M |
| 3300025646|Ga0208161_1166334 | Not Available | 535 | Open in IMG/M |
| 3300025647|Ga0208160_1033501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C429 | 1543 | Open in IMG/M |
| 3300025647|Ga0208160_1044908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 1279 | Open in IMG/M |
| 3300025655|Ga0208795_1059205 | Not Available | 1110 | Open in IMG/M |
| 3300025655|Ga0208795_1084975 | Not Available | 871 | Open in IMG/M |
| 3300025671|Ga0208898_1050931 | Not Available | 1504 | Open in IMG/M |
| 3300025840|Ga0208917_1057244 | All Organisms → Viruses → Predicted Viral | 1524 | Open in IMG/M |
| 3300025872|Ga0208783_10180078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
| 3300027131|Ga0255066_1002232 | Not Available | 3381 | Open in IMG/M |
| 3300027418|Ga0208022_1001274 | Not Available | 7364 | Open in IMG/M |
| 3300027600|Ga0255117_1109266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C449 | 512 | Open in IMG/M |
| 3300027697|Ga0209033_1014161 | All Organisms → Viruses → Predicted Viral | 3427 | Open in IMG/M |
| 3300027707|Ga0209443_1258177 | Not Available | 592 | Open in IMG/M |
| 3300027733|Ga0209297_1276943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 634 | Open in IMG/M |
| 3300027734|Ga0209087_1011487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 4518 | Open in IMG/M |
| 3300027734|Ga0209087_1243366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 667 | Open in IMG/M |
| 3300027785|Ga0209246_10397312 | Not Available | 518 | Open in IMG/M |
| 3300027798|Ga0209353_10003306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8544 | Open in IMG/M |
| 3300027798|Ga0209353_10310217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300027808|Ga0209354_10012849 | Not Available | 3345 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10524069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 558 | Open in IMG/M |
| 3300031565|Ga0307379_11445051 | Not Available | 552 | Open in IMG/M |
| 3300031707|Ga0315291_11271689 | Not Available | 596 | Open in IMG/M |
| 3300031746|Ga0315293_10719917 | Not Available | 740 | Open in IMG/M |
| 3300031758|Ga0315907_10803381 | Not Available | 702 | Open in IMG/M |
| 3300031772|Ga0315288_11095212 | Not Available | 698 | Open in IMG/M |
| 3300031857|Ga0315909_10261756 | All Organisms → Viruses → Predicted Viral | 1319 | Open in IMG/M |
| 3300032173|Ga0315268_12335082 | Not Available | 549 | Open in IMG/M |
| 3300032516|Ga0315273_11192341 | Not Available | 960 | Open in IMG/M |
| 3300033233|Ga0334722_10209152 | Not Available | 1444 | Open in IMG/M |
| 3300033233|Ga0334722_10232075 | Not Available | 1359 | Open in IMG/M |
| 3300033981|Ga0334982_0088746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 1645 | Open in IMG/M |
