NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F054797

Metagenome Family F054797

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054797
Family Type Metagenome
Number of Sequences 139
Average Sequence Length 42 residues
Representative Sequence HPAVFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR
Number of Associated Samples 120
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.56 %
% of genes from short scaffolds (< 2000 bps) 86.33 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (39.568 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(16.547 % of family members)
Environment Ontology (ENVO) Unclassified
(47.482 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(55.396 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.00%    β-sheet: 0.00%    Coil/Unstructured: 70.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF06067DUF932 2.88
PF02467Whib 0.72



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.43 %
UnclassifiedrootN/A39.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2236876005|none_p065923All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage511Open in IMG/M
3300001282|B570J14230_10052473All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031347Open in IMG/M
3300001968|GOS2236_1009990All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage882Open in IMG/M
3300002161|JGI24766J26685_10012172All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4032275Open in IMG/M
3300002161|JGI24766J26685_10083760Not Available687Open in IMG/M
3300003393|JGI25909J50240_1009715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2346Open in IMG/M
3300003413|JGI25922J50271_10089811Not Available656Open in IMG/M
3300003430|JGI25921J50272_10028346All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031414Open in IMG/M
3300004054|Ga0063232_10274334Not Available512Open in IMG/M
3300004096|Ga0066177_10581403Not Available501Open in IMG/M
3300005517|Ga0070374_10627321Not Available533Open in IMG/M
3300005525|Ga0068877_10415457All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi756Open in IMG/M
3300005527|Ga0068876_10250612Not Available1016Open in IMG/M
3300005528|Ga0068872_10046066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2751Open in IMG/M
3300005528|Ga0068872_10059632All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4032361Open in IMG/M
3300005528|Ga0068872_10654933All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi553Open in IMG/M
3300005580|Ga0049083_10017164All Organisms → Viruses → Predicted Viral2615Open in IMG/M
3300005580|Ga0049083_10146174Not Available811Open in IMG/M
3300005581|Ga0049081_10205737All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi704Open in IMG/M
3300005583|Ga0049085_10147009Not Available796Open in IMG/M
3300005805|Ga0079957_1150210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031186Open in IMG/M
3300006005|Ga0073910_1009125All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403657Open in IMG/M
3300006641|Ga0075471_10336021All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi764Open in IMG/M
3300006641|Ga0075471_10484114Not Available614Open in IMG/M
3300006875|Ga0075473_10244730All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon725Open in IMG/M
3300007545|Ga0102873_1080469All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403989Open in IMG/M
3300007559|Ga0102828_1017020Not Available1547Open in IMG/M
3300007562|Ga0102915_1149408Not Available762Open in IMG/M
3300007590|Ga0102917_1291973Not Available563Open in IMG/M
3300007597|Ga0102919_1223820Not Available588Open in IMG/M
3300007622|Ga0102863_1051185All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031205Open in IMG/M
3300007627|Ga0102869_1072707Not Available951Open in IMG/M
3300008055|Ga0108970_11422131All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi1018Open in IMG/M
3300008107|Ga0114340_1230233Not Available585Open in IMG/M
