NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F054802

Metagenome / Metatranscriptome Family F054802

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054802
Family Type Metagenome / Metatranscriptome
Number of Sequences 139
Average Sequence Length 52 residues
Representative Sequence SKNPHASIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS
Number of Associated Samples 99
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 2.16 %
% of genes near scaffold ends (potentially truncated) 90.65 %
% of genes from short scaffolds (< 2000 bps) 92.81 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (87.770 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(33.813 % of family members)
Environment Ontology (ENVO) Unclassified
(49.640 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(41.007 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 63.64%    β-sheet: 0.00%    Coil/Unstructured: 36.36%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF08774VRR_NUC 13.67
PF01844HNH 0.72
PF00145DNA_methylase 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002272|B570J29579_103999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage732Open in IMG/M
3300002408|B570J29032_109851239All Organisms → Viruses → Predicted Viral1654Open in IMG/M
3300002835|B570J40625_101062734All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage687Open in IMG/M
3300003393|JGI25909J50240_1020737All Organisms → cellular organisms → Bacteria1512Open in IMG/M
3300005662|Ga0078894_10904385All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300005662|Ga0078894_11022755All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage710Open in IMG/M
3300005805|Ga0079957_1045741All Organisms → cellular organisms → Bacteria2725Open in IMG/M
3300006030|Ga0075470_10062299All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1137Open in IMG/M
3300006641|Ga0075471_10058877All Organisms → cellular organisms → Bacteria2120Open in IMG/M
3300006802|Ga0070749_10616970All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300006805|Ga0075464_10165756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1303Open in IMG/M
3300006805|Ga0075464_10288314All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300006805|Ga0075464_10650539All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage650Open in IMG/M
3300006920|Ga0070748_1113301All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300006920|Ga0070748_1321441All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300007162|Ga0079300_10152447All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage627Open in IMG/M
3300007541|Ga0099848_1058329All Organisms → Viruses → Predicted Viral1540Open in IMG/M
3300007541|Ga0099848_1160937All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage825Open in IMG/M
3300007542|Ga0099846_1297014All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage554Open in IMG/M
3300007554|Ga0102820_1150047All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300007559|Ga0102828_1141418All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage600Open in IMG/M
3300007692|Ga0102823_1044215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1199Open in IMG/M
3300008111|Ga0114344_1150651All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage795Open in IMG/M
3300008117|Ga0114351_1297166All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage766Open in IMG/M
3300008266|Ga0114363_1069331All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1344Open in IMG/M
3300008450|Ga0114880_1044207All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1916Open in IMG/M
3300008450|Ga0114880_1120377All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage986Open in IMG/M
3300008450|Ga0114880_1258087All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300009081|Ga0105098_10021597All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2467Open in IMG/M
3300009081|Ga0105098_10025412All Organisms → Viruses → Predicted Viral2296Open in IMG/M
3300009085|Ga0105103_10699873All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
3300009149|Ga0114918_10668355All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300009164|Ga0114975_10731362All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300009168|Ga0105104_10257847All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage953Open in IMG/M
3300009168|Ga0105104_10767477All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage558Open in IMG/M
3300009169|Ga0105097_10438486All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage728Open in IMG/M