| 3300033993|Ga0334994_0384481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C449 | 683 | Open in IMG/M |
| 3300034012|Ga0334986_0033338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 3386 | Open in IMG/M |
| 3300034012|Ga0334986_0153633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1326 | Open in IMG/M |
| 3300034019|Ga0334998_0655927 | Not Available | 565 | Open in IMG/M |
| 3300034023|Ga0335021_0663320 | Not Available | 511 | Open in IMG/M |
| 3300034095|Ga0335022_0203666 | Not Available | 1184 | Open in IMG/M |
| 3300034101|Ga0335027_0729498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C429 | 584 | Open in IMG/M |
| 3300034121|Ga0335058_0120256 | All Organisms → Viruses → Predicted Viral | 1537 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 25.90% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 25.18% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.91% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.76% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.76% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.32% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.60% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.88% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.88% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.16% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.16% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.44% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.72% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.72% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.72% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.72% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.72% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.72% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.72% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.72% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2022920000 | Saline water microbial communities from Qinghai Lake, Tibetan Plateau - High mountain lake (unassembled) | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300016731 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022914 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG | Environmental | Open in IMG/M |
| 3300023087 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024499 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
| 3300027486 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| QL_na_929930 | 2022920000 | Saline Water | ERQAAAMPQGSPETMPGLAMAGMGAEAPMQAPAGPPNIEALLAQLGG |
| B570J29032_1096562033 | 3300002408 | Freshwater | GAPETMPGLGMPGMGMEQPAGPPAQAGPPPIGDLLAQLGG* |
| JGI25909J50240_10376051 | 3300003393 | Freshwater Lake | MPQGAPETMPGLAMPGMGAEAPVQGPQGAPPLEALLAQLGA* |