3300008110|Ga0114343_1143731Not Available770Open in IMG/M
3300008113|Ga0114346_1161908Not Available942Open in IMG/M
3300008114|Ga0114347_1220258Not Available612Open in IMG/M
3300008116|Ga0114350_1193965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Frigoribacterium → unclassified Frigoribacterium → Frigoribacterium sp. CG_9.8508Open in IMG/M
3300008117|Ga0114351_1339072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage683Open in IMG/M
3300008117|Ga0114351_1386148All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage605Open in IMG/M
3300008117|Ga0114351_1436666All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi535Open in IMG/M
3300008118|Ga0114352_1019539All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031429Open in IMG/M
3300008120|Ga0114355_1146974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium843Open in IMG/M
3300008262|Ga0114337_1164095Not Available947Open in IMG/M
3300008263|Ga0114349_1120037All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031106Open in IMG/M
3300009026|Ga0102829_1177605Not Available687Open in IMG/M
3300009049|Ga0102911_1160875Not Available636Open in IMG/M
3300009057|Ga0102892_1048705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403798Open in IMG/M
3300009159|Ga0114978_10405745Not Available815Open in IMG/M
3300009180|Ga0114979_10591187Not Available635Open in IMG/M
3300009183|Ga0114974_10055207All Organisms → Viruses → Predicted Viral2649Open in IMG/M
3300009183|Ga0114974_10763207All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi521Open in IMG/M
3300009187|Ga0114972_10566410Not Available637Open in IMG/M
3300009194|Ga0114983_1030011All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031369Open in IMG/M
3300009419|Ga0114982_1103148Not Available881Open in IMG/M
3300010160|Ga0114967_10059266All Organisms → Viruses → Predicted Viral2370Open in IMG/M
3300010354|Ga0129333_10618637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403938Open in IMG/M
3300010354|Ga0129333_11592525Not Available533Open in IMG/M
3300010370|Ga0129336_10350278Not Available813Open in IMG/M
3300011009|Ga0129318_10090059All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi861Open in IMG/M
3300011011|Ga0139556_1032523All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi766Open in IMG/M
3300011268|Ga0151620_1039987All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1571Open in IMG/M
3300012665|Ga0157210_1034856Not Available783Open in IMG/M
3300014050|Ga0119952_1052648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031097Open in IMG/M
3300017701|Ga0181364_1010983All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031526Open in IMG/M
3300017761|Ga0181356_1173540All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403654Open in IMG/M
3300017766|Ga0181343_1110981Not Available775Open in IMG/M
3300017778|Ga0181349_1188150Not Available720Open in IMG/M
3300020048|Ga0207193_1262461Not Available1288Open in IMG/M
3300020151|Ga0211736_10767200Not Available1121Open in IMG/M
3300020161|Ga0211726_10588972All Organisms → Viruses → Predicted Viral2572Open in IMG/M
3300020162|Ga0211735_10223025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031829Open in IMG/M
3300020162|Ga0211735_11081370Not Available700Open in IMG/M
3300020205|Ga0211731_10174651All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1089Open in IMG/M
3300020490|Ga0208052_102452All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031627Open in IMG/M
3300021079|Ga0194055_10062563All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031837Open in IMG/M
3300021962|Ga0222713_10013468Not Available7191Open in IMG/M
3300021962|Ga0222713_10023101All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes5166Open in IMG/M
3300021962|Ga0222713_10242588All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031179Open in IMG/M
3300021963|Ga0222712_10064591All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2668Open in IMG/M