3300009183|Ga0114974_10124510All Organisms → Viruses → Predicted Viral1635Open in IMG/M
3300009183|Ga0114974_10692181All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage554Open in IMG/M
3300009564|Ga0130019_1030519All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage702Open in IMG/M
3300010368|Ga0129324_10254566All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage699Open in IMG/M
3300010368|Ga0129324_10266818All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage679Open in IMG/M
3300010368|Ga0129324_10273020All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage670Open in IMG/M
3300010370|Ga0129336_10619476All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300012709|Ga0157608_1026731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1361Open in IMG/M
3300012712|Ga0157598_1187378All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage536Open in IMG/M
3300012734|Ga0157615_1033940All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300012759|Ga0157626_1093004All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage604Open in IMG/M
3300013004|Ga0164293_10864250All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300013005|Ga0164292_10373672All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage957Open in IMG/M
3300013005|Ga0164292_10495594All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage801Open in IMG/M
3300013372|Ga0177922_10033952All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage614Open in IMG/M
3300013372|Ga0177922_10637854All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage503Open in IMG/M
3300017785|Ga0181355_1291953All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage614Open in IMG/M
3300019784|Ga0181359_1168276All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage736Open in IMG/M
3300019784|Ga0181359_1260269All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300020151|Ga0211736_10716659All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage879Open in IMG/M
3300020159|Ga0211734_10462698All Organisms → Viruses → Predicted Viral1394Open in IMG/M
3300021962|Ga0222713_10418215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage821Open in IMG/M
3300021963|Ga0222712_10484341All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage735Open in IMG/M
3300022179|Ga0181353_1100018All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage714Open in IMG/M
3300022748|Ga0228702_1082461All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage787Open in IMG/M
3300025543|Ga0208303_1076116All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage753Open in IMG/M
3300025635|Ga0208147_1087261All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage765Open in IMG/M
3300025646|Ga0208161_1168221All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage530Open in IMG/M
3300025655|Ga0208795_1047520All Organisms → Viruses → Predicted Viral1281Open in IMG/M
3300025687|Ga0208019_1124772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage757Open in IMG/M
3300025687|Ga0208019_1195706All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300025872|Ga0208783_10030043All Organisms → cellular organisms → Bacteria2591Open in IMG/M
3300025889|Ga0208644_1132894All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1169Open in IMG/M
3300025896|Ga0208916_10239927All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage787Open in IMG/M
3300027138|Ga0255064_1047260All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage685Open in IMG/M
3300027142|Ga0255065_1054435All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
3300027152|Ga0255100_1034431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1030Open in IMG/M
3300027213|Ga0208555_1053498All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage624Open in IMG/M
3300027492|Ga0255093_1083751All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage594Open in IMG/M
3300027499|Ga0208788_1029033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1646Open in IMG/M
3300027588|Ga0255101_1006155All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2104Open in IMG/M
3300027597|Ga0255088_1013040All Organisms → Viruses → Predicted Viral2070Open in IMG/M
3300027693|Ga0209704_1010729All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2175Open in IMG/M
3300027759|Ga0209296_1161491All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage996Open in IMG/M
3300027798|Ga0209353_10278499All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage713Open in IMG/M
3300027899|Ga0209668_10262152All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1098Open in IMG/M