| JGI25909J50240_10774911 | 3300003393 | Freshwater Lake | QAAQAPAGAPETMPGLAMPGMGAQQPAEAPAGPPGIEGLLAQLGGR* |
| JGI25920J50251_100772013 | 3300003404 | Freshwater Lake | KRTDQRARDRQAAAMPQGAPETMPGLAMPGMGAEAPVQGPQGAPPLEALLAQLGA* |
| Ga0049081_101754463 | 3300005581 | Freshwater Lentic | EAMPGLAMPGMGAEAPMQPPPGPQGLDALLAQLGG* |
| Ga0079957_10788791 | 3300005805 | Lake | SPETMPGLALPGMGAEAPVAAPAGPPPLEELLAQLGG* |
| Ga0073926_101155861 | 3300005943 | Sand | EVDAAAKERQAAEAPQGAPETMPGLAPPGMGAEQPVAPPEGAQGQPDIQSLLAQLGG* |
| Ga0075461_100507243 | 3300006637 | Aqueous | MAPETMPGLAMPGMGAEQPMAAPPAGGGGIEALLAQLGG* |
| Ga0070749_100556841 | 3300006802 | Aqueous | DRQAQAMPAGAPETMPGLALPGMGAEAPVAGPAGPPPIEALLAQLGA* |
| Ga0070749_100652593 | 3300006802 | Aqueous | PGLAMPGMGAESPMAPPPGPPGGGGIEALLAQLGG* |
| Ga0070749_102183863 | 3300006802 | Aqueous | GLAMPGMGAESPMMAPEGPAGPPPLEALLAQLGG* |
| Ga0070749_104471341 | 3300006802 | Aqueous | PEAMPGLAMPGMGAEAPMQSPPGPQGLDALLAQLGG* |
| Ga0070749_107082452 | 3300006802 | Aqueous | RQAQAMPAGAPETMPGLALPGMGAEAPVAGPAGPPPIEALLAQLGA* |
| Ga0075477_103287802 | 3300006869 | Aqueous | QEMPEGSPETMPGLAMPGMGAEAPMAGPPGGGIEALLAQLGG* |
| Ga0075475_101106163 | 3300006874 | Aqueous | ETMPGLAMPGMGAEAPMAAPAGPPGIEQLLAQLGG* |
| Ga0075475_103765271 | 3300006874 | Aqueous | APETMPGLAMPGLGAEAPIAGPQGAPPLEALLAQLGA* |
| Ga0070750_100461983 | 3300006916 | Aqueous | QSQEMPAGAPETMPGLAMPGMGAEAPMAPPAGPPGIEQLLAQLGG* |
| Ga0070746_103920441 | 3300006919 | Aqueous | RERQAEEMPQGAPETMPGLAMPGMGAEAPVAAPAGPPGIEQLLAQLGG* |
| Ga0099851_10167143 | 3300007538 | Aqueous | PAGAPETMPGLALPGMGAEAPVAGPAGPPPIEALLAQLGA* |
| Ga0099851_10480451 | 3300007538 | Aqueous | QERQAMAMPEGAPETMPGLALPGMGAEAPTQGPAGAPPLEALLAQLGA* |
| Ga0099849_13628861 | 3300007539 | Aqueous | TMPGLALPGMGAEAPTQGPAGAPPLEALLAQLGA* |
| Ga0099847_12360392 | 3300007540 | Aqueous | APETMPGLAMPGMGAEAPAAGPPGGGGIEALLAQLGG* |
| Ga0099848_10147421 | 3300007541 | Aqueous | AQAMPVGAPETMPGLALPGMGAEAPVAGPAGPPPIEALLAQLGA* |
| Ga0099848_12084421 | 3300007541 | Aqueous | TMPGLALPGMGAEAPVAGPAGPPPIEALLAQLGA* |
| Ga0099846_10027751 | 3300007542 | Aqueous | ETMPGLAMPGMGAEAPVAAPAGPPGIEQLLAQLGG* |
| Ga0099850_10457921 | 3300007960 | Aqueous | RAQDRQAQAMPAGAPETMPGLALPGMGAEAPVAGPAGPPPIEALLAQLGA* |
| Ga0105152_105333031 | 3300009039 | Lake Sediment | AMPQGAPETMPGLAAPGMGAEAPVQGPQGAPPLEALLAQLGA* |
| Ga0114977_103218043 | 3300009158 | Freshwater Lake | QRARDRQAMAMPAGAPETMPGLAGPGMGAQAPVAPPPGAPGGGGMEALLARLGG* |
| Ga0114977_103218053 | 3300009158 | Freshwater Lake | QRARDRQAMAMPAGAPETMPGLAGPGMGAQAPVAPPPGAPGGGGMEALLAQLGG* |
| Ga0105102_107763532 | 3300009165 | Freshwater Sediment | MPAGAPETMPGLAMPGMGAEMMGGPPPQAGPPPIDQLLSQLGG* |