3300022198|Ga0196905_1021139All Organisms → Viruses → Predicted Viral2037Open in IMG/M
3300022407|Ga0181351_1083942All Organisms → Viruses → Predicted Viral1264Open in IMG/M
3300022747|Ga0228703_1117428Not Available602Open in IMG/M
3300024277|Ga0255207_1032749Not Available786Open in IMG/M
3300024346|Ga0244775_10517648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403973Open in IMG/M
3300024352|Ga0255142_1000575Not Available10581Open in IMG/M
3300024355|Ga0255157_1015688All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1349Open in IMG/M
3300024356|Ga0255169_1026313All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1073Open in IMG/M
3300024514|Ga0255177_1065350Not Available605Open in IMG/M
3300025585|Ga0208546_1032471All Organisms → Viruses → Predicted Viral1281Open in IMG/M
3300025848|Ga0208005_1076793All Organisms → Viruses → Predicted Viral1040Open in IMG/M
3300027121|Ga0255074_1043817Not Available556Open in IMG/M
3300027203|Ga0208925_116143Not Available537Open in IMG/M
3300027212|Ga0208554_1011046All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031457Open in IMG/M
3300027281|Ga0208440_1083380Not Available660Open in IMG/M
3300027365|Ga0209300_1008270All Organisms → Viruses → Predicted Viral3011Open in IMG/M
3300027467|Ga0255154_1041544Not Available1047Open in IMG/M
3300027486|Ga0255086_1050963Not Available661Open in IMG/M
3300027563|Ga0209552_1052343All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031156Open in IMG/M
3300027578|Ga0255075_1095895Not Available510Open in IMG/M
3300027593|Ga0255118_1030779All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403960Open in IMG/M
3300027659|Ga0208975_1063401All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031114Open in IMG/M
3300027688|Ga0209553_1052351Not Available1599Open in IMG/M
3300027712|Ga0209499_1117265All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403996Open in IMG/M
3300027754|Ga0209596_1057194All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4032004Open in IMG/M
3300027785|Ga0209246_10415255Not Available504Open in IMG/M
3300027793|Ga0209972_10478252Not Available515Open in IMG/M
3300027808|Ga0209354_10159922All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403918Open in IMG/M
3300027816|Ga0209990_10088400All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031516Open in IMG/M
3300027816|Ga0209990_10272090All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi765Open in IMG/M
3300027973|Ga0209298_10092237All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031332Open in IMG/M
3300028025|Ga0247723_1000641Not Available23057Open in IMG/M
3300028025|Ga0247723_1013950Not Available2949Open in IMG/M
3300028025|Ga0247723_1019794All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4032294Open in IMG/M
3300028073|Ga0255180_1082451Not Available584Open in IMG/M
3300028103|Ga0255172_1050043All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage768Open in IMG/M
3300028394|Ga0304730_1263962Not Available613Open in IMG/M
3300031758|Ga0315907_10196002All Organisms → Viruses → Predicted Viral1694Open in IMG/M
3300031758|Ga0315907_11143964All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi549Open in IMG/M
3300031784|Ga0315899_10994089All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi746Open in IMG/M
3300031786|Ga0315908_10476027All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031043Open in IMG/M
3300031857|Ga0315909_10235715All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031417Open in IMG/M
3300031857|Ga0315909_10575690Not Available759Open in IMG/M
3300031951|Ga0315904_10334455All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031402Open in IMG/M
3300032116|Ga0315903_11191179Not Available514Open in IMG/M
3300033978|Ga0334977_0180169All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031075Open in IMG/M
3300033978|Ga0334977_0183893All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031061Open in IMG/M