3300031566|Ga0307378_10427698All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1208Open in IMG/M
3300031566|Ga0307378_10859105All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage756Open in IMG/M
3300031566|Ga0307378_11097099All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage639Open in IMG/M
3300031578|Ga0307376_10423243All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage872Open in IMG/M
3300031578|Ga0307376_10432618All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage860Open in IMG/M
3300031669|Ga0307375_10341844All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage946Open in IMG/M
3300031669|Ga0307375_10355319All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage922Open in IMG/M
3300031669|Ga0307375_10797203All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300031857|Ga0315909_10158838All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1848Open in IMG/M
3300031857|Ga0315909_10603405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage733Open in IMG/M
3300031951|Ga0315904_10221477All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1838Open in IMG/M
3300031951|Ga0315904_10526134All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1036Open in IMG/M
3300031951|Ga0315904_11462490All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300032093|Ga0315902_11092201All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage587Open in IMG/M
3300032401|Ga0315275_10830951All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1022Open in IMG/M
3300033980|Ga0334981_0315280All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage689Open in IMG/M
3300033981|Ga0334982_0076202All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1804Open in IMG/M
3300033981|Ga0334982_0526580All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300033995|Ga0335003_0364096All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage630Open in IMG/M
3300033996|Ga0334979_0176443All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1275Open in IMG/M
3300033996|Ga0334979_0218602All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1115Open in IMG/M
3300033996|Ga0334979_0320081All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage876Open in IMG/M
3300033996|Ga0334979_0725852All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage517Open in IMG/M
3300034012|Ga0334986_0211505All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1077Open in IMG/M
3300034012|Ga0334986_0569329All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300034022|Ga0335005_0427977All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage753Open in IMG/M
3300034061|Ga0334987_0754453All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage549Open in IMG/M
3300034062|Ga0334995_0096645All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2252Open in IMG/M
3300034062|Ga0334995_0170159All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1550Open in IMG/M
3300034062|Ga0334995_0253126All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1184Open in IMG/M
3300034066|Ga0335019_0788546All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage537Open in IMG/M
3300034073|Ga0310130_0046259All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1308Open in IMG/M
3300034073|Ga0310130_0276262All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300034092|Ga0335010_0403404All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage747Open in IMG/M
3300034093|Ga0335012_0135191All Organisms → Viruses → Predicted Viral1353Open in IMG/M
3300034096|Ga0335025_0368382All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage750Open in IMG/M
3300034096|Ga0335025_0596891All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage545Open in IMG/M
3300034101|Ga0335027_0590153All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300034101|Ga0335027_0781739All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage555Open in IMG/M
3300034103|Ga0335030_0606819All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage671Open in IMG/M
3300034106|Ga0335036_0872806All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300034112|Ga0335066_0102410All Organisms → Viruses → Predicted Viral1807Open in IMG/M
3300034118|Ga0335053_0272335All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1076Open in IMG/M
3300034118|Ga0335053_0620987All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage619Open in IMG/M
3300034119|Ga0335054_0737927All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage525Open in IMG/M
3300034121|Ga0335058_0222696All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1101Open in IMG/M