| Ga0105104_107766092 | 3300009168 | Freshwater Sediment | GAPETMPGLGMPGMGMEQPVGPPAGPPDIGQLLAQLGG* |
| Ga0105097_100766521 | 3300009169 | Freshwater Sediment | AQAPQGAPETMPGLAMPGMGGQMQAGPPPQAGPPPIDQLLAQLGG* |
| Ga0116204_10709381 | 3300010293 | Anoxic Lake Water | MGSPETMPGLAMASMGAQAPVAGPQGPPPLEALLAQLGA* |
| Ga0136656_12261823 | 3300010318 | Freshwater To Marine Saline Gradient | ETMPGLAMPGMGAEAPVAPPAGPPGIEQLLAQLGG* |
| Ga0129333_102390823 | 3300010354 | Freshwater To Marine Saline Gradient | TQQRAQDRQAQAMPAGAPETMPGLALPGMGAEAPIAGPAGPPPIEALLAQLGA* |
| Ga0129333_102549731 | 3300010354 | Freshwater To Marine Saline Gradient | ERQAMAMPEGAPETMPGLALPGMGAEAPIAGPAGAPPIEALLAQLGA* |
| Ga0129333_107368221 | 3300010354 | Freshwater To Marine Saline Gradient | TMPGLALPGMGAEAPVEGPAGAPPIEALLAQLGA* |
| Ga0129336_100702423 | 3300010370 | Freshwater To Marine Saline Gradient | MPEGAPETMPGLALPGMGAEAPIAGPAGAPPIEALLAQLGA* |
| Ga0129336_101209383 | 3300010370 | Freshwater To Marine Saline Gradient | MPGLAMPGMGAEAPMAPPAGPQGGPEGLAALLAQLGG* |
| Ga0129336_102978991 | 3300010370 | Freshwater To Marine Saline Gradient | AQAMPEGAPETMPGLAIPGMGAEAPVQAPAGPPQLDQLLAQLGG* |
| Ga0129336_104631421 | 3300010370 | Freshwater To Marine Saline Gradient | AMAPQGAPETMPGLAMPGMGAEMQAAAPTPAGPPPIGDLLAQLGG* |
| Ga0136549_100049811 | 3300010389 | Marine Methane Seep Sediment | EEMPQGAPETMPGLAMPGMGAEAPVAAPAGPPGIEQLLAQLGG* |
| (restricted) Ga0172372_100390964 | 3300013132 | Freshwater | AQGAPEAMPGLAMPGMGMEAPVEQPAPGPMNLDALLAQLGA* |
| Ga0177922_112666631 | 3300013372 | Freshwater | PETMPGLAMPGMGAQQPAAPPAGPAGIEGLLAQLGGG* |
| Ga0182094_12989822 | 3300016731 | Salt Marsh | APETMPGLAMPGMGAEQPMAGPPPGGGGLDDLLAQLGA |
| Ga0181364_10301951 | 3300017701 | Freshwater Lake | LVVEQDVSLFGAVKRTDQRARDRQAQAMPQGAPETMPGLANPGMGAEAPVQGPAGAPPLEALLAQLGG |
| Ga0181364_10392793 | 3300017701 | Freshwater Lake | QRARDRQAAAMPQGAPETMPGLAMPGMGAEAPVQGPQGAPPLEALLAQLGA |
| Ga0181363_10031221 | 3300017707 | Freshwater Lake | AGSPETMPGLALPGMGAEAPVAGPAGPPPLEELLAQLGG |
| Ga0181350_10642511 | 3300017716 | Freshwater Lake | ARDRQAAAMPQGAPETMPGLANPGMGAESPVQGPQGAPPLEALLAQLGG |
| Ga0181350_11060121 | 3300017716 | Freshwater Lake | DRQAAAMPQGAPETMPGLAMPGMGAEAPVQGPQGAPPLEALLAQLGA |
| Ga0181362_10292644 | 3300017723 | Freshwater Lake | MPQGAPETMPGLAMPGMGAEAPVQGPQGAPPLEALLAQLGG |
| Ga0181365_10048351 | 3300017736 | Freshwater Lake | TMPGLAMPGMGAQQPAEAPAGPPGIEGLLAQLGGR |
| Ga0181365_10445231 | 3300017736 | Freshwater Lake | AMPGLAPAGMGAESPMAPPQGPAGPGGLEGLLAQLGG |
| Ga0181352_10350043 | 3300017747 | Freshwater Lake | AGSPETMPGLALPGMGAEAPVAAPAGPPPLEELLAQLGG |
| Ga0181356_10850103 | 3300017761 | Freshwater Lake | RAKDRQAAQAPAGAPETMPGLAMPGMGAQQPAAPQAGPAGIEGLLAQLGGG |