3300033996|Ga0334979_0530904Not Available633Open in IMG/M
3300034019|Ga0334998_0446818All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403732Open in IMG/M
3300034062|Ga0334995_0561898All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403671Open in IMG/M
3300034064|Ga0335001_0347113All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403804Open in IMG/M
3300034106|Ga0335036_0328299All Organisms → Viruses → Predicted Viral1007Open in IMG/M
3300034107|Ga0335037_0283335All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403903Open in IMG/M
3300034119|Ga0335054_0777012All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi507Open in IMG/M
3300034121|Ga0335058_0084709All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031850Open in IMG/M
3300034166|Ga0335016_0257022All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031096Open in IMG/M
3300034166|Ga0335016_0319233All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403942Open in IMG/M
3300034356|Ga0335048_0327970All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403783Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake16.55%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine10.07%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater9.35%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton8.63%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater8.63%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake7.19%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.76%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.04%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.32%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic3.60%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.88%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.88%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface2.16%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment2.16%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.44%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.44%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.72%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.72%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.72%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.72%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine0.72%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.72%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.72%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2236876005Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-3LG-ETM-15mEnvironmentalOpen in IMG/M
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300001968Marine microbial communities from Lake Gatun, Panama - GS020EnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300003413Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DDEnvironmentalOpen in IMG/M
3300003430Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SDEnvironmentalOpen in IMG/M
3300004054Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2)EnvironmentalOpen in IMG/M
3300004096Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)EnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005525Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaGEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005583Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRFEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006005Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007562Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02EnvironmentalOpen in IMG/M
3300007590Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02EnvironmentalOpen in IMG/M
3300007597Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02EnvironmentalOpen in IMG/M
3300007622Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02EnvironmentalOpen in IMG/M