3300034122|Ga0335060_0078543All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2024Open in IMG/M
3300034122|Ga0335060_0183679All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1199Open in IMG/M
3300034122|Ga0335060_0669998All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300034272|Ga0335049_0532135All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage742Open in IMG/M
3300034272|Ga0335049_0763688All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300034279|Ga0335052_0128423All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1510Open in IMG/M
3300034279|Ga0335052_0400017All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage731Open in IMG/M
3300034284|Ga0335013_0862154All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300034356|Ga0335048_0321349All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage795Open in IMG/M
3300034356|Ga0335048_0430814All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage647Open in IMG/M
3300034357|Ga0335064_0111587All Organisms → Viruses → Predicted Viral1654Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater33.81%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous14.39%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake5.76%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil5.76%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment5.04%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater4.32%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater4.32%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.88%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.88%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.88%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.16%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.16%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.44%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.44%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.44%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water1.44%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.72%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.72%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.72%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.72%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.72%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002272Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion nsEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007162Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11EnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009564Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300012709Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012712Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012734Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012759Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022748Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MGEnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027138Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300027142Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300027152Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8dEnvironmentalOpen in IMG/M
3300027213Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027492Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8dEnvironmentalOpen in IMG/M
3300027499Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes)EnvironmentalOpen in IMG/M
3300027588Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8dEnvironmentalOpen in IMG/M
3300027597Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8dEnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034279Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M
3300034357Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J29579_10399933300002272FreshwaterINEIADISTNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS*
B570J29032_10985123943300002408FreshwaterNEIADISTNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS*
B570J40625_10106273413300002835FreshwaterANVSTNPHASIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS*
JGI25909J50240_102073713300003393Freshwater LakeNPHASIIRRLRTMKNSLSLNDPMPLYDVTTLDLAIKALEAHS*
Ga0078894_1090438513300005662Freshwater LakeSKNPHASIIRRLRAMKNDLSLNDPMPLHDVTTLDLAIKALEAHS*
Ga0078894_1102275523300005662Freshwater LakeMTIKHDMAIFDLINQIADTNTNPHASIIRRLRAMQNSLSLEDPMPLHDVTTLDLAIKALQAHS*
Ga0079957_104574163300005805LakeHTMAMFGLIDDIMAVSKNPHASIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS*
Ga0075470_1006229913300006030AqueousQRELISEILNPHASIIRRLRTMRNSLSLEDPTPVADVALLDRVIQILEAHS*