| Ga0181356_11088191 | 3300017761 | Freshwater Lake | DQRARDRQAAAMPQGAPETMPGLAMPGMGAEAPVEGPQGAPPLEALLAQLGA |
| Ga0181343_11033413 | 3300017766 | Freshwater Lake | QDVPLFEAVRRTDQRAKDRQATPAPAGAPETMPGLCMPGMGNEMQAGPPPQAGPPPIDQLLAQLGG |
| Ga0181358_10134851 | 3300017774 | Freshwater Lake | APETMPGLAMPGMGAEAPVQGPQGAPPLEALLAQLGA |
| Ga0181358_10549771 | 3300017774 | Freshwater Lake | QAAQAPAGAPETMPGLAMPGMGAQQPAEAPAGPPGIEGLLAQLGGR |
| Ga0181349_11084431 | 3300017778 | Freshwater Lake | AMPQGAPETMPGLAMPGMGAEAPVQGPQGAPPLEALLAQLGA |
| Ga0181348_10983831 | 3300017784 | Freshwater Lake | RTDQRARDRQAAAMPQGAPETMPGLAMPGMGAEAPVEGPQGAPPLEALLAQLGA |
| Ga0181348_13264931 | 3300017784 | Freshwater Lake | VKRTDQRAKDRQAAQAPAGAPETMPGLAMPGMGQQQPAEAPAGPPGIEGLLAQLGGR |
| Ga0181348_13318691 | 3300017784 | Freshwater Lake | DQRAKDRQAAQAPAGAPETMPGLAMPGMGAQQPAEAPAGPAGIEGLLAQLGGR |
| Ga0181355_13633752 | 3300017785 | Freshwater Lake | AKDRQAAQAPAGAPETMPGLAMPGMGQEQPAEAPAGPAGIEGLLAQLGGR |
| Ga0181590_100886331 | 3300017967 | Salt Marsh | QSQEMPAGAPETMPGLAMPGMGAEAPMAPPAGPPGIEQLLAQLGG |
| Ga0181579_101546413 | 3300018039 | Salt Marsh | QEMPAGAPETMPGLAMPGMGAEAPMAPPAGPPGIEQLLAQLGG |
| Ga0181591_101281751 | 3300018424 | Salt Marsh | QEMPAGAPETMPGLAMPGMGAEAPMAAPAGPPGIEQLLAQLGG |
| Ga0181359_10012125 | 3300019784 | Freshwater Lake | QGAPETMPGLAMPGMGAEAPIEGPQGAPPLEALLAQLGA |
| Ga0181359_10216511 | 3300019784 | Freshwater Lake | EKRTDQRARDRQAAAMPQGAPETMPGLAMPGMGAEAPVEGPQGAPPLEALLAQLGA |
| Ga0181359_11794431 | 3300019784 | Freshwater Lake | QAPAGAPETMPGLAMPGMGAQQPAAPPAGPAGIEGLLAQLGGG |
| Ga0194112_108079223 | 3300020109 | Freshwater Lake | MAMPMGAPETMPGLAMPGMGAEAPVQGPGGEPSLEQLLAQIGG |
| Ga0194121_100200411 | 3300020200 | Freshwater Lake | AMPMGSPETMPGLAMAGMGAEAPVAGPQGAPPLEALLAQLGA |
| Ga0211731_113909991 | 3300020205 | Freshwater | QAAQAPAGAPETMPGLAMPGMGAQQPAEAPAGPQGMEGLLAQLGGR |
| Ga0194127_102879673 | 3300020221 | Freshwater Lake | LAMPMGAPETMPGLAMPGMGAEAPVQGPGGEPSLEQLLAQIGG |
| Ga0194126_102568691 | 3300020603 | Freshwater Lake | ETMPGLAMPGMGAEAPVQGPGGEPSLEQLLAQIGG |
| Ga0222718_105434022 | 3300021958 | Estuarine Water | ERQAQEMPEGAPETMPGLAMPGMGAEAPMAAPAGPPGIEQLLAQLGG |
| Ga0222714_100414071 | 3300021961 | Estuarine Water | PETMPGLATPGMGAEAPVQGPQGAPPLEALLAQLGA |
| Ga0222713_100179714 | 3300021962 | Estuarine Water | PETMPGLAAPGMGAEAPAQGPQGAPPLEALLAQLGA |
| Ga0222712_102757213 | 3300021963 | Estuarine Water | APETMPGLATPGMGAEAPVAGPQGAPPLEALLAQLGA |
| Ga0212029_10080273 | 3300022063 | Aqueous | GAPETMPGLAMPGMGAEAPMAAPAGPPGIEQLLAQLGG |
| Ga0212027_10314613 | 3300022168 | Aqueous | QEMPQGAPETMPGLAMPGMGAEAPVAPPAGPPGIEQLLAQLGG |
| Ga0212031_10106101 | 3300022176 | Aqueous | ETMPGLAMPGMGAEAPVAAPAGEPSLESLLAQLGG |