3300007627Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02EnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008118Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-100-LTREnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008263Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTREnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009057Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009194Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RTEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300011009Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNAEnvironmentalOpen in IMG/M
3300011011Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300014050Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007BEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020490Freshwater microbial communities from Lake Mendota, WI - 18JUL2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021079Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9mEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022747Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MGEnvironmentalOpen in IMG/M
3300024277Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8dEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024352Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300024355Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8hEnvironmentalOpen in IMG/M
3300024356Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8dEnvironmentalOpen in IMG/M
3300024514Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8dEnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027121Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027203Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027212Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027217Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027281Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027365Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes)EnvironmentalOpen in IMG/M
3300027467Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8hEnvironmentalOpen in IMG/M
3300027486Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300027563Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027578Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8hEnvironmentalOpen in IMG/M
3300027593Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8hEnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027688Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027712Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027973Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028073Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8dEnvironmentalOpen in IMG/M
3300028103Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8dEnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034166Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
none_06592322236876005Marine EstuarineMLAIKTHPALFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPKFT
B570J14230_1005247333300001282FreshwaterASNKTHPAVFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFSSR*
GOS2236_100999033300001968MarineHPAVFSKMVVDFAEMFAKDNPRFDANRFYSAANYKIPNFAN*
JGI24766J26685_1001217273300002161Freshwater And SedimentHPAVFSKMVVDFAEMFAKDNPRFDANRFYTASNYKIPTFTN*
JGI24766J26685_1008376013300002161Freshwater And SedimentPALFSKIVNDFALMFAQDNPRFDVNRFHEASGYXVPXFTSR*
JGI25909J50240_100971593300003393Freshwater LakeHPAVFSKMVHDFAEMFAKDNERFDVTRFHEASGYNVPNFTSR*
JGI25922J50271_1008981133300003413Freshwater LakeSDKAHPALFSKIVNDFAVMFAQDNERFDVNRFHKACGYHVTKFTSR*
JGI25921J50272_1002834643300003430Freshwater LakeAVFSKIVNDFAEMFAVDNERFDVKRFHEASGYNVPNFTSR*
Ga0063232_1027433413300004054Freshwater LakeALFSKIVNDFAVMFAQDNERFDVNRFHKACGYHVTKFTSR*
Ga0066177_1058140313300004096Freshwater LakePALFSKMVNDFAEMFAKDNPRFDVVRFHEASNYKVKVGK*
Ga0070374_1062732123300005517Freshwater LakeHPALFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFTSR*