Ga0075471_1005887753300006641AqueousIDDIMAISKNPHASIIRRLRTMKNQLSLNDPMPLYDVTTLDLAIKALEAHS*
Ga0070749_1061697023300006802AqueousLIDDIMAISKNPHASIIRRLRTMKNQLSLNDPMPLYDVTTLDLAIKALEAHS*
Ga0075464_1016575613300006805AqueousRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS*
Ga0075464_1028831413300006805AqueousMNEIMAVNTNPHASIIRRLRTMKNSLSLNDPMPLYDVTTLDLAIKALEAHS*
Ga0075464_1065053913300006805AqueousGLIDDIMNVSKNPHASIIRRLQTMKNHLSLNEPMPLYEVTTLDLAIKALQAHS*
Ga0070748_111330113300006920AqueousIIRRLRTMKNQLSLNDPMPLYDVTTLDQAIKALEAHS*
Ga0070748_132144113300006920AqueousLDQAMQTDHTMALVGLMNEIMAVNTNPHASIIRRLRAMKNSLSLNDPMPLYDVTTLDLAIKALEAHS*
Ga0079300_1015244713300007162Deep SubsurfaceRLRAMKNSLSLEDPMPLHDVTTLDLAIKALQAHS*
Ga0099848_105832953300007541AqueousAIFNLIDEIADTRQNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS*
Ga0099848_116093713300007541AqueousRQNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS*
Ga0099846_129701423300007542AqueousTEMINHNMAIFNLIDEIANTRPNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS*
Ga0102820_115004713300007554EstuarineSIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS*
Ga0102828_114141813300007559EstuarineQAMQTNHTMAMFDLIDDIMAVKKNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS*
Ga0102823_104421543300007692EstuarineSKNPHASIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS*
Ga0114344_115065113300008111Freshwater, PlanktonNPHASIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS*
Ga0114351_129716613300008117Freshwater, PlanktonMVMEQMMTTKHDMAIFNLINEIADISTNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS*
Ga0114363_106933113300008266Freshwater, PlanktonRRLQTMKNQLSLNEPMPLYDVTTLDMAIKALQAHS*
Ga0114880_104420713300008450Freshwater LakeAVFSLIDDIMAMSKNPHASIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS*
Ga0114880_112037743300008450Freshwater LakeDMAIFNLINEIADISTNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS*
Ga0114880_125808713300008450Freshwater LakeHASIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS*
Ga0105098_1002159713300009081Freshwater SedimentIDQIADTQQNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS*
Ga0105098_1002541263300009081Freshwater SedimentIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS*
Ga0105103_1069987313300009085Freshwater SedimentSIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS*
Ga0114918_1066835513300009149Deep SubsurfaceQNTHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS*
Ga0114975_1073136213300009164Freshwater LakeAVSKNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS*
Ga0105104_1025784713300009168Freshwater SedimentQAMTTRHEMAIFDLINQIADTSTNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS*
Ga0105104_1076747713300009168Freshwater SedimentVLEQAMNKNHTMAIFGLIDQIADTQQNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS*
Ga0105097_1043848633300009169Freshwater SedimentQNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS*
Ga0114974_1012451013300009183Freshwater LakeEIMAVSKNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS*
Ga0114974_1069218123300009183Freshwater LakeMERNKMTIKHDMAIFDLINQIADTSTNPHASIIRRLRAMQNSLSLEDPMPLHDVTTLDLAIKALQAHS*
Ga0130019_103051923300009564Meromictic PondMAIFNLIDEIADTSRNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS*
Ga0129324_1025456633300010368Freshwater To Marine Saline GradientIRRLQTMKNQLSLNEPMPLHDVTTLDLAIKALQAHS*
Ga0129324_1026681813300010368Freshwater To Marine Saline GradientIADTRQNTHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS*
Ga0129324_1027302013300010368Freshwater To Marine Saline GradientNMAIFNLIDEIADTRQNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS*
Ga0129336_1061947623300010370Freshwater To Marine Saline GradientFNLIDEIANTSRNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS*
Ga0157608_102673113300012709FreshwaterISTNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS*
Ga0157598_118737813300012712FreshwaterADISTNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS*
Ga0157615_103394013300012734FreshwaterLMDDILAVSQNPHASIIRRLRTMKNQLSLNDPMPLYDVTTLDQAIKALEAHS*
Ga0157626_109300423300012759FreshwaterASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS*
Ga0164293_1086425023300013004FreshwaterDISTNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS*
Ga0164292_1037367233300013005FreshwaterPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS*
Ga0164292_1049559413300013005FreshwaterKLVLERTEMINHNMAIFNLIDEIADIRQNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS*
Ga0177922_1003395213300013372FreshwaterTMALVGLMNEIMAVNTNPHASIIRRLRTMKNSLSLNDPMPLYDVTTLDLAIKALEAHS*