| Ga0181353_10694633 | 3300022179 | Freshwater Lake | QDVPLFDAVRRTDQRAKDRQAAVAPQGAPETMPGLGMPGMGMEQPAGPPAQAGPPPIGDLLAQLGG |
| Ga0181353_10753243 | 3300022179 | Freshwater Lake | GAPETMPGLALPGMGAEAPVAGPAGPPPIEALLAQLGA |
| Ga0181354_10521973 | 3300022190 | Freshwater Lake | ATPAPVGAPETMPGLAMPGMGAEQPMGPAEPSVEGLLAQLGGM |
| Ga0181354_10672643 | 3300022190 | Freshwater Lake | AAMPQGAPETMPGLAMPGMGAEAPVQGPQGAPPLEALLAQLGA |
| Ga0196905_10833241 | 3300022198 | Aqueous | MPMGAPETMPGLATPGMGAEAPVSGPGGQPSLEQLLAQIGG |
| Ga0196905_11093601 | 3300022198 | Aqueous | GAPETMPGLAMPGMGAEAPVAAPAGPPGIEQLLAQLGG |
| Ga0181351_10973253 | 3300022407 | Freshwater Lake | AQAPAGAPETMPGLAMPGMGQEQPAAPPAGPAGIEGLLAQLGGR |
| Ga0255767_12858962 | 3300022914 | Salt Marsh | QAQEMPAGAPETMPGLAMPGMGAEAPMAPPAGPPGIEQLLAQLGG |
| Ga0255774_105054182 | 3300023087 | Salt Marsh | EGMPGLAMPGMGAEAPMAPPGGGGGIEALLAQLGG |
| Ga0214923_100734731 | 3300023179 | Freshwater | EKDVTLYDAVKRTDQRARDRQAAAMPQGAPETMPGLATPGMGAEAPVAGPAGAPPLEALLAQLGA |
| Ga0255195_10397141 | 3300024499 | Freshwater | SPEAMPGLAMPGMGAEAPMQPPPGPQGLDALLAQLGG |
| Ga0208149_10702163 | 3300025610 | Aqueous | MPGLAMPGMGAEQPMAAPPPSGGGGIEALLAQLGG |
| Ga0208004_10259943 | 3300025630 | Aqueous | PETMPGLAMPGMGAEAPVAAPAGEPSLESLLAQLGG |
| Ga0208161_11644971 | 3300025646 | Aqueous | AQAMPVGAPETMPGLALPGMGAEAPVAGPAGPPPIEALLAQLGA |
| Ga0208161_11663341 | 3300025646 | Aqueous | MMPMGAPETMPGLAMPGMGAEAPVQAGGAPPLEALLSQLGG |
| Ga0208160_10335011 | 3300025647 | Aqueous | QGSPETMPGLAMPGMGAEAPMAGPPGGGGIEALLAQLGG |
| Ga0208160_10449081 | 3300025647 | Aqueous | AMPVGAPETMPGLALPGMGAEAPVAGPAGPPPIEALLAQLGA |
| Ga0208795_10592051 | 3300025655 | Aqueous | ETMPGLAIPGMGGEAQVAGPAGPPPIEALLAQLGG |
| Ga0208795_10849751 | 3300025655 | Aqueous | MGAPETMPGLATPGMGAEAPVSGPGGQPSLEQLLAQIGG |
| Ga0208898_10509311 | 3300025671 | Aqueous | MSPEGMPGLAMPGMGAEAPMAPPEAAGPPPLEALLAQLGG |
| Ga0208917_10572443 | 3300025840 | Aqueous | EMPAGAPETMPGLAMPGMGAEAPMAPPAGPPGIEQLLAQLGG |
| Ga0208783_101800781 | 3300025872 | Aqueous | APQGAPETMPGLAMPGMGAEMQAGPPEMAGPPPIQNLLAQLGG |
| Ga0255066_10022321 | 3300027131 | Freshwater | ERQAAEAPQGAPETMPGLAPPGMGAEQPVAPPEGAQGQPDIQSLLAQLGG |
| Ga0208022_10012741 | 3300027418 | Estuarine | MPGLAMPQMGGQQPMGPPPGPQGAPPIDQLLAQLGG |
| Ga0255086_10230753 | 3300027486 | Freshwater | DVPLFDAVRRTDQRAKDRQASVAPQGAPETMPGLGMPGMGMEQPAGPPAQAGPPPIGDLLAQLGG |
| Ga0255117_11092661 | 3300027600 | Freshwater | VAPQGAPETMPGLGMPGMGMEQPAGPPAQAGPPPIGDLLAQLGG |
| Ga0209033_10141611 | 3300027697 | Freshwater Lake | VPAGAPAGMPGLAMPGMGAEAPMAPPAPQGIEGLLAQLGA |
| Ga0209443_12581773 | 3300027707 | Freshwater Lake | ETMPGLAMPGMGAEAPVQGPQGAPPLEALLAQLGA |
| Ga0209297_12769431 | 3300027733 | Freshwater Lake | RARDRQAMAMPAGAPETMPGLAGPGMGAQAPVAPPPGAPGGGGMEALLARLGG |