Ga0068877_1041545733300005525Freshwater LakeFSKIVNDFAEMFAKDNERFDVKRFHEASGYHVPNFSSR*
Ga0068876_1025061253300005527Freshwater LakeFSKIVNDFAEMFAKDNDRFDVVRFHKASNYKIPNFSS*
Ga0068872_1004606673300005528Freshwater LakeFSKMVVDFAEMFAKDNPRFDANRFYSASNYKIPSFRS*
Ga0068872_1005963263300005528Freshwater LakeVNDFAEMFAKDNPRFDVKRFHEASGYNVPNFSSR*
Ga0068872_1065493313300005528Freshwater LakeKTHPAVFSKMVNDFAEMFAKDNERFDVKRFHEASGYVIPKLTTR*
Ga0049083_1001716413300005580Freshwater LenticTHPALFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFTSR*
Ga0049083_1014617443300005580Freshwater LenticTHPALFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFSSR*
Ga0049081_1020573733300005581Freshwater LenticKVVNDFAEMFAKDNERFDVKRFHEASGYVIPKLTTR*
Ga0049085_1014700913300005583Freshwater LenticHPALFSKIVNDFAEMFAVDNPRFDITRFHKASGYNVPNFTSR*
Ga0079957_115021023300005805LakeYASNKIHPAVFSKVVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR*
Ga0073910_100912513300006005SandLFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPKFTSR*
Ga0075471_1033602133300006641AqueousFSKMVNDFAEMFAKDNPRFDVKRFHEASGYKLPTFTN*
Ga0075471_1048411423300006641AqueousFSKMVVDFALMFAKDNPKFDANKFYEASNYRVPKFTTN*
Ga0075473_1024473023300006875AqueousFSKMVNDFAEMFAKDNERFDVNRFHEASGYRVPKFTSN*
Ga0102873_108046913300007545EstuarineKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR*
Ga0102828_101702013300007559EstuarineKYASDKTHPALFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFSSR*
Ga0102915_114940813300007562EstuarinePAVFSKIVNDFAEMFAVDNERFDVKRFHEASGYNVPNFTSR*
Ga0102917_129197313300007590EstuarineKTHPAVFSKIVNDFAEMFAKDNERFDVSRFHKASGYDVPNFTSR*
Ga0102919_122382013300007597EstuarineMVNDFAEMFAKDNERFDVKRFHEASGYNVPKFTSR*
Ga0102863_105118513300007622EstuarineKYASNKIHPAVFSKIVNDFAEMFAKDNERFDVKRFHEASGYHVPNFSSR*
Ga0102869_107270713300007627EstuarinePALFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPKFTSR*
Ga0108970_1142213143300008055EstuaryKYASDKTHPALFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR*
Ga0114340_123023323300008107Freshwater, PlanktonVNDFAEMFAKDNERFDVKRFHEASGYHVPNFSSR*
Ga0114343_114373113300008110Freshwater, PlanktonFSKMVVDFALMFAKDNPKFDANRFYEASNYHVPKFTSH*
Ga0114346_116190843300008113Freshwater, PlanktonSKMVNDFAEMFAKDNERFDVARFHEASGYRVPNFS*
Ga0114347_122025823300008114Freshwater, PlanktonVNDFAEMFAKDNERFDVKRFHEASGYVVPNFSSR*
Ga0114350_119396513300008116Freshwater, PlanktonMSDKIHPAVFSKSVNDFAEMFAKDNPRFDVKKFHEASNYRVPQLRTN*
Ga0114351_133907213300008117Freshwater, PlanktonLFSKIVNDFAEMFAKDNDRFDVNRFHEASGYHVPKFTSR*
Ga0114351_138614813300008117Freshwater, PlanktonKVVVDFAVMFAKDNPKFDANKFYSASGYHVPNFSSR*
Ga0114351_143666613300008117Freshwater, PlanktonFSKMVNDFAEMFAKDNPRFDVKRFHEASGYNVPNFTSK*
Ga0114352_101953943300008118Freshwater, PlanktonFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFSSK*
Ga0114355_114697413300008120Freshwater, PlanktonPAVFSKIVNDFAEMFAKDNERFDVKRFHEASGYVIPNFSSR*
Ga0114337_116409543300008262Freshwater, PlanktonASNKTHPALFSKIVNDFAEMFAKDNPRFDVSRFHEASGYHVPNFTSR*
Ga0114349_112003713300008263Freshwater, PlanktonYASNKTHPALFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPNFSSK*
Ga0102829_117760513300009026EstuarineSDKTHPALFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFSSR*
Ga0102911_116087513300009049EstuarineMSNKTHPAVFSKVVNDFAEMFAKDNERFDVNRFHEASGYHVPNFSSR*
Ga0102892_104870513300009057EstuarineIHPAVFSKVVNDFAEMFAVDNERFDVKRFHEASGYNVPNFTSR*
Ga0114978_1040574533300009159Freshwater LakeLFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFSSR*
Ga0114979_1059118713300009180Freshwater LakeDKTHPALFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFSSR*
Ga0114974_1005520713300009183Freshwater LakeHPALFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFSSR*
Ga0114974_1076320723300009183Freshwater LakeKYASNKIHPAVFSKVVNDFAEMFAKDNERFDVTKFHEASGYRVPNFSSR*
Ga0114972_1056641013300009187Freshwater LakeAVFSKVVNDFAEMFAVDNERFDVKRFHEASGYNVPNFTSR*
Ga0114983_103001113300009194Deep SubsurfaceSDKTHPALFSKIVNDFAQMFAVDNPRFDVKRFHEASGYNVPNFTSR*