Ga0177922_1063785423300013372FreshwaterFGLIDDIMAISKNPHASIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS*
Ga0181355_129195323300017785Freshwater LakeQAMNTNHTMAIFGLMDDILAVSKNPHASIIRRLRAMKNDLSLNDPMPLHDVTTLDLAIKALEAHS
Ga0181359_116827633300019784Freshwater LakeGLIDDIMAISKNPHASIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS
Ga0181359_126026913300019784Freshwater LakeMAIFNLMDDIMAISKNPHASIIRRLRAMKNQLSLNEPMPLHDVTTLDLAIKALEAHS
Ga0211736_1071665933300020151FreshwaterVLESSASASHTMAMFGLIDEIMAISKNPHASIIRRLRTMKNSLSLNDPMPLYDVTTLDLAIKALEAHS
Ga0211734_1046269853300020159FreshwaterLEQAMNTNHTMAVFSLMDEIANVSTNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS
Ga0222713_1041821513300021962Estuarine WaterSIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0222712_1048434133300021963Estuarine WaterLIDEIANVSKNPHASIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS
Ga0181353_110001833300022179Freshwater LakeSEILNPHASIIRRLRTMRNSLSLEDPTPVADVALLDRVIQILEAHS
Ga0228702_108246113300022748FreshwaterMAISKNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0208303_107611633300025543AqueousIDEIADTRQNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0208147_108726133300025635AqueousASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0208161_116822113300025646AqueousLIDEIADTRQNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0208795_104752013300025655AqueousLERTEMINHNMAIFNLIDEIADTSRNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0208019_112477233300025687AqueousHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0208019_119570613300025687AqueousSMAIFNLIDEIADIRQNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0208783_1003004363300025872AqueousAMFGLIDDIMAISKNPHASIIRRLRTMKNQLSLNDPMPLYDVTTLDLAIKALEAHS
Ga0208644_113289413300025889AqueousMASHTMAMFGLIDDIMAISKNPHASIIRRLRTMKNQLSLNDPMPLYDVTTLDLAIKALEAHS
Ga0208916_1023992733300025896AqueousNHTMALVGLMNEIMAVNTNPHASIIRRLRAMKNSLSLNDPMPLHDVTTLDLAIKALEAHS
Ga0255064_104726033300027138FreshwaterTNPHASIIRRLRAMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0255065_105443533300027142FreshwaterASIIRRLRAMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0255100_103443133300027152FreshwaterIEDIMAVSKNPHASIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS
Ga0208555_105349823300027213EstuarineEQAMNTNHTMAIFGLMDDILAVSKNPHASIIRRLRAMKNSLSLNDPMPLYDVTTLDLAIKALEAHS
Ga0255093_108375123300027492FreshwaterEMVNHTMAMFGLIDEIMNVSKNPHASIIQRLRVMKNSLSLEDPMPLYDVTTLDLAIKALQAHS
Ga0208788_102903313300027499Deep SubsurfaceTNPHASIIRRLRAMKNSLSLEDPMPLHDVTTLDLAIKALQAHS
Ga0255101_100615563300027588FreshwaterHTMAMFGLIDEIMNVSKNPHASIIQRLRVMKNSLSLEDPMPLYDVTTLDLAIKALQAHS
Ga0255088_101304053300027597FreshwaterIDDIMAVKKNPHASIIQRLKGMKNSLSLEDPMPLYDVTTLDLAIKALQAHS
Ga0209704_101072913300027693Freshwater SedimentIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0209296_116149133300027759Freshwater LakeGLIDEIMAVSKNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS
Ga0209353_1027849913300027798Freshwater LakeDLIDDIMAVKKNPHASIIQRLKGMKNSLSLEEPMPLYDVTTLDLAIKALQAHS
Ga0209668_1026215213300027899Freshwater Lake SedimentLAVSKNPHASIIRRLRTMKNQLSLNDPMPLYDVTTLDQAIKALEAHS
Ga0307378_1042769813300031566SoilDTRQNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0307378_1085910533300031566SoilIIKRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0307378_1109709913300031566SoilHNMAIFNLIDEIADTCQNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0307376_1042324343300031578SoilTRQNTHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0307376_1043261813300031578SoilHNMAIFNLIDEIADTRQNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0307375_1034184433300031669SoilIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0307375_1035531943300031669SoilRMVLEQAMQTNHTMAMFDLIDDIMAVKKNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS
Ga0307375_1079720323300031669SoilRTKMINHNMAIFNLIDEIADTRQNTHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0315909_1015883813300031857FreshwaterSIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS
Ga0315909_1060340523300031857FreshwaterRMVLEQTMTTRHDMAIFDLINQIADTSTNPHASIIQRLKTMKNQLSLEEPMPLYDVTTLDMAIKALQAHS
Ga0315904_1022147753300031951FreshwaterTNHTMAMFGLIDDIMAISKNPHASIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAH
Ga0315904_1052613433300031951FreshwaterTMAMFGLIDEIMAVSKNPHASIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS
Ga0315904_1146249023300031951FreshwaterHTMAIFSLMDDIMAISKNPHASIIRRLRAMKNQLSLNDPMPLHDVTTLDLAIKALEAHS
Ga0315902_1109220123300032093FreshwaterIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS
Ga0315275_1083095113300032401SedimentHTMAIFGLMDDILAVSKNPHASIIRRLRAMKNSLSLNDPMPLHDVTTLDLAIKALEAHS
Ga0334981_0315280_531_6893300033980FreshwaterLINEIADISTNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0334982_0076202_1647_18023300033981FreshwaterINEIADISTNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0334982_0526580_349_5073300033981FreshwaterLINEIADISTNPHASIIQRLKGMKNSMSLEEPMPLHDVTTLDLAIKALQAHS
Ga0335003_0364096_5_2143300033995FreshwaterMVLEQMMTTKHDMAIFDLINEIANVSTNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS
Ga0334979_0176443_5_1783300033996FreshwaterMAMFDLIDDIMAVKKNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS
Ga0334979_0218602_2_1453300033996FreshwaterMAISKNPHASIIRRLRTMKNQLSLNDPMPLYDVTTLDQAIKALEAHS
Ga0334979_0320081_1_1383300033996FreshwaterISTNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0334979_0725852_357_5153300033996FreshwaterLIDDILAISKNPHASIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS
Ga0334986_0211505_912_10703300034012FreshwaterLINQIADTSTNPHASIIRRLRAMKNSLSLEDPMPLHDVTTLDLAIKALQAHS
Ga0334986_0569329_3_1193300034012FreshwaterSIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0335005_0427977_568_7413300034022FreshwaterMAIFNLINEIADISTNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0334987_0754453_433_5493300034061FreshwaterSIIQRLKGMKNSLSLEEQMPLHDVTTLDLAIKALQAHS
Ga0334995_0096645_1_1443300034062FreshwaterADISTNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0334995_0170159_1409_15493300034062FreshwaterDISTNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS
Ga0334995_0253126_1020_11843300034062FreshwaterFNLINEIADISTNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0335019_0788546_391_5373300034066FreshwaterILAVSQNPHASIIRRLRTMKNQLSLNDPMPLYDVTTLDQAIKALEAHS
Ga0310130_0046259_1196_13063300034073Fracking WaterIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS
Ga0310130_0276262_356_5293300034073Fracking WaterMAIFNLIDEIADTSRNPHASIIRRLQTMKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0335010_0403404_533_7363300034092FreshwaterMEQMMTTKHDMAIFNLINEIADISTNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0335012_0135191_3_1703300034093FreshwaterIFNLINEIADISTNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS
Ga0335025_0368382_637_7503300034096FreshwaterIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0335025_0596891_336_5453300034096FreshwaterMVLEQTMNTNHTMAIFGLMDDILAVSKNPHASIIRRLRAMKNDLSLNDPMPLHDVTTLDLAIKALEAHS
Ga0335027_0590153_5_1483300034101FreshwaterMNVSKNPHGIIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS
Ga0335027_0781739_309_5183300034101FreshwaterMVMEQMMTTRHDMAIFNLINEIADISTNPHASIIQRLKSMKNSLSLEDPMPLHDVTTLDLAIKALQAHS
Ga0335030_0606819_503_6703300034103FreshwaterIFNLINEIADISTNPHASIIQRLKGMKNLLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0335036_0872806_26_2353300034106FreshwaterMVMEQMMTTKHDMAIFNLINEIADISTNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS
Ga0335066_0102410_1605_17993300034112FreshwaterMMTTRHDMAIFNLINEIADISTNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0335053_0272335_12_2063300034118FreshwaterMMTTKHDMAIFNLINEIADISTNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS
Ga0335053_0620987_3_1163300034118FreshwaterIIRRLRTMKNQLSLNDPMPLYDVTTLDQAIKALEAHS
Ga0335054_0737927_397_5253300034119FreshwaterNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0335058_0222696_3_1253300034121FreshwaterHASIIQRLKTKKNQLSLNEPMPLYDVTTLDLAIKALQAHS
Ga0335060_0078543_3_1643300034122FreshwaterNLINEIADISTNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0335060_0183679_1057_11973300034122FreshwaterAVSKNPHASIIRRLRTMKNSLSLNDPMPLYDVTTLDQAIKALEAHS
Ga0335060_0669998_14_2053300034122FreshwaterMQTNHTTAIMGLMDEIMAVSQNPHASIIQRLKTMKNQLSLEDPMPLHDVTTLDLAIKALQAHS
Ga0335049_0532135_632_7423300034272FreshwaterIRRLKTLKNQLSLEEPMPLHDVTTLDLAIKALSAHS
Ga0335049_0763688_394_5673300034272FreshwaterMAVFSLIDDIMAISKNPHASIIQRLKTMKNQLSLEDPMPLYDVTTLDLAIKALQAHS
Ga0335052_0128423_1305_15083300034279FreshwaterMEQMMTTKHDMAIFNLINEIAEISTNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0335052_0400017_3_1733300034279FreshwaterAIFNLINEIADISTNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0335013_0862154_2_1693300034284FreshwaterMFDLIDDIMAVKKNPHASIIQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS
Ga0335048_0321349_589_7923300034356FreshwaterMEQMMTSKHDMAIFNLINEIADISTNPHASIIQRLKGMKNSLSLEEPMPLHDVTTLDLAIKALQAHS
Ga0335048_0430814_538_6453300034356FreshwaterQRLKGMKNSLSLEDPMPLHDVTTLDLAIKALQAHS
Ga0335064_0111587_27_1823300034357FreshwaterMDEILAVSTNPHASLIRRLKTLKNQLSLEEPMPLHDVTTLDLAIKALSAHS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.