| Ga0209087_10114871 | 3300027734 | Freshwater Lake | DQRARDRQAMAMPAGAPETMPGLAGPGMGAQAPVAPPPGAPGGGGMEALLARLGG |
| Ga0209087_12433663 | 3300027734 | Freshwater Lake | DQRARDRQAMAMPAGAPETMPGLAGPGMGAQAPVAPPPGAPGGGGMEALLAQLGG |
| Ga0209246_103973121 | 3300027785 | Freshwater Lake | AQAPAGAPETMPGLAMPGMGQQQPAEAPAGPPGIEGLLAQLGGR |
| Ga0209353_100033066 | 3300027798 | Freshwater Lake | PQGAPETMPGLAMPGMGAEAPIEGPQGAPPLEALLAQLGA |
| Ga0209353_103102173 | 3300027798 | Freshwater Lake | TDQRARDRQAQAMPQGAPETMPGLANPGMGAEAPVQGPAGAPPLEALLAQLGGR |
| Ga0209354_100128491 | 3300027808 | Freshwater Lake | QRAKDRQAAQAPAGAPETMPGLAMPGMGAQQPAEAPAGPPGIEGLLAQLGGR |
| (restricted) Ga0233417_105240692 | 3300028043 | Sediment | PVPQGAPEAMPGLAMPGMGAEAPVERQGPPPLDQLLAQLGA |
| Ga0307379_114450512 | 3300031565 | Soil | AEAKERQSAEAPQGAPETMPGLAPPGMGAEQPIAPPEGPQGQPDIQSLLAQLGG |
| Ga0315291_112716891 | 3300031707 | Sediment | QAAAMPQGAPETMPGLAMPGMGAEAPIEGPQGAPPLEALLAQLGA |
| Ga0315293_107199173 | 3300031746 | Sediment | AQAPAGAPETMPGLAMPGMGQQQPAAPPAGPPGIEGLLAQLGGR |
| Ga0315907_108033813 | 3300031758 | Freshwater | TMPGLAMPGMGAEAPVAAPAGGPPPLDQLLAQLGG |
| Ga0315288_110952121 | 3300031772 | Sediment | ETMPGLATPGMGAEAPVQGPQGAPPLEALLAQLGA |
| Ga0315909_102617563 | 3300031857 | Freshwater | QGSPGTMPGLAMPGMGGEMMGGPPPQAGPPPMDQLLAQLGG |
| Ga0315901_103908721 | 3300031963 | Freshwater | VRRTDQRARDRQAQAMPQGAPETMPGLAMPGMGAEAPVQGPAGAPPIEALLAQLGG |
| Ga0315268_123350821 | 3300032173 | Sediment | ETMPGLAMPGMGQQQPAAPPAGPAGIEGLLAQLGGR |
| Ga0315273_111923413 | 3300032516 | Sediment | KRTDQRARDRQAAAMPQGAPETMPGLATPGMGAEAPVQGPQGAPPLEALLAQLGA |
| Ga0334722_102091523 | 3300033233 | Sediment | DRQAAQAPAGAPETMPGLAMPGMGQEQPAAPPAGPPGIEGLLAQLGGR |
| Ga0334722_102320751 | 3300033233 | Sediment | GAPETMPGLATPGMGAEAPVAGPQGAPPLEALLAQLGA |
| Ga0334982_0088746_1527_1643 | 3300033981 | Freshwater | GSPEAMPGLAMPGMGAEAPMQPPPGPQGLDALLAQLGG |
| Ga0334994_0384481_548_682 | 3300033993 | Freshwater | QAPQGSPETMPGLAMPGMGGQMQAGPPPQAGPPPIDQLLAQLGG |
| Ga0334986_0033338_3232_3384 | 3300034012 | Freshwater | KDRQAAQAPQGAPETMPGLAMPGMGNEMMGGPPPQAGPPPIDQLLSQLGG |
| Ga0334986_0153633_1113_1238 | 3300034012 | Freshwater | MPAGAPETMPGLALPGMGAEAPVAGPAGPLPIEALLAQLGA |
| Ga0334998_0655927_3_137 | 3300034019 | Freshwater | AAAMPQGAPETMPGLAMPGMGAEAPVQGPQGAPPLEALLAQLGA |
| Ga0335021_0663320_1_108 | 3300034023 | Freshwater | PEAMPGLAMPGTGAESQVQQPQGGGLESLLAQLGG |
| Ga0335022_0203666_2_148 | 3300034095 | Freshwater | QAAEAPQGTPETMPGLAPPGMGAEQPVAPPEGAQGQPDIQSLLAQLGG |
| Ga0335027_0729498_444_584 | 3300034101 | Freshwater | QAPQGAPETMPGLAMPGMGAEMPAGPPPEAAGPPDLQSLLAQLGGR |
| Ga0335058_0120256_1333_1440 | 3300034121 | Freshwater | MPGLAMPGMGAEMQAGPPPQAGPPPIDQLLAQLGG |
| ⦗Top⦘ |