Ga0114982_110314843300009419Deep SubsurfacePALFSKIVNDFAEMFAKDNERFDVNRFHEASGYNVPKFTSR*
Ga0114967_1005926613300010160Freshwater LakeIHPAVFSKIVNDFAEMFAVDNERFDVKRFHEASNYNVPNFTSR*
Ga0129333_1061863713300010354Freshwater To Marine Saline GradientSNKTHPALFSKIVNDFAEMFAKDNPRFDVTKFHEASGYKVKTLTN*
Ga0129333_1159252523300010354Freshwater To Marine Saline GradientSDKTHPAVFSKMVNDFAEMFAKDNQRFDVVRFHKASNYHVPKFTSN*
Ga0129336_1035027833300010370Freshwater To Marine Saline GradientFSKMVNDFAEMFAKDNERFDVVRFHKASNYHVPKFTTN*
Ga0129318_1009005933300011009Freshwater To Marine Saline GradientAVFSKTVHDFAEMFAKDNERFDVKRFHEASGYHVPNFTSR*
Ga0139556_103252313300011011FreshwaterIHPAVFSKVVNDFAEMFAKDNERFDVKRFHEASGYVIPKLTTR*
Ga0151620_103998773300011268FreshwaterMQAIKRTPALFSKIVNDFAEMFAKDNPRFDVVRFHEASNYKVKVGK*
Ga0157210_103485613300012665FreshwaterFSYIVNEFAVYFANDNERFDVKRFHKASNYNVPQVTQ*
Ga0119952_105264813300014050FreshwaterKMHPALFSKMVNDFAEMFAKDNPRFDVKRFHEASGYKLPTFTN*
Ga0181364_101098313300017701Freshwater LakeRYASDKTHPALFSKIVNDFAEMFAVDNPRFDITRFHKARGYNVPNFTSR
Ga0181356_117354013300017761Freshwater LakeHPAVFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR
Ga0181343_111098113300017766Freshwater LakeSNKTHPALFSKMVNDFAQMFAVDNPRFDVKRFHEASGYNVPNFTSR
Ga0181349_118815023300017778Freshwater LakeLKYASDKTHPVLFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFTSR
Ga0207193_126246143300020048Freshwater Lake SedimentTHPALFSKMVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFTSR
Ga0211736_1076720013300020151FreshwaterHPALFSKIVNDFAEMFAKDNERFDVSRFHKASGYDVPNLTSR
Ga0211726_1058897213300020161FreshwaterKMVNDFAEMFAKDNDRFDVTRFHEACGYNVPNFSSR
Ga0211735_1022302513300020162FreshwaterKYASNKTHPALFSKIVNDFAEMFAKDNERFDVKRFHEASGYVIPKLTTR
Ga0211735_1108137013300020162FreshwaterIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFSSR
Ga0211731_1017465143300020205FreshwaterMSNKTHPALFSKVVHDFAEMFAKDNPRFDVTRFHEASNYTVKAVY
Ga0208052_10245233300020490FreshwaterPAVFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR
Ga0194055_1006256343300021079Anoxic Zone FreshwaterLKYASNKIHPAVFSKVVNDFAEMFAVDNERFDVIRFHEASGYNVPNFTSR
Ga0222713_1001346813300021962Estuarine WaterPALFSKIVNDFAEMFAKDNPRFDVKRFHEASNYHVPQFSK
Ga0222713_10023101123300021962Estuarine WaterLFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR
Ga0222713_1024258833300021962Estuarine WaterKNLSDKIHPALFSKTVVDFAMMFAKDNSNFDAKKFYDASGYYVPNFSSK
Ga0222712_1006459183300021963Estuarine WaterNKMHPALFSKVVNDFAEMFAKDNPRFDVSRFHEASNYKVKVG
Ga0196905_102113913300022198AqueousMVNDFAEMFAKDNPRFDVKRFHEASNYRVPKFTSN
Ga0181351_108394243300022407Freshwater LakeFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFTSR
Ga0228703_111742823300022747FreshwaterKMVNDFAEMFAKDNPRFDVKRFHEASGYNVPQFTS
Ga0255207_103274913300024277FreshwaterKTHPAIFSKMVNDFAEMFAKDNPKFDVKRFHEASNYRVPKFTAN
Ga0244775_1051764813300024346EstuarineVFSKMVNDFAEMFAKDNERFDVKRFHEASGYHVPKLTTR
Ga0255142_1000575273300024352FreshwaterSDKTHPAVFSKMVVDFAEMFARDNERFDATKFYSASNYKIPNFSN
Ga0255157_101568853300024355FreshwaterDKTHPAVFSKMVVDFAEMFAKDNPKFDAIKFYSASNYKIPSFRS
Ga0255169_102631353300024356FreshwaterAYVSDKTHPAVFSKMVVDFAEMFAKDNPRFDANRFYSAANYKIPNFAN
Ga0255177_106535013300024514FreshwaterPAVFSKMVIDFAEMFAKDNPRFDANKFYDASNYKLPKLGTKXNYQIKKE
Ga0208546_103247113300025585AqueousFSKMVVDFALMFAKDNPKFDANKFYEASNYRVPKFTTN
Ga0208005_107679333300025848AqueousKTHPAIFSKMVVDFALMFAKDNPKFDANKFYEASNYRVPKFTTN
Ga0255074_104381713300027121FreshwaterTHPALFSKMVNDFALMFAKENERFDVNKFHEACGYHVPKLSTK
Ga0208925_11614333300027203EstuarineSDKAHPALFSKIVNDFAVMFAQDNERFDVNRFHEACGYHVTKLTSR
Ga0208554_101104613300027212EstuarineKTHPAVFSKTVHDFAEMFAKDNERFDVKRFHEASGYHVPNFTSR
Ga0208928_103605513300027217EstuarineASDKTHPAVFSKMVNDFALIFAKENPNFNVNKFHEACGYHVPNLSSR
Ga0208440_108338023300027281EstuarineFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPKFTSR
Ga0209300_100827083300027365Deep SubsurfaceFSKIVNDFAQMFAVDNPRFDVKRFHEASGYNVPNFTSR
Ga0255154_104154413300027467FreshwaterHPAVFSKMVVDFAEMFAKDNPNFDAIKFYSASNYKIPSFRS
Ga0255086_105096313300027486FreshwaterALFSKIVNDFAEMFAKDNERFDVSRFHKASGYNVPNFTSR
Ga0209552_105234313300027563Freshwater LakeDKIHPAVFSKTVHDFAEMFAKDNERFDVSRFHKASNYRVPNFNSK
Ga0255075_109589523300027578FreshwaterDKTHPALFSKMVNDFALMFAKENERFDVNKFHEACGYHVPKLSTK
Ga0255118_103077933300027593FreshwaterFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR
Ga0208975_106340143300027659Freshwater LenticVFSKVVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR
Ga0209553_105235163300027688Freshwater LakeSDKTHPALFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPKFTSR
Ga0209499_111726523300027712Freshwater LakeFSKIVNDFAEMFAIDNERFDVKRFHEASGYNVPNFTSR
Ga0209596_105719413300027754Freshwater LakeSDKTHPALFSKIVNDFAEMFAVDNPRFDITRFHKASGYNVPNFTSR
Ga0209246_1041525523300027785Freshwater LakeDKTHPALFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFSSR
Ga0209972_1047825213300027793Freshwater LakeVFSKMVVDFAEMFAKDNPRFDANRFYSASNYKIPSFRS
Ga0209354_1015992243300027808Freshwater LakeFSKMVHDFAEMFAIDNERFDVKRFHEASGYNVPNFTSR
Ga0209990_1008840043300027816Freshwater LakeIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR
Ga0209990_1027209033300027816Freshwater LakeFSKMVNDFAEMFAKDNERFDVKRFHEASGYVVPNFSSR
Ga0209298_1009223743300027973Freshwater LakeSDKTHPALFSKVIVDFALMFAKDNPKFDANKFYKASGYHVPQFNSR
Ga0247723_1000641603300028025Deep Subsurface SedimentASNKTHPALFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR
Ga0247723_1013950103300028025Deep Subsurface SedimentASNKTHPALFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFSSR
Ga0247723_101979453300028025Deep Subsurface SedimentYASDKTHPAVFSKMVNDFAEMFAKDNERFDVKRFHEASGYHVPKFTSR
Ga0255180_108245113300028073FreshwaterKMVNDFAEMFAKDNPRFDVKRFHEASNYHVPKFTSR
Ga0255172_105004313300028103FreshwaterSDKTHPAVFSKMVVDFAEMFAKDNPRFDANRFYSAANYKIPTFSN
Ga0304730_126396223300028394Freshwater LakeHPAVFSKVVNDFAEMFAIDNERFDVKRFHEASGYNVPNFTSR
Ga0315907_1019600243300031758FreshwaterPAVFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR
Ga0315907_1114396423300031758FreshwaterKYASNKTHPAVFSKMVNDFAEMFAKDNERFDVKRFHEASGYVVPNFSSR
Ga0315899_1099408933300031784FreshwaterPALFSKMVNDFAEMFAKDNPRFDVKRFHEASGYNVPNFSSK
Ga0315908_1047602713300031786FreshwaterKLVHDFAEMFAKDNPRFDVTRFHEASNYNVPNFTSR
Ga0315909_1023571533300031857FreshwaterLKYQSNKIHPAVFSKVVNDFAEMFAKDNPRFDVKRFHEASGYHVPNFSSR
Ga0315909_1057569043300031857FreshwaterVSDKTHPAVFSKMVVDFAEMFAKDNPRFDANRFYSAANYKIPSFRS
Ga0315904_1033445533300031951FreshwaterKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFSSR
Ga0315903_1119117913300032116FreshwaterLKYQSNKIHPAVFSKVVNDFAEMFAKDNPRFDVKRFHEASGYNVPNFTSR
Ga0334977_0180169_2_1183300033978FreshwaterFSKVVNDFAEMFAKDNERFDVTRFHKASGYRVPNFSSK
Ga0334977_0183893_926_10603300033978FreshwaterKTHPAVFSKIVNDFAEMFAKDNERFDVKRFHEASGYHVPNFSSR
Ga0334979_0530904_1_1263300033996FreshwaterPALFSKIVNDFAVMFAKDNERFDVNRFHEACGYNVPKLSTR
Ga0334998_0446818_597_7313300034019FreshwaterKTHPAVFSKMVNDFAEMFAKDNPRFDVTRFHEASGYHVPKFSSK
Ga0334995_0561898_531_6713300034062FreshwaterSNKIHPAVFSKIVNDFAEMFAIDNERFDVKRFHEASGYNVPNFTSR
Ga0335001_0347113_3_1253300034064FreshwaterAVFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR
Ga0335036_0328299_2_1543300034106FreshwaterLKYASNKTHPAVFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR
Ga0335037_0283335_2_1423300034107FreshwaterSDKTHPAVFSKMVNDFAEMFAKDNERFDVKRFHEASGYHVPKFTSR
Ga0335054_0777012_382_5073300034119FreshwaterPAVFSKIVNDFAEMFAKDNERFDVKRFHEASGYHVPNFSSR
Ga0335058_0084709_2_1093300034121FreshwaterIVNDFAEMFAVDNPRFDVKRFHEASGYNVPKFTSR
Ga0335016_0257022_969_10943300034166FreshwaterPALFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPNFSSR
Ga0335016_0319233_795_9413300034166FreshwaterYISDKIHPAVFSKTVHDFAEMFAKDNERFDVSRFHKASGYHVPNFSSK
Ga0335048_0327970_634_7833300034356FreshwaterKYVSNKTHPAVFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.