Basic Information | |
---|---|
Family ID | F054797 |
Family Type | Metagenome |
Number of Sequences | 139 |
Average Sequence Length | 42 residues |
Representative Sequence | HPAVFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 139 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.56 % |
% of genes from short scaffolds (< 2000 bps) | 86.33 % |
Associated GOLD sequencing projects | 112 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (39.568 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (16.547 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.482 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.396 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.00% β-sheet: 0.00% Coil/Unstructured: 70.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 139 Family Scaffolds |
---|---|---|
PF06067 | DUF932 | 2.88 |
PF02467 | Whib | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.43 % |
Unclassified | root | N/A | 39.57 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2236876005|none_p065923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300001282|B570J14230_10052473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1347 | Open in IMG/M |
3300001968|GOS2236_1009990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
3300002161|JGI24766J26685_10012172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2275 | Open in IMG/M |
3300002161|JGI24766J26685_10083760 | Not Available | 687 | Open in IMG/M |
3300003393|JGI25909J50240_1009715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2346 | Open in IMG/M |
3300003413|JGI25922J50271_10089811 | Not Available | 656 | Open in IMG/M |
3300003430|JGI25921J50272_10028346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1414 | Open in IMG/M |
3300004054|Ga0063232_10274334 | Not Available | 512 | Open in IMG/M |
3300004096|Ga0066177_10581403 | Not Available | 501 | Open in IMG/M |
3300005517|Ga0070374_10627321 | Not Available | 533 | Open in IMG/M |
3300005525|Ga0068877_10415457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 756 | Open in IMG/M |
3300005527|Ga0068876_10250612 | Not Available | 1016 | Open in IMG/M |
3300005528|Ga0068872_10046066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2751 | Open in IMG/M |
3300005528|Ga0068872_10059632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2361 | Open in IMG/M |
3300005528|Ga0068872_10654933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 553 | Open in IMG/M |
3300005580|Ga0049083_10017164 | All Organisms → Viruses → Predicted Viral | 2615 | Open in IMG/M |
3300005580|Ga0049083_10146174 | Not Available | 811 | Open in IMG/M |
3300005581|Ga0049081_10205737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 704 | Open in IMG/M |
3300005583|Ga0049085_10147009 | Not Available | 796 | Open in IMG/M |
3300005805|Ga0079957_1150210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1186 | Open in IMG/M |
3300006005|Ga0073910_1009125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 657 | Open in IMG/M |
3300006641|Ga0075471_10336021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 764 | Open in IMG/M |
3300006641|Ga0075471_10484114 | Not Available | 614 | Open in IMG/M |
3300006875|Ga0075473_10244730 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 725 | Open in IMG/M |
3300007545|Ga0102873_1080469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 989 | Open in IMG/M |
3300007559|Ga0102828_1017020 | Not Available | 1547 | Open in IMG/M |
3300007562|Ga0102915_1149408 | Not Available | 762 | Open in IMG/M |
3300007590|Ga0102917_1291973 | Not Available | 563 | Open in IMG/M |
3300007597|Ga0102919_1223820 | Not Available | 588 | Open in IMG/M |
3300007622|Ga0102863_1051185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1205 | Open in IMG/M |
3300007627|Ga0102869_1072707 | Not Available | 951 | Open in IMG/M |
3300008055|Ga0108970_11422131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 1018 | Open in IMG/M |
3300008107|Ga0114340_1230233 | Not Available | 585 | Open in IMG/M |
3300008110|Ga0114343_1143731 | Not Available | 770 | Open in IMG/M |
3300008113|Ga0114346_1161908 | Not Available | 942 | Open in IMG/M |
3300008114|Ga0114347_1220258 | Not Available | 612 | Open in IMG/M |
3300008116|Ga0114350_1193965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Frigoribacterium → unclassified Frigoribacterium → Frigoribacterium sp. CG_9.8 | 508 | Open in IMG/M |
3300008117|Ga0114351_1339072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
3300008117|Ga0114351_1386148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300008117|Ga0114351_1436666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 535 | Open in IMG/M |
3300008118|Ga0114352_1019539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1429 | Open in IMG/M |
3300008120|Ga0114355_1146974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 843 | Open in IMG/M |
3300008262|Ga0114337_1164095 | Not Available | 947 | Open in IMG/M |
3300008263|Ga0114349_1120037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1106 | Open in IMG/M |
3300009026|Ga0102829_1177605 | Not Available | 687 | Open in IMG/M |
3300009049|Ga0102911_1160875 | Not Available | 636 | Open in IMG/M |
3300009057|Ga0102892_1048705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 798 | Open in IMG/M |
3300009159|Ga0114978_10405745 | Not Available | 815 | Open in IMG/M |
3300009180|Ga0114979_10591187 | Not Available | 635 | Open in IMG/M |
3300009183|Ga0114974_10055207 | All Organisms → Viruses → Predicted Viral | 2649 | Open in IMG/M |
3300009183|Ga0114974_10763207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 521 | Open in IMG/M |
3300009187|Ga0114972_10566410 | Not Available | 637 | Open in IMG/M |
3300009194|Ga0114983_1030011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1369 | Open in IMG/M |
3300009419|Ga0114982_1103148 | Not Available | 881 | Open in IMG/M |
3300010160|Ga0114967_10059266 | All Organisms → Viruses → Predicted Viral | 2370 | Open in IMG/M |
3300010354|Ga0129333_10618637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 938 | Open in IMG/M |
3300010354|Ga0129333_11592525 | Not Available | 533 | Open in IMG/M |
3300010370|Ga0129336_10350278 | Not Available | 813 | Open in IMG/M |
3300011009|Ga0129318_10090059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 861 | Open in IMG/M |
3300011011|Ga0139556_1032523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 766 | Open in IMG/M |
3300011268|Ga0151620_1039987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1571 | Open in IMG/M |
3300012665|Ga0157210_1034856 | Not Available | 783 | Open in IMG/M |
3300014050|Ga0119952_1052648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1097 | Open in IMG/M |
3300017701|Ga0181364_1010983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1526 | Open in IMG/M |
3300017761|Ga0181356_1173540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 654 | Open in IMG/M |
3300017766|Ga0181343_1110981 | Not Available | 775 | Open in IMG/M |
3300017778|Ga0181349_1188150 | Not Available | 720 | Open in IMG/M |
3300020048|Ga0207193_1262461 | Not Available | 1288 | Open in IMG/M |
3300020151|Ga0211736_10767200 | Not Available | 1121 | Open in IMG/M |
3300020161|Ga0211726_10588972 | All Organisms → Viruses → Predicted Viral | 2572 | Open in IMG/M |
3300020162|Ga0211735_10223025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1829 | Open in IMG/M |
3300020162|Ga0211735_11081370 | Not Available | 700 | Open in IMG/M |
3300020205|Ga0211731_10174651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1089 | Open in IMG/M |
3300020490|Ga0208052_102452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1627 | Open in IMG/M |
3300021079|Ga0194055_10062563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1837 | Open in IMG/M |
3300021962|Ga0222713_10013468 | Not Available | 7191 | Open in IMG/M |
3300021962|Ga0222713_10023101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5166 | Open in IMG/M |
3300021962|Ga0222713_10242588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1179 | Open in IMG/M |
3300021963|Ga0222712_10064591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2668 | Open in IMG/M |
3300022198|Ga0196905_1021139 | All Organisms → Viruses → Predicted Viral | 2037 | Open in IMG/M |
3300022407|Ga0181351_1083942 | All Organisms → Viruses → Predicted Viral | 1264 | Open in IMG/M |
3300022747|Ga0228703_1117428 | Not Available | 602 | Open in IMG/M |
3300024277|Ga0255207_1032749 | Not Available | 786 | Open in IMG/M |
3300024346|Ga0244775_10517648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 973 | Open in IMG/M |
3300024352|Ga0255142_1000575 | Not Available | 10581 | Open in IMG/M |
3300024355|Ga0255157_1015688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1349 | Open in IMG/M |
3300024356|Ga0255169_1026313 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1073 | Open in IMG/M |
3300024514|Ga0255177_1065350 | Not Available | 605 | Open in IMG/M |
3300025585|Ga0208546_1032471 | All Organisms → Viruses → Predicted Viral | 1281 | Open in IMG/M |
3300025848|Ga0208005_1076793 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
3300027121|Ga0255074_1043817 | Not Available | 556 | Open in IMG/M |
3300027203|Ga0208925_116143 | Not Available | 537 | Open in IMG/M |
3300027212|Ga0208554_1011046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1457 | Open in IMG/M |
3300027281|Ga0208440_1083380 | Not Available | 660 | Open in IMG/M |
3300027365|Ga0209300_1008270 | All Organisms → Viruses → Predicted Viral | 3011 | Open in IMG/M |
3300027467|Ga0255154_1041544 | Not Available | 1047 | Open in IMG/M |
3300027486|Ga0255086_1050963 | Not Available | 661 | Open in IMG/M |
3300027563|Ga0209552_1052343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1156 | Open in IMG/M |
3300027578|Ga0255075_1095895 | Not Available | 510 | Open in IMG/M |
3300027593|Ga0255118_1030779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 960 | Open in IMG/M |
3300027659|Ga0208975_1063401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1114 | Open in IMG/M |
3300027688|Ga0209553_1052351 | Not Available | 1599 | Open in IMG/M |
3300027712|Ga0209499_1117265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 996 | Open in IMG/M |
3300027754|Ga0209596_1057194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2004 | Open in IMG/M |
3300027785|Ga0209246_10415255 | Not Available | 504 | Open in IMG/M |
3300027793|Ga0209972_10478252 | Not Available | 515 | Open in IMG/M |
3300027808|Ga0209354_10159922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 918 | Open in IMG/M |
3300027816|Ga0209990_10088400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1516 | Open in IMG/M |
3300027816|Ga0209990_10272090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 765 | Open in IMG/M |
3300027973|Ga0209298_10092237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1332 | Open in IMG/M |
3300028025|Ga0247723_1000641 | Not Available | 23057 | Open in IMG/M |
3300028025|Ga0247723_1013950 | Not Available | 2949 | Open in IMG/M |
3300028025|Ga0247723_1019794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2294 | Open in IMG/M |
3300028073|Ga0255180_1082451 | Not Available | 584 | Open in IMG/M |
3300028103|Ga0255172_1050043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
3300028394|Ga0304730_1263962 | Not Available | 613 | Open in IMG/M |
3300031758|Ga0315907_10196002 | All Organisms → Viruses → Predicted Viral | 1694 | Open in IMG/M |
3300031758|Ga0315907_11143964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 549 | Open in IMG/M |
3300031784|Ga0315899_10994089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 746 | Open in IMG/M |
3300031786|Ga0315908_10476027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1043 | Open in IMG/M |
3300031857|Ga0315909_10235715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1417 | Open in IMG/M |
3300031857|Ga0315909_10575690 | Not Available | 759 | Open in IMG/M |
3300031951|Ga0315904_10334455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1402 | Open in IMG/M |
3300032116|Ga0315903_11191179 | Not Available | 514 | Open in IMG/M |
3300033978|Ga0334977_0180169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1075 | Open in IMG/M |
3300033978|Ga0334977_0183893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1061 | Open in IMG/M |
3300033996|Ga0334979_0530904 | Not Available | 633 | Open in IMG/M |
3300034019|Ga0334998_0446818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 732 | Open in IMG/M |
3300034062|Ga0334995_0561898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 671 | Open in IMG/M |
3300034064|Ga0335001_0347113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 804 | Open in IMG/M |
3300034106|Ga0335036_0328299 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
3300034107|Ga0335037_0283335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 903 | Open in IMG/M |
3300034119|Ga0335054_0777012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 507 | Open in IMG/M |
3300034121|Ga0335058_0084709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1850 | Open in IMG/M |
3300034166|Ga0335016_0257022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1096 | Open in IMG/M |
3300034166|Ga0335016_0319233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 942 | Open in IMG/M |
3300034356|Ga0335048_0327970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 783 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.55% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 10.07% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.35% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.63% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 8.63% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.19% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.76% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.04% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.32% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.60% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.88% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.88% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.16% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.16% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.44% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.44% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.72% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.72% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.72% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.72% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.72% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.72% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.72% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.72% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.72% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.72% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2236876005 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-3LG-ETM-15m | Environmental | Open in IMG/M |
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006005 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008118 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-100-LTR | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
3300009057 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020490 | Freshwater microbial communities from Lake Mendota, WI - 18JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021079 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9m | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300024277 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8d | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
3300024355 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300024356 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d | Environmental | Open in IMG/M |
3300024514 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027203 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027217 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027281 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027467 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h | Environmental | Open in IMG/M |
3300027486 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
3300027593 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028073 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8d | Environmental | Open in IMG/M |
3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
none_0659232 | 2236876005 | Marine Estuarine | MLAIKTHPALFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPKFT |
B570J14230_100524733 | 3300001282 | Freshwater | ASNKTHPAVFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFSSR* |
GOS2236_10099903 | 3300001968 | Marine | HPAVFSKMVVDFAEMFAKDNPRFDANRFYSAANYKIPNFAN* |
JGI24766J26685_100121727 | 3300002161 | Freshwater And Sediment | HPAVFSKMVVDFAEMFAKDNPRFDANRFYTASNYKIPTFTN* |
JGI24766J26685_100837601 | 3300002161 | Freshwater And Sediment | PALFSKIVNDFALMFAQDNPRFDVNRFHEASGYXVPXFTSR* |
JGI25909J50240_10097159 | 3300003393 | Freshwater Lake | HPAVFSKMVHDFAEMFAKDNERFDVTRFHEASGYNVPNFTSR* |
JGI25922J50271_100898113 | 3300003413 | Freshwater Lake | SDKAHPALFSKIVNDFAVMFAQDNERFDVNRFHKACGYHVTKFTSR* |
JGI25921J50272_100283464 | 3300003430 | Freshwater Lake | AVFSKIVNDFAEMFAVDNERFDVKRFHEASGYNVPNFTSR* |
Ga0063232_102743341 | 3300004054 | Freshwater Lake | ALFSKIVNDFAVMFAQDNERFDVNRFHKACGYHVTKFTSR* |
Ga0066177_105814031 | 3300004096 | Freshwater Lake | PALFSKMVNDFAEMFAKDNPRFDVVRFHEASNYKVKVGK* |
Ga0070374_106273212 | 3300005517 | Freshwater Lake | HPALFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFTSR* |
Ga0068877_104154573 | 3300005525 | Freshwater Lake | FSKIVNDFAEMFAKDNERFDVKRFHEASGYHVPNFSSR* |
Ga0068876_102506125 | 3300005527 | Freshwater Lake | FSKIVNDFAEMFAKDNDRFDVVRFHKASNYKIPNFSS* |
Ga0068872_100460667 | 3300005528 | Freshwater Lake | FSKMVVDFAEMFAKDNPRFDANRFYSASNYKIPSFRS* |
Ga0068872_100596326 | 3300005528 | Freshwater Lake | VNDFAEMFAKDNPRFDVKRFHEASGYNVPNFSSR* |
Ga0068872_106549331 | 3300005528 | Freshwater Lake | KTHPAVFSKMVNDFAEMFAKDNERFDVKRFHEASGYVIPKLTTR* |
Ga0049083_100171641 | 3300005580 | Freshwater Lentic | THPALFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFTSR* |
Ga0049083_101461744 | 3300005580 | Freshwater Lentic | THPALFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFSSR* |
Ga0049081_102057373 | 3300005581 | Freshwater Lentic | KVVNDFAEMFAKDNERFDVKRFHEASGYVIPKLTTR* |
Ga0049085_101470091 | 3300005583 | Freshwater Lentic | HPALFSKIVNDFAEMFAVDNPRFDITRFHKASGYNVPNFTSR* |
Ga0079957_11502102 | 3300005805 | Lake | YASNKIHPAVFSKVVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR* |
Ga0073910_10091251 | 3300006005 | Sand | LFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPKFTSR* |
Ga0075471_103360213 | 3300006641 | Aqueous | FSKMVNDFAEMFAKDNPRFDVKRFHEASGYKLPTFTN* |
Ga0075471_104841142 | 3300006641 | Aqueous | FSKMVVDFALMFAKDNPKFDANKFYEASNYRVPKFTTN* |
Ga0075473_102447302 | 3300006875 | Aqueous | FSKMVNDFAEMFAKDNERFDVNRFHEASGYRVPKFTSN* |
Ga0102873_10804691 | 3300007545 | Estuarine | KIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR* |
Ga0102828_10170201 | 3300007559 | Estuarine | KYASDKTHPALFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFSSR* |
Ga0102915_11494081 | 3300007562 | Estuarine | PAVFSKIVNDFAEMFAVDNERFDVKRFHEASGYNVPNFTSR* |
Ga0102917_12919731 | 3300007590 | Estuarine | KTHPAVFSKIVNDFAEMFAKDNERFDVSRFHKASGYDVPNFTSR* |
Ga0102919_12238201 | 3300007597 | Estuarine | MVNDFAEMFAKDNERFDVKRFHEASGYNVPKFTSR* |
Ga0102863_10511851 | 3300007622 | Estuarine | KYASNKIHPAVFSKIVNDFAEMFAKDNERFDVKRFHEASGYHVPNFSSR* |
Ga0102869_10727071 | 3300007627 | Estuarine | PALFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPKFTSR* |
Ga0108970_114221314 | 3300008055 | Estuary | KYASDKTHPALFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR* |
Ga0114340_12302332 | 3300008107 | Freshwater, Plankton | VNDFAEMFAKDNERFDVKRFHEASGYHVPNFSSR* |
Ga0114343_11437311 | 3300008110 | Freshwater, Plankton | FSKMVVDFALMFAKDNPKFDANRFYEASNYHVPKFTSH* |
Ga0114346_11619084 | 3300008113 | Freshwater, Plankton | SKMVNDFAEMFAKDNERFDVARFHEASGYRVPNFS* |
Ga0114347_12202582 | 3300008114 | Freshwater, Plankton | VNDFAEMFAKDNERFDVKRFHEASGYVVPNFSSR* |
Ga0114350_11939651 | 3300008116 | Freshwater, Plankton | MSDKIHPAVFSKSVNDFAEMFAKDNPRFDVKKFHEASNYRVPQLRTN* |
Ga0114351_13390721 | 3300008117 | Freshwater, Plankton | LFSKIVNDFAEMFAKDNDRFDVNRFHEASGYHVPKFTSR* |
Ga0114351_13861481 | 3300008117 | Freshwater, Plankton | KVVVDFAVMFAKDNPKFDANKFYSASGYHVPNFSSR* |
Ga0114351_14366661 | 3300008117 | Freshwater, Plankton | FSKMVNDFAEMFAKDNPRFDVKRFHEASGYNVPNFTSK* |
Ga0114352_10195394 | 3300008118 | Freshwater, Plankton | FSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFSSK* |
Ga0114355_11469741 | 3300008120 | Freshwater, Plankton | PAVFSKIVNDFAEMFAKDNERFDVKRFHEASGYVIPNFSSR* |
Ga0114337_11640954 | 3300008262 | Freshwater, Plankton | ASNKTHPALFSKIVNDFAEMFAKDNPRFDVSRFHEASGYHVPNFTSR* |
Ga0114349_11200371 | 3300008263 | Freshwater, Plankton | YASNKTHPALFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPNFSSK* |
Ga0102829_11776051 | 3300009026 | Estuarine | SDKTHPALFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFSSR* |
Ga0102911_11608751 | 3300009049 | Estuarine | MSNKTHPAVFSKVVNDFAEMFAKDNERFDVNRFHEASGYHVPNFSSR* |
Ga0102892_10487051 | 3300009057 | Estuarine | IHPAVFSKVVNDFAEMFAVDNERFDVKRFHEASGYNVPNFTSR* |
Ga0114978_104057453 | 3300009159 | Freshwater Lake | LFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFSSR* |
Ga0114979_105911871 | 3300009180 | Freshwater Lake | DKTHPALFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFSSR* |
Ga0114974_100552071 | 3300009183 | Freshwater Lake | HPALFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFSSR* |
Ga0114974_107632072 | 3300009183 | Freshwater Lake | KYASNKIHPAVFSKVVNDFAEMFAKDNERFDVTKFHEASGYRVPNFSSR* |
Ga0114972_105664101 | 3300009187 | Freshwater Lake | AVFSKVVNDFAEMFAVDNERFDVKRFHEASGYNVPNFTSR* |
Ga0114983_10300111 | 3300009194 | Deep Subsurface | SDKTHPALFSKIVNDFAQMFAVDNPRFDVKRFHEASGYNVPNFTSR* |
Ga0114982_11031484 | 3300009419 | Deep Subsurface | PALFSKIVNDFAEMFAKDNERFDVNRFHEASGYNVPKFTSR* |
Ga0114967_100592661 | 3300010160 | Freshwater Lake | IHPAVFSKIVNDFAEMFAVDNERFDVKRFHEASNYNVPNFTSR* |
Ga0129333_106186371 | 3300010354 | Freshwater To Marine Saline Gradient | SNKTHPALFSKIVNDFAEMFAKDNPRFDVTKFHEASGYKVKTLTN* |
Ga0129333_115925252 | 3300010354 | Freshwater To Marine Saline Gradient | SDKTHPAVFSKMVNDFAEMFAKDNQRFDVVRFHKASNYHVPKFTSN* |
Ga0129336_103502783 | 3300010370 | Freshwater To Marine Saline Gradient | FSKMVNDFAEMFAKDNERFDVVRFHKASNYHVPKFTTN* |
Ga0129318_100900593 | 3300011009 | Freshwater To Marine Saline Gradient | AVFSKTVHDFAEMFAKDNERFDVKRFHEASGYHVPNFTSR* |
Ga0139556_10325231 | 3300011011 | Freshwater | IHPAVFSKVVNDFAEMFAKDNERFDVKRFHEASGYVIPKLTTR* |
Ga0151620_10399877 | 3300011268 | Freshwater | MQAIKRTPALFSKIVNDFAEMFAKDNPRFDVVRFHEASNYKVKVGK* |
Ga0157210_10348561 | 3300012665 | Freshwater | FSYIVNEFAVYFANDNERFDVKRFHKASNYNVPQVTQ* |
Ga0119952_10526481 | 3300014050 | Freshwater | KMHPALFSKMVNDFAEMFAKDNPRFDVKRFHEASGYKLPTFTN* |
Ga0181364_10109831 | 3300017701 | Freshwater Lake | RYASDKTHPALFSKIVNDFAEMFAVDNPRFDITRFHKARGYNVPNFTSR |
Ga0181356_11735401 | 3300017761 | Freshwater Lake | HPAVFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR |
Ga0181343_11109811 | 3300017766 | Freshwater Lake | SNKTHPALFSKMVNDFAQMFAVDNPRFDVKRFHEASGYNVPNFTSR |
Ga0181349_11881502 | 3300017778 | Freshwater Lake | LKYASDKTHPVLFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFTSR |
Ga0207193_12624614 | 3300020048 | Freshwater Lake Sediment | THPALFSKMVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFTSR |
Ga0211736_107672001 | 3300020151 | Freshwater | HPALFSKIVNDFAEMFAKDNERFDVSRFHKASGYDVPNLTSR |
Ga0211726_105889721 | 3300020161 | Freshwater | KMVNDFAEMFAKDNDRFDVTRFHEACGYNVPNFSSR |
Ga0211735_102230251 | 3300020162 | Freshwater | KYASNKTHPALFSKIVNDFAEMFAKDNERFDVKRFHEASGYVIPKLTTR |
Ga0211735_110813701 | 3300020162 | Freshwater | IVNDFAEMFAKDNERFDVKRFHEASGYNVPNFSSR |
Ga0211731_101746514 | 3300020205 | Freshwater | MSNKTHPALFSKVVHDFAEMFAKDNPRFDVTRFHEASNYTVKAVY |
Ga0208052_1024523 | 3300020490 | Freshwater | PAVFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR |
Ga0194055_100625634 | 3300021079 | Anoxic Zone Freshwater | LKYASNKIHPAVFSKVVNDFAEMFAVDNERFDVIRFHEASGYNVPNFTSR |
Ga0222713_100134681 | 3300021962 | Estuarine Water | PALFSKIVNDFAEMFAKDNPRFDVKRFHEASNYHVPQFSK |
Ga0222713_1002310112 | 3300021962 | Estuarine Water | LFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR |
Ga0222713_102425883 | 3300021962 | Estuarine Water | KNLSDKIHPALFSKTVVDFAMMFAKDNSNFDAKKFYDASGYYVPNFSSK |
Ga0222712_100645918 | 3300021963 | Estuarine Water | NKMHPALFSKVVNDFAEMFAKDNPRFDVSRFHEASNYKVKVG |
Ga0196905_10211391 | 3300022198 | Aqueous | MVNDFAEMFAKDNPRFDVKRFHEASNYRVPKFTSN |
Ga0181351_10839424 | 3300022407 | Freshwater Lake | FSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFTSR |
Ga0228703_11174282 | 3300022747 | Freshwater | KMVNDFAEMFAKDNPRFDVKRFHEASGYNVPQFTS |
Ga0255207_10327491 | 3300024277 | Freshwater | KTHPAIFSKMVNDFAEMFAKDNPKFDVKRFHEASNYRVPKFTAN |
Ga0244775_105176481 | 3300024346 | Estuarine | VFSKMVNDFAEMFAKDNERFDVKRFHEASGYHVPKLTTR |
Ga0255142_100057527 | 3300024352 | Freshwater | SDKTHPAVFSKMVVDFAEMFARDNERFDATKFYSASNYKIPNFSN |
Ga0255157_10156885 | 3300024355 | Freshwater | DKTHPAVFSKMVVDFAEMFAKDNPKFDAIKFYSASNYKIPSFRS |
Ga0255169_10263135 | 3300024356 | Freshwater | AYVSDKTHPAVFSKMVVDFAEMFAKDNPRFDANRFYSAANYKIPNFAN |
Ga0255177_10653501 | 3300024514 | Freshwater | PAVFSKMVIDFAEMFAKDNPRFDANKFYDASNYKLPKLGTKXNYQIKKE |
Ga0208546_10324711 | 3300025585 | Aqueous | FSKMVVDFALMFAKDNPKFDANKFYEASNYRVPKFTTN |
Ga0208005_10767933 | 3300025848 | Aqueous | KTHPAIFSKMVVDFALMFAKDNPKFDANKFYEASNYRVPKFTTN |
Ga0255074_10438171 | 3300027121 | Freshwater | THPALFSKMVNDFALMFAKENERFDVNKFHEACGYHVPKLSTK |
Ga0208925_1161433 | 3300027203 | Estuarine | SDKAHPALFSKIVNDFAVMFAQDNERFDVNRFHEACGYHVTKLTSR |
Ga0208554_10110461 | 3300027212 | Estuarine | KTHPAVFSKTVHDFAEMFAKDNERFDVKRFHEASGYHVPNFTSR |
Ga0208928_10360551 | 3300027217 | Estuarine | ASDKTHPAVFSKMVNDFALIFAKENPNFNVNKFHEACGYHVPNLSSR |
Ga0208440_10833802 | 3300027281 | Estuarine | FSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPKFTSR |
Ga0209300_10082708 | 3300027365 | Deep Subsurface | FSKIVNDFAQMFAVDNPRFDVKRFHEASGYNVPNFTSR |
Ga0255154_10415441 | 3300027467 | Freshwater | HPAVFSKMVVDFAEMFAKDNPNFDAIKFYSASNYKIPSFRS |
Ga0255086_10509631 | 3300027486 | Freshwater | ALFSKIVNDFAEMFAKDNERFDVSRFHKASGYNVPNFTSR |
Ga0209552_10523431 | 3300027563 | Freshwater Lake | DKIHPAVFSKTVHDFAEMFAKDNERFDVSRFHKASNYRVPNFNSK |
Ga0255075_10958952 | 3300027578 | Freshwater | DKTHPALFSKMVNDFALMFAKENERFDVNKFHEACGYHVPKLSTK |
Ga0255118_10307793 | 3300027593 | Freshwater | FSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR |
Ga0208975_10634014 | 3300027659 | Freshwater Lentic | VFSKVVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR |
Ga0209553_10523516 | 3300027688 | Freshwater Lake | SDKTHPALFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPKFTSR |
Ga0209499_11172652 | 3300027712 | Freshwater Lake | FSKIVNDFAEMFAIDNERFDVKRFHEASGYNVPNFTSR |
Ga0209596_10571941 | 3300027754 | Freshwater Lake | SDKTHPALFSKIVNDFAEMFAVDNPRFDITRFHKASGYNVPNFTSR |
Ga0209246_104152552 | 3300027785 | Freshwater Lake | DKTHPALFSKIVNDFAEMFAVDNPRFDVNRFHEASGYNVPKFSSR |
Ga0209972_104782521 | 3300027793 | Freshwater Lake | VFSKMVVDFAEMFAKDNPRFDANRFYSASNYKIPSFRS |
Ga0209354_101599224 | 3300027808 | Freshwater Lake | FSKMVHDFAEMFAIDNERFDVKRFHEASGYNVPNFTSR |
Ga0209990_100884004 | 3300027816 | Freshwater Lake | IVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR |
Ga0209990_102720903 | 3300027816 | Freshwater Lake | FSKMVNDFAEMFAKDNERFDVKRFHEASGYVVPNFSSR |
Ga0209298_100922374 | 3300027973 | Freshwater Lake | SDKTHPALFSKVIVDFALMFAKDNPKFDANKFYKASGYHVPQFNSR |
Ga0247723_100064160 | 3300028025 | Deep Subsurface Sediment | ASNKTHPALFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR |
Ga0247723_101395010 | 3300028025 | Deep Subsurface Sediment | ASNKTHPALFSKIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFSSR |
Ga0247723_10197945 | 3300028025 | Deep Subsurface Sediment | YASDKTHPAVFSKMVNDFAEMFAKDNERFDVKRFHEASGYHVPKFTSR |
Ga0255180_10824511 | 3300028073 | Freshwater | KMVNDFAEMFAKDNPRFDVKRFHEASNYHVPKFTSR |
Ga0255172_10500431 | 3300028103 | Freshwater | SDKTHPAVFSKMVVDFAEMFAKDNPRFDANRFYSAANYKIPTFSN |
Ga0304730_12639622 | 3300028394 | Freshwater Lake | HPAVFSKVVNDFAEMFAIDNERFDVKRFHEASGYNVPNFTSR |
Ga0315907_101960024 | 3300031758 | Freshwater | PAVFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR |
Ga0315907_111439642 | 3300031758 | Freshwater | KYASNKTHPAVFSKMVNDFAEMFAKDNERFDVKRFHEASGYVVPNFSSR |
Ga0315899_109940893 | 3300031784 | Freshwater | PALFSKMVNDFAEMFAKDNPRFDVKRFHEASGYNVPNFSSK |
Ga0315908_104760271 | 3300031786 | Freshwater | KLVHDFAEMFAKDNPRFDVTRFHEASNYNVPNFTSR |
Ga0315909_102357153 | 3300031857 | Freshwater | LKYQSNKIHPAVFSKVVNDFAEMFAKDNPRFDVKRFHEASGYHVPNFSSR |
Ga0315909_105756904 | 3300031857 | Freshwater | VSDKTHPAVFSKMVVDFAEMFAKDNPRFDANRFYSAANYKIPSFRS |
Ga0315904_103344553 | 3300031951 | Freshwater | KIVNDFAEMFAKDNERFDVKRFHEASGYNVPNFSSR |
Ga0315903_111911791 | 3300032116 | Freshwater | LKYQSNKIHPAVFSKVVNDFAEMFAKDNPRFDVKRFHEASGYNVPNFTSR |
Ga0334977_0180169_2_118 | 3300033978 | Freshwater | FSKVVNDFAEMFAKDNERFDVTRFHKASGYRVPNFSSK |
Ga0334977_0183893_926_1060 | 3300033978 | Freshwater | KTHPAVFSKIVNDFAEMFAKDNERFDVKRFHEASGYHVPNFSSR |
Ga0334979_0530904_1_126 | 3300033996 | Freshwater | PALFSKIVNDFAVMFAKDNERFDVNRFHEACGYNVPKLSTR |
Ga0334998_0446818_597_731 | 3300034019 | Freshwater | KTHPAVFSKMVNDFAEMFAKDNPRFDVTRFHEASGYHVPKFSSK |
Ga0334995_0561898_531_671 | 3300034062 | Freshwater | SNKIHPAVFSKIVNDFAEMFAIDNERFDVKRFHEASGYNVPNFTSR |
Ga0335001_0347113_3_125 | 3300034064 | Freshwater | AVFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR |
Ga0335036_0328299_2_154 | 3300034106 | Freshwater | LKYASNKTHPAVFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR |
Ga0335037_0283335_2_142 | 3300034107 | Freshwater | SDKTHPAVFSKMVNDFAEMFAKDNERFDVKRFHEASGYHVPKFTSR |
Ga0335054_0777012_382_507 | 3300034119 | Freshwater | PAVFSKIVNDFAEMFAKDNERFDVKRFHEASGYHVPNFSSR |
Ga0335058_0084709_2_109 | 3300034121 | Freshwater | IVNDFAEMFAVDNPRFDVKRFHEASGYNVPKFTSR |
Ga0335016_0257022_969_1094 | 3300034166 | Freshwater | PALFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPNFSSR |
Ga0335016_0319233_795_941 | 3300034166 | Freshwater | YISDKIHPAVFSKTVHDFAEMFAKDNERFDVSRFHKASGYHVPNFSSK |
Ga0335048_0327970_634_783 | 3300034356 | Freshwater | KYVSNKTHPAVFSKMVNDFAEMFAKDNERFDVKRFHEASGYNVPNFTSR |
⦗Top⦘